HHsearch alignment for GI: 255764482 and conserved domain: PRK13255

>PRK13255 thiopurine S-methyltransferase; Reviewed.
Probab=98.27  E-value=7.8e-06  Score=52.12  Aligned_cols=114  Identities=16%  Similarity=0.088  Sum_probs=72.5

Q ss_pred             CCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHH--HHHHHHHHCCC------CCCCCCEEECCCCCCCC
Q ss_conf             89985578999587843899999986799889999889899998--89999980664------52225302004442353
Q gi|255764482|r    7 VNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHY--ARKTLALPANA------QISKRISLIEVDVTLVG   78 (225)
Q Consensus         7 ~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~--A~~n~~~~~~~------~~~~~~~~~~~D~~~~~   78 (225)
T Consensus        33 L~~~~~~rVlVPlCGKs~Dm~wLa~~--G~~VvGvEls~~Av~~ff~e~~l~~~~~~~~~~~~y~~~~i~i~~gDfF~L~  110 (218)
T PRK13255         33 LALPAGSRVLVPLCGKSLDMLWLAEQ--GHEVLGVELSELAVEQFFAENGLTPQVRQSGEFEHYQAGEISLYCGDFFALT  110 (218)
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHC--CCEEEEEECHHHHHHHHHHHCCCCCCCCCCCCEEEEECCCEEEEECCCCCCC
T ss_conf             08788986999489867769999848--9726998352999999999738986301367603775388279966420278


Q ss_pred             CCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             100001235765205772265446446547885455652056689899999999862469837870
Q gi|255764482|r   79 ENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLI  144 (225)
Q Consensus        79 ~~~~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i  144 (225)
T Consensus       111 ~~------~~g~~DaIyDR------aal~ALpp----------~~R~~Y~~~l~~ll~~g~~~LLi  154 (218)
T PRK13255        111 AA------DLADVDAVYDR------AALIALPE----------EMRERYVQQLAALLPAGCRGLLV  154 (218)
T ss_pred             HH------HCCCCCEEEEC------CCEECCCH----------HHHHHHHHHHHHHCCCCCCEEEE
T ss_conf             63------54774889975------38012898----------99999999999864998748999