Query         gi|255764482|ref|YP_003065169.2| methyltransferase protein [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 225
No_of_seqs    156 out of 9562
Neff          9.2 
Searched_HMMs 39220
Date          Mon May 30 00:53:35 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 255764482.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 COG4123 Predicted O-methyltran 100.0       0       0  320.3  20.4  212    1-221    34-246 (248)
  2 pfam05175 MTS Methyltransferas  99.9   1E-25 2.7E-30  164.3  10.7  120    2-146    22-141 (170)
  3 TIGR03533 L3_gln_methyl protei  99.9 1.8E-23 4.7E-28  151.6  13.9  134    5-149   115-255 (284)
  4 PRK11805 N5-glutamine S-adenos  99.9   2E-23   5E-28  151.4  12.9  134    5-149   127-267 (307)
  5 TIGR03534 RF_mod_HemK protein-  99.9 4.4E-22 1.1E-26  143.8  16.6  153   11-176    87-247 (251)
  6 PRK09328 N5-glutamine S-adenos  99.9 5.9E-22 1.5E-26  143.1  16.7  153   11-176   109-268 (277)
  7 PRK09489 rsmC 16S ribosomal RN  99.9   4E-22   1E-26  144.0  14.1  117    2-145   187-303 (342)
  8 PRK01544 bifunctional N5-gluta  99.9 5.5E-22 1.4E-26  143.3  14.1  134   10-154   134-278 (503)
  9 PRK09329 N5-glutamine S-adenos  99.9 8.4E-21 2.2E-25  136.6  16.5  151   10-176   108-266 (285)
 10 COG2813 RsmC 16S RNA G1207 met  99.9 2.6E-21 6.7E-26  139.5  13.7  119    2-146   149-267 (300)
 11 COG2890 HemK Methylase of poly  99.9 1.8E-20 4.6E-25  134.7  15.5  133   14-159   113-252 (280)
 12 PRK11873 arsM arsenite S-adeno  99.8 5.6E-20 1.4E-24  132.0  12.5  111    5-144    67-178 (258)
 13 PRK01683 trans-aconitate 2-met  99.8 5.7E-20 1.5E-24  131.9  11.8  109    3-146    23-131 (252)
 14 pfam01170 UPF0020 Putative RNA  99.8 2.1E-18 5.3E-23  123.1  13.1  125    3-149    20-144 (171)
 15 PRK00216 ubiE ubiquinone/menaq  99.8 1.7E-18 4.4E-23  123.5  11.9  114    3-144    43-157 (239)
 16 pfam02384 N6_Mtase N-6 DNA Met  99.8 2.6E-17 6.7E-22  116.9  16.2  141    2-150    37-189 (312)
 17 PRK08317 hypothetical protein;  99.8 4.4E-18 1.1E-22  121.2  12.0  111    5-145    13-124 (241)
 18 COG4106 Tam Trans-aconitate me  99.8 3.2E-18 8.1E-23  122.1   9.5  177    3-221    22-235 (257)
 19 pfam01209 Ubie_methyltran ubiE  99.8 8.5E-18 2.2E-22  119.6  11.6  112    4-144    40-152 (233)
 20 TIGR00537 hemK_rel_arch methyl  99.8 5.2E-18 1.3E-22  120.8  10.3  144    2-159    11-159 (183)
 21 smart00828 PKS_MT Methyltransf  99.7 1.7E-17 4.4E-22  117.9  11.4  103   13-144     1-103 (224)
 22 KOG2904 consensus               99.7 8.5E-17 2.2E-21  114.0  13.7  130   11-145   148-285 (328)
 23 COG1041 Predicted DNA modifica  99.7   7E-17 1.8E-21  114.5  12.5  129    2-152   188-317 (347)
 24 PRK10258 biotin biosynthesis p  99.7   4E-17   1E-21  115.9  10.9  121    3-159    34-155 (251)
 25 PTZ00098 phosphoethanolamine N  99.7 1.2E-16 2.9E-21  113.2  11.7  109    6-144    47-155 (263)
