HHsearch alignment for GI: 255764482 and conserved domain: TIGR01177

>TIGR01177 TIGR01177 conserved hypothetical protein TIGR01177; InterPro: IPR005885 This family of largely hypothetical proteins is found exclusively in the Archaea and contain a putative RNA methylase domain..
Probab=98.07  E-value=6.6e-06  Score=52.53  Aligned_cols=130  Identities=18%  Similarity=0.175  Sum_probs=92.7

Q ss_pred             CHHHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEE-ECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCC
Q ss_conf             624389985578999587843899999986799889999-8898999988999998066452225302004442353100
Q gi|255764482|r    3 LASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLA-ERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENR   81 (225)
Q Consensus         3 La~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gv-D~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~   81 (225)
T Consensus       195 ~~~~~~~~~g~~~~dp~~g~gg~~~~~gl~--g~~~~g~gd~~~~~~~g~~~~l~~~~~~~--~~~~~~~~~~~~~~~~~  270 (358)
T TIGR01177       195 LVNLAGVKEGDRLLDPFCGTGGFLIEAGLL--GAKPIGCGDLDWKLVEGARLNLEHYGIED--KVFSVKRGDAKDLPLRL  270 (358)
T ss_pred             HHHHHHCCCCCCEECCCCCCCCHHHHHHHH--CCCCCCCCHHHHHHHCCCHHHHHHCCCCC--CEEEEEECCCHHCCCCC
T ss_conf             765420246751004222666033233332--11000244035676425211133305543--15676403300111003


Q ss_pred             CCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHH
Q ss_conf             0012357652057722654464465478854556520566898999999998624698378702888
Q gi|255764482|r   82 NLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQ  148 (225)
Q Consensus        82 ~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~  148 (225)
T Consensus       271 ~--~-~~~~~~~~~~d~p~g~~~~~~~~---------~~~~l~~~~~~~~~~~~~~~g~~~~~~~~~  325 (358)
T TIGR01177       271 P--G-LDESVDAIATDPPYGRSTTAAGD---------GLEELYEKSLEELHEVLKGGGWLAVAVPTD  325 (358)
T ss_pred             C--C-CHHHHHHHHCCCCCCCCCCCCCH---------HHHHHHHHHHHHHHHHHCCCCCEEEEEECC
T ss_conf             5--3-10112222125654531112210---------368888888888888642687179974033