HHsearch alignment for GI: 255764482 and conserved domain: TIGR03451

>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase. Members of this protein family are mycothiol-dependent formaldehyde dehydrogenase (EC 1.2.1.66). This protein is found, so far, only in the Actinobacteria (Mycobacterium sp., Streptomyces sp., Corynebacterium sp., and related species), where mycothione replaces glutathione.
Probab=97.26  E-value=0.0071  Score=35.44  Aligned_cols=104  Identities=16%  Similarity=0.129  Sum_probs=63.1

Q ss_pred             HCCCCCCCEEEEECCCHHH-HHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC
Q ss_conf             3899855789995878438-999999867998899998898999988999998066452225302004442353100001
Q gi|255764482|r    6 LVNATGSFHLADLGAGAGA-AGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA   84 (225)
Q Consensus         6 ~~~~~~~~~VLDlGcG~G~-~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~   84 (225)
T Consensus       171 ~~~~~~g~~VlV~GaG~iGl~a~~~ak~~Ga~~Vi~~d~~~~rl~~A~~l----Ga~---~~i~~~~~~~~-----~~v~  238 (358)
T TIGR03451       171 TGGVKRGDSVAVIGCGGVGDAAIAGAALAGASKIIAVDIDDRKLEWAREF----GAT---HTVNSSGTDPV-----EAIR  238 (358)
T ss_pred             HCCCCCCCEEEEECCCHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHC----CCE---EEECCCCCCHH-----HHHH
T ss_conf             40799998899967376999999999983991899991988999999965----990---99739987889-----9999


Q ss_pred             CCCCC-CCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             23576-52057722654464465478854556520566898999999998624698378702
Q gi|255764482|r   85 GLKNN-FYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIA  145 (225)
Q Consensus        85 ~~~~~-~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~  145 (225)
T Consensus       239 ~~t~g~G~Dvvie~~------------------------G~~~~~~~al~~~~~gG~iv~~G  276 (358)
T TIGR03451       239 ALTGGFGADVVIDAV------------------------GRPETYKQAFYARDLAGTVVLVG  276 (358)
T ss_pred             HHHCCCCCCEEEECC------------------------CCHHHHHHHHHHHCCCCEEEEEE
T ss_conf             985898874999999------------------------99899999999762796999992