 26 COG2226 UbiE Methylase involve  99.7 2.1E-16 5.3E-21  111.8  12.0  112    4-144    44-155 (238)
 27 PRK05134 3-demethylubiquinone-  99.7 1.5E-16 3.7E-21  112.7  10.0  110    6-146    43-152 (233)
 28 TIGR01983 UbiG ubiquinone bios  99.7 1.2E-16 3.1E-21  113.1   8.9  116    8-147    81-200 (275)
 29 pfam02353 CMAS Cyclopropane-fa  99.7 3.6E-16 9.3E-21  110.4  11.3  111    3-143    54-164 (273)
 30 cd02440 AdoMet_MTases S-adenos  99.7 4.2E-16 1.1E-20  110.1  11.1  103   14-144     1-103 (107)
 31 pfam02475 Met_10 Met-10+ like-  99.7 5.9E-16 1.5E-20  109.2  10.5  102    9-143    98-199 (199)
 32 PRK03522 rumB 23S rRNA methylu  99.6 2.3E-14 5.8E-19  100.3  16.7  147    5-185   227-373 (375)
 33 PRK11036 putative metallothion  99.6 2.7E-15 6.9E-20  105.5  11.6  109   11-148    44-152 (256)
 34 TIGR01934 MenG_MenH_UbiE ubiqu  99.6 1.5E-15 3.8E-20  106.9  10.2  112    9-145    41-161 (242)
 35 PRK00517 prmA ribosomal protei  99.6 1.3E-14 3.3E-19  101.6  13.9  116    9-159   160-276 (298)
 36 COG2230 Cfa Cyclopropane fatty  99.6 5.5E-15 1.4E-19  103.8  11.9  111    3-143    64-174 (283)
 37 pfam06325 PrmA Ribosomal prote  99.6   9E-15 2.3E-19  102.6  13.0  117    9-161   158-275 (294)
 38 PRK13168 rumA 23S rRNA 5-methy  99.6   4E-14   1E-18   98.9  15.8  151    5-186   288-439 (440)
 39 TIGR02072 BioC biotin biosynth  99.6 1.9E-15   5E-20  106.3   7.1  122   11-158    36-161 (272)
 40 PRK00377 cbiT cobalt-precorrin  99.6 1.3E-13 3.4E-18   96.0  16.4  133    5-167    34-168 (198)
 41 PRK07402 precorrin-6B methylas  99.6 2.2E-13 5.6E-18   94.7  17.4  123    5-159    34-157 (196)
 42 COG2264 PrmA Ribosomal protein  99.6 1.1E-14 2.7E-19  102.2  10.5  122    9-163   160-283 (300)
 43 COG1092 Predicted SAM-dependen  99.6 1.3E-14 3.4E-19  101.6  10.6  128   11-154   217-350 (393)
 44 COG0286 HsdM Type I restrictio  99.6 1.2E-14 3.1E-19  101.8  10.1  142    2-148   177-329 (489)
 45 pfam09445 Methyltransf_15 RNA   99.6   2E-13 5.1E-18   95.0  16.0  114   13-136     2-115 (165)
 46 TIGR00479 rumA 23S rRNA (uraci  99.6 4.5E-14 1.2E-18   98.6  12.1  140    5-174   288-429 (434)
 47 COG2265 TrmA SAM-dependent met  99.6 1.3E-13 3.2E-18   96.1  13.7  140    5-175   287-427 (432)
 48 PRK10901 16S rRNA methyltransf  99.6 2.2E-13 5.6E-18   94.7  14.0  133    2-144   236-372 (428)
 49 PRK08287 cobalt-precorrin-6Y C  99.6 9.4E-13 2.4E-17   91.2  17.1  129    5-167    24-154 (186)
 50 pfam05958 tRNA_U5-meth_tr tRNA  99.6 5.4E-13 1.4E-17   92.5  15.8  145    6-180   193-346 (353)
 51 PRK05031 tRNA (uracil-5-)-meth  99.5 5.7E-13 1.5E-17   92.4  15.5  145    6-180   203-356 (363)
 52 pfam08242 Methyltransf_12 Meth  99.5 3.1E-14 7.9E-19   99.5   8.5   98   16-141     1-98  (98)
 53 COG2227 UbiG 2-polyprenyl-3-me  99.5 3.9E-14   1E-18   98.9   8.8  104   11-146    59-162 (243)
