HHsearch alignment for GI: 255764482 and conserved domain: TIGR00091

>TIGR00091 TIGR00091 tRNA (guanine-N(7)-)-methyltransferase; InterPro: IPR004395 This predicted S-adenosylmethionine-dependent methyltransferase is found in a single copy in most Bacteria . It is also found, with a short amino-terminal extension in eukaryotes. Its function is unknown. In Escherichia coli, this protein flanks the DNA repair protein MutY, also called micA.; GO: 0008168 methyltransferase activity.
Probab=99.32  E-value=3.8e-11  Score=82.10  Aligned_cols=136  Identities=13%  Similarity=0.154  Sum_probs=102.6

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEEC--------CHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCC
Q ss_conf             8557899958784389999998679988999988--------98999988999998066452225302004442353100
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRLHEAQILLAER--------SPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENR   81 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~--------~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~   81 (225)
T Consensus        18 ~~~p~~~EIGcG~G~fl~~~A~~nP~~~flGIE~RvqvtnYv~~p~v~~a~~~~~~~g~~~--~Nl~~L~~DA~~l~~~~   95 (216)
T TIGR00091        18 NQKPLVLEIGCGKGRFLIKMAKQNPDKNFLGIEIRVQVTNYVETPIVLKAINKANKLGLKL--RNLHVLCGDANELLEKF   95 (216)
T ss_pred             CCCCEEEEECCCCCCCHHHHHHHCCCCCEEEEEEEEEEEEEECCCHHHHHHHHHHHHCCCH--HHHHHHHCCHHHHHHHH
T ss_conf             1454489841687602689977279972777899988741022728998875576617844--21352213602320454


Q ss_pred             CCCCCCCC--CCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHHHHHH-HHHHHH
Q ss_conf             00123576--520577226544644654788545565205668989999999986246983787028888999-999852
Q gi|255764482|r   82 NLAGLKNN--FYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQ-IVNACA  158 (225)
Q Consensus        82 ~~~~~~~~--~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~~l~~-~l~~~~  158 (225)
T Consensus        96 ~----~~~PP~l~k~f~~FP----------DPW~KkRH~KRR~~~~~Fl~~~~~~L~~~G~i~~~TD~~~lfE~mL~~l~  161 (216)
T TIGR00091        96 F----PDGPPSLSKVFLNFP----------DPWPKKRHNKRRITQPHFLKEVANVLKKGGVIELKTDNEPLFEDMLKVLS  161 (216)
T ss_pred             H----CCCCCCEEEEEEECC----------CCCHHHHHCCCCCCCHHHHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHH
T ss_conf             0----078980456888778----------89510210223425678999999970459689997078467899999996


Q ss_pred             CCC
Q ss_conf             178
Q gi|255764482|r  159 RRI  161 (225)
Q Consensus       159 ~~~  161 (225)
T Consensus       162 ~~~  164 (216)
T TIGR00091       162 END  164 (216)
T ss_pred             HCC
T ss_conf             536