HHsearch alignment for GI: 255764482 and conserved domain: TIGR00536

>TIGR00536 hemK_fam methyltransferase, HemK family; InterPro: IPR004556 The gene hemK from Escherichia coli was found to contribute to heme biosynthesis and originally suggested to be protoporphyrinogen oxidase . Functional analysis of the nearest homolog in Saccharomyces cerevisiae, YNL063w, finds it is not protoporphyrinogen oxidase and sequence analysis suggests that HemK homologs have S-adenosyl-methionine-dependent methyltransferase activity . Homologs are found, usually in a single copy, in nearly all completed genomes, but varying somewhat in apparent domain architecture. Both Escherichia coli and Haemophilus influenzae have two members rather than one. The members from the Mycoplasmas have an additional C-terminal domain.; GO: 0008276 protein methyltransferase activity, 0006479 protein amino acid methylation.
Probab=98.96  E-value=4.1e-09  Score=70.63  Aligned_cols=134  Identities=19%  Similarity=0.226  Sum_probs=97.9

Q ss_pred             CEEEEECCCHHHHHHHHHHHCC--CCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC-
Q ss_conf             7899958784389999998679--9889999889899998899999806645222530200444235310000123576-
Q gi|255764482|r   13 FHLADLGAGAGAAGLAVASRLH--EAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNN-   89 (225)
Q Consensus        13 ~~VLDlGcG~G~~~l~la~r~~--~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~-   89 (225)
T Consensus       128 ~~~~d~~~g~g~~~~~~~~~~~pc~~~~~~~d~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~------~~~p  198 (311)
T TIGR00536       128 LHILDLGTGSGCIALALAYEFPPCNAEVIAVDLSPDALALAEENAEKLGL---EGRVELLQSDLLEPLPG------LGGP  198 (311)
T ss_pred             CHHHHCCCCCHHHHHHHHHCCCCCCCEEEEECCCHHHHHHHHHHHHHHHH---HCCCEEEHHHHHHHHHH------CCCC
T ss_conf             01110145631566655430466662266411223678888876776432---01200101124443320------3665


Q ss_pred             CCCEEEECCCCCCCCCCCCC--CHHHHHHHC-------CCCCCHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHH
Q ss_conf             52057722654464465478--854556520-------5668989999999986246983787028888999999
Q gi|255764482|r   90 FYDHVIMNPPFNERIGTMTP--DKIKEEAHV-------MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVN  155 (225)
Q Consensus        90 ~fDlii~nPPy~~~~~~~~~--~~~~~~a~~-------~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~~l~~~l~  155 (225)
T Consensus       199 ~~~~~~~~ppy~~~~~~~~~~~~~~~~~p~~~l~~~g~~g~~~~~~~~~~~~~~~~~~g~~~~~~g~~~~~~~~~  273 (311)
T TIGR00536       199 KLDLLVSNPPYIDEEDLADLSPGVVLFEPLLALVGFGDDGLKILKRILELAPDYLKPGGFLLLEIGNWQLGLLKE  273 (311)
T ss_pred             CEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHH
T ss_conf             223664588654413455531123432003454304740078999998754543056755899616223567787