 54 PRK07580 Mg-protoporphyrin IX   99.5 9.8E-14 2.5E-18   96.7  10.6  108    9-149    61-168 (230)
 55 COG2242 CobL Precorrin-6B meth  99.5 1.6E-12   4E-17   89.9  16.7  125    5-162    28-153 (187)
 56 COG0116 Predicted N6-adenine-s  99.5 1.9E-13 4.8E-18   95.1  11.4  125    6-150   186-349 (381)
 57 pfam01189 Nol1_Nop2_Fmu NOL1/N  99.5 8.6E-13 2.2E-17   91.4  14.7  188    2-205    75-270 (277)
 58 TIGR00406 prmA ribosomal prote  99.5 5.5E-14 1.4E-18   98.1   8.3  124    5-159   190-315 (330)
 59 TIGR02021 BchM-ChlM magnesium   99.5 4.5E-14 1.1E-18   98.7   7.8  141    9-181    52-195 (224)
 60 PRK11705 cyclopropane fatty ac  99.5 1.8E-13 4.7E-18   95.2  10.7  107    3-143   159-265 (383)
 61 PRK11933 yebU rRNA (cytosine-C  99.5 1.1E-12 2.8E-17   90.8  14.6  129    6-144   108-241 (471)
 62 pfam05971 Methyltransf_10 Prot  99.5 1.2E-14 3.1E-19  101.9   4.3   90   10-103    64-153 (254)
 63 KOG3191 consensus               99.5 1.7E-12 4.3E-17   89.8  15.1  138   11-161    43-185 (209)
 64 pfam10672 Methyltrans_SAM S-ad  99.5 1.3E-12 3.2E-17   90.5  13.7  116   10-144   122-237 (286)
 65 COG2263 Predicted RNA methylas  99.5 1.6E-13 4.2E-18   95.5   8.5   80    8-103    42-121 (198)
 66 pfam08241 Methyltransf_11 Meth  99.5 1.8E-13 4.6E-18   95.2   8.7   95   16-143     1-95  (95)
 67 PRK11207 tellurite resistance   99.5 7.7E-13   2E-17   91.7  11.2  109    7-145    26-134 (198)
 68 COG2519 GCD14 tRNA(1-methylade  99.5 3.9E-12   1E-16   87.7  13.9  123    4-160    87-211 (256)
 69 PRK11727 putative SAM-dependen  99.4 9.6E-14 2.4E-18   96.8   4.5   91    8-103   114-205 (326)
 70 KOG1270 consensus               99.4 3.8E-13 9.7E-18   93.4   6.9  104   11-144    89-194 (282)
 71 COG0144 Sun tRNA and rRNA cyto  99.4 2.6E-12 6.6E-17   88.7  11.1  135    2-144   147-287 (355)
 72 TIGR02469 CbiT precorrin-6Y C5  99.4 3.1E-12 7.9E-17   88.3  11.3  115    4-143    12-131 (135)
 73 pfam08704 GCD14 tRNA methyltra  99.4   3E-11 7.6E-16   82.7  15.4  136    4-169    95-234 (309)
 74 pfam01596 Methyltransf_3 O-met  99.4 1.5E-12 3.9E-17   90.0   8.7  117    2-143    35-152 (204)
 75 pfam01135 PCMT Protein-L-isoas  99.4   1E-11 2.6E-16   85.3  11.3  107    4-145    66-173 (205)
 76 COG4122 Predicted O-methyltran  99.3 7.5E-12 1.9E-16   86.1   9.5  112    3-143    51-164 (219)
 77 PRK00121 trmB tRNA (guanine-N(  99.3 2.1E-11 5.3E-16   83.6  10.9  132   10-159    53-185 (229)
 78 TIGR00091 TIGR00091 tRNA (guan  99.3 3.8E-11 9.7E-16   82.1  11.9  136   10-161    18-164 (216)
 79 COG2520 Predicted methyltransf  99.3 1.2E-11   3E-16   85.0   9.2  102    9-143   186-287 (341)
 80 COG0220 Predicted S-adenosylme  99.3 3.6E-11 9.3E-16   82.2  11.4  123   13-153    50-172 (227)
 81 KOG1540 consensus               99.3 5.4E-11 1.4E-15   81.3  12.1  115    4-144    93-213 (296)
