HHsearch alignment for GI: 255764482 and conserved domain: PRK13168

>PRK13168 rumA 23S rRNA 5-methyluridine methyltransferase; Reviewed.
Probab=99.63  E-value=4e-14  Score=98.89  Aligned_cols=151  Identities=13%  Similarity=0.119  Sum_probs=113.3

Q ss_pred             HHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC
Q ss_conf             43899855789995878438999999867998899998898999988999998066452225302004442353100001
Q gi|255764482|r    5 SLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA   84 (225)
Q Consensus         5 ~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~   84 (225)
T Consensus       288 ~~l~~~~~~~VlDLYcGvGtfsl~LA~~--~~~V~gvE~~~~av~~A~~Na~~n~i~n----~~f~~~d~~~~l~~~~--  359 (440)
T PRK13168        288 EWLDPQPGDRVLDLFCGLGNFTLPLARQ--AAEVVGVEGVPAMVERARENARRNGLDN----VTFYHANLFEDFTDQP--  359 (440)
T ss_pred             HHHCCCCCCEEEEEECCCCCCCHHHHHC--CCEEEEEECCHHHHHHHHHHHHHCCCCC----CEEEECCHHHHHHHHH--
T ss_conf             9852678988998623856211113530--6768876057999999999999749998----7899746456635578--


Q ss_pred             CCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHH-HCCCCC
Q ss_conf             2357652057722654464465478854556520566898999999998624698378702888899999985-217884
Q gi|255764482|r   85 GLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGS  163 (225)
Q Consensus        85 ~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~~l~~~l~~~-~~~~~~  163 (225)
T Consensus       360 -~~~~~~D~vi~DPPR-----------------~G----~~~~i~~l~~-~~p~~IvYVSCnPaTlARDl~~L~~~GY~l  416 (440)
T PRK13168        360 -WAKGGFDKVLLDPPR-----------------AG----AFEVMQALAK-LKPKRIVYVSCNPATLARDAGVLVEAGYRL  416 (440)
T ss_pred             -HHCCCCCEEEECCCC-----------------CC----HHHHHHHHHH-CCCCEEEEECCCHHHHHHHHHHHHHCCCEE
T ss_conf             -637999989999885-----------------27----8999999984-798979999389899999999998789489


Q ss_pred             EEEEEECCCCCCCCEEEEEEEEE
Q ss_conf             69998145896983099999997
Q gi|255764482|r  164 LEITPLHPREGECASRILVTGRK  186 (225)
Q Consensus       164 ~~i~~v~~~~~~~~~~vlv~~~k  186 (225)
T Consensus       417 ~~i~~vDmFP~T~HvE~vall~R  439 (440)
T PRK13168        417 KRAGVLDMFPHTGHVESMALFER  439 (440)
T ss_pred             EEEEEEECCCCCCEEEEEEEEEE
T ss_conf             59999606999983899999983