 82 COG2521 Predicted archaeal met  99.3 1.6E-12 4.1E-17   89.9   4.1  115    4-142   127-242 (287)
 83 pfam03848 TehB Tellurite resis  99.3 2.5E-11 6.4E-16   83.1   9.9  108    8-146    27-134 (192)
 84 PRK13942 protein-L-isoaspartat  99.3 2.8E-11 7.1E-16   82.9  10.1  107    4-145    69-176 (214)
 85 PRK00312 pcm protein-L-isoaspa  99.3 6.2E-11 1.6E-15   80.9  11.4  104    5-145    72-175 (213)
 86 PRK13944 protein-L-isoaspartat  99.3   4E-11   1E-15   82.0  10.1  109    3-145    64-173 (205)
 87 pfam10294 Methyltransf_16 Puta  99.3 1.2E-10   3E-15   79.4  12.3  124   10-157    43-168 (171)
 88 pfam07021 MetW Methionine bios  99.3   2E-11 5.1E-16   83.7   8.1  107    3-149     7-113 (193)
 89 pfam02390 Methyltransf_4 Putat  99.3 1.1E-10 2.8E-15   79.5  11.0  132   10-159    19-152 (199)
 90 PRK11783 rlmL 23S rRNA m(2)G24  99.2 4.4E-11 1.1E-15   81.8   8.6   86   10-103   193-320 (716)
 91 TIGR00755 ksgA dimethyladenosi  99.2 4.3E-11 1.1E-15   81.8   8.1   88    4-103    22-115 (277)
 92 COG0030 KsgA Dimethyladenosine  99.2 7.7E-11   2E-15   80.4   8.5   86    4-103    23-108 (259)
 93 KOG2899 consensus               99.2 1.5E-10 3.9E-15   78.7  10.0  184   10-210    57-283 (288)
 94 KOG1271 consensus               99.2 1.3E-10 3.4E-15   79.0   9.2  129   12-160    68-196 (227)
 95 COG2518 Pcm Protein-L-isoaspar  99.2 1.5E-10 3.9E-15   78.7   9.4  106    3-145    64-169 (209)
 96 PRK13943 protein-L-isoaspartat  99.2 1.6E-10 4.1E-15   78.6   9.5  106    3-143    67-173 (317)
 97 PRK11188 rrmJ 23S rRNA methylt  99.2 2.1E-10 5.4E-15   77.9  10.0  146    9-178    49-197 (209)
 98 PRK11783 rlmL 23S rRNA m(2)G24  99.2 3.6E-10 9.1E-15   76.6  10.6  122   10-147   551-672 (716)
 99 TIGR00438 rrmJ ribosomal RNA l  99.2 1.3E-10 3.2E-15   79.2   8.1  138    9-167    30-173 (192)
100 KOG2671 consensus               99.2 3.7E-12 9.4E-17   87.8   0.1  137    1-147   198-356 (421)
101 KOG3420 consensus               99.2 3.9E-11   1E-15   82.0   5.3   82    9-103    46-127 (185)
102 KOG2187 consensus               99.2 5.1E-10 1.3E-14   75.7  10.7  115    5-147   377-492 (534)
103 PRK10909 rsmD 16S rRNA m(2)G96  99.2 4.5E-10 1.2E-14   76.0  10.2  107   10-146    51-159 (198)
104 TIGR02081 metW methionine bios  99.1 6.7E-11 1.7E-15   80.7   5.7  102    9-147    11-119 (205)
105 pfam05401 NodS Nodulation prot  99.1 1.4E-10 3.7E-15   78.9   6.7  107    8-146    40-147 (201)
106 PRK11088 rrmA 23S rRNA methylt  99.1 1.4E-09 3.7E-14   73.2  11.3  108   11-159    85-196 (272)
107 PTZ00338 dimethyladenosine tra  99.1 3.7E-10 9.4E-15   76.5   8.1   86    4-103    31-116 (296)
108 smart00650 rADc Ribosomal RNA   99.1 4.5E-10 1.1E-14   76.1   7.9   86    4-104     6-91  (169)
109 KOG1122 consensus               99.1   5E-09 1.3E-13   70.1  12.5  163    4-177   234-406 (460)
110 PRK05785 hypothetical protein;  99.1 2.7E-09 6.8E-14   71.7  10.9  105    8-152    48-152 (225)
111 TIGR00563 rsmB ribosomal RNA s  99.1 3.1E-09 7.9E-14   71.3  11.1  146    3-152   263-419 (487)
112 pfam03602 Cons_hypoth95 Conser  99.0 2.9E-09 7.3E-14   71.5  10.4  108   11-146    43-152 (181)
113 PRK00107 gidB glucose-inhibite  99.0 3.4E-08 8.6E-13   65.5  15.8  150    3-187    61-214 (216)
114 COG0742 N6-adenine-specific me  99.0 2.6E-09 6.5E-14   71.8  10.1  114   10-147    42-156 (187)
115 PRK04457 spermidine synthase;   99.0 1.5E-08 3.9E-13   67.4  13.3  150   10-185    65-216 (262)
116 PRK00274 ksgA dimethyladenosin  99.0 1.2E-09 3.1E-14   73.6   7.4   85    4-104    32-116 (267)
117 PRK06922 hypothetical protein;  99.0 7.5E-10 1.9E-14   74.8   6.2  119   10-143   419-537 (679)
118 pfam01728 FtsJ FtsJ-like methy  99.0 5.7E-09 1.5E-13   69.8  10.6  134   10-165    20-155 (176)
119 KOG1541 consensus               99.0   7E-09 1.8E-13   69.3  11.0  147   11-183    50-203 (270)
120 KOG1499 consensus               99.0 3.3E-09 8.4E-14   71.2   8.8  106   10-142    59-164 (346)
121 PRK12335 tellurite resistance   99.0   4E-09   1E-13   70.7   8.8  106   10-146   121-226 (289)
122 pfam00398 RrnaAD Ribosomal RNA  99.0 4.3E-09 1.1E-13   70.5   8.7   86    4-104    23-108 (258)
123 TIGR00536 hemK_fam methyltrans  99.0 4.1E-09   1E-13   70.6   8.5  134   13-155   128-273 (311)
124 TIGR02752 MenG_heptapren 2-hep  99.0 3.7E-09 9.4E-14   70.9   8.2  113    5-146    39-152 (231)
125 COG4976 Predicted methyltransf  98.9 1.2E-09   3E-14   73.7   5.4  102   10-145   124-225 (287)
126 PRK06202 hypothetical protein;  98.9 6.9E-09 1.8E-13   69.4   9.2   80    9-102    59-142 (233)
127 TIGR02085 meth_trns_rumB 23S r  98.9   1E-09 2.6E-14   74.1   4.9  134   10-174   236-374 (386)
128 KOG1500 consensus               98.9 6.4E-09 1.6E-13   69.6   8.9  104   11-143   177-280 (517)
129 TIGR00477 tehB tellurite resis  98.9 3.3E-09 8.4E-14   71.2   7.4  109    6-144    68-176 (239)
130 KOG0820 consensus               98.9 6.1E-09 1.6E-13   69.6   8.2   84    5-102    52-135 (315)
131 COG3129 Predicted SAM-dependen  98.9 2.6E-10 6.5E-15   77.4   1.1   89   10-103    77-166 (292)
132 PHA02056 putative methyltransf  98.9 4.8E-09 1.2E-13   70.2   7.4   84    8-108    61-144 (279)
133 KOG2361 consensus               98.9 2.4E-08 6.1E-13   66.3  10.5  111   10-144    70-182 (264)
134 KOG1663 consensus               98.9 1.2E-08   3E-13   68.0   8.6  117    2-143    64-181 (237)
135 COG0293 FtsJ 23S rRNA methylas  98.8 7.2E-08 1.8E-12   63.6  10.4  146    9-176    43-192 (205)
136 pfam05724 TPMT Thiopurine S-me  98.8 1.2E-07 3.1E-12   62.3  10.9  114    7-144    18-139 (203)
137 COG0421 SpeE Spermidine syntha  98.8   1E-07 2.6E-12   62.8  10.4  118    6-144    72-189 (282)
138 TIGR02987 met_A_Alw26 type II   98.8 4.3E-08 1.1E-12   64.9   8.0  142   11-152    33-235 (603)
139 pfam01564 Spermine_synth Sperm  98.7 4.7E-07 1.2E-11   59.0  13.1  134   10-164    74-213 (240)
140 KOG2198 consensus               98.7 1.4E-07 3.6E-12   61.9  10.2  152    5-160   149-318 (375)
141 TIGR00446 nop2p NOL1/NOP2/sun   98.7 7.4E-08 1.9E-12   63.5   8.5  129    8-144    72-212 (284)
142 KOG4300 consensus               98.7 5.4E-08 1.4E-12   64.3   7.8  111    7-146    72-183 (252)
143 pfam03291 Pox_MCEL mRNA cappin  98.7 9.2E-08 2.3E-12   63.0   8.6  129   10-154    62-197 (327)
144 PRK00811 spermidine synthase;   98.7 9.2E-07 2.3E-11   57.4  13.1  137   10-167    77-220 (283)
145 KOG1975 consensus               98.7 6.9E-08 1.8E-12   63.7   7.3  124    9-148   115-240 (389)
146 KOG2730 consensus               98.7 1.4E-08 3.6E-13   67.6   3.5   87   11-105    94-180 (263)
147 PRK01544 bifunctional N5-gluta  98.7 6.2E-07 1.6E-11   58.3  11.9  134    9-161   342-476 (503)
148 KOG2912 consensus               98.7 1.1E-08 2.9E-13   68.1   3.0   86   15-103   106-191 (419)
149 PRK03612 spermidine synthase;   98.7 3.5E-07 8.9E-12   59.7  10.3  130   10-159   292-430 (516)
150 KOG2915 consensus               98.6 2.2E-06 5.6E-11   55.2  13.8  137    5-172    99-239 (314)
151 KOG3010 consensus               98.6 1.1E-07 2.9E-12   62.5   7.0  103   10-143    31-135 (261)
152 PRK04338 N(2),N(2)-dimethylgua  98.6 3.6E-07 9.2E-12   59.7   9.4  156    2-189    42-227 (376)
153 TIGR00080 pimt protein-L-isoas  98.6 1.2E-07 3.2E-12   62.3   6.4  107    6-143    75-185 (228)
154 COG4076 Predicted RNA methylas  98.6 1.1E-07 2.9E-12   62.5   5.9  100   12-142    33-132 (252)
155 pfam02527 GidB rRNA small subu  98.6 4.3E-06 1.1E-10   53.6  13.3  102   11-146    48-149 (184)
156 COG3963 Phospholipid N-methylt  98.5 8.6E-07 2.2E-11   57.5   9.3  116    3-145    40-156 (194)
157 COG0357 GidB Predicted S-adeno  98.5 5.5E-06 1.4E-10   53.0  13.3   98   12-142    68-165 (215)
158 pfam08003 Methyltransf_9 Prote  98.5 2.1E-06 5.4E-11   55.3  11.0  110    4-143   108-217 (315)
159 pfam06080 DUF938 Protein of un  98.5 1.3E-06 3.3E-11   56.5   9.3  116   10-146    24-139 (201)
160 PRK01581 speE spermidine synth  98.5 1.5E-06 3.9E-11   56.1   9.6  115    9-143   137-255 (363)
161 TIGR00095 TIGR00095 putative m  98.5 1.2E-06 3.1E-11   56.7   8.4  119   11-146    55-178 (210)
162 pfam06962 rRNA_methylase Putat  98.5 5.9E-06 1.5E-10   52.8  11.8  129   37-183     1-139 (140)
163 pfam00891 Methyltransf_2 O-met  98.3 4.5E-06 1.2E-10   53.5   9.2  100    8-144    98-197 (239)
164 pfam05219 DREV DREV methyltran  98.3 9.2E-06 2.3E-10   51.7   9.5   96   11-146    94-191 (265)
165 PRK13255 thiopurine S-methyltr  98.3 7.8E-06   2E-10   52.1   8.9  114    7-144    33-154 (218)
166 TIGR02143 trmA_only tRNA (urac  98.3 2.2E-07 5.7E-12   60.8   1.0  116   14-158   206-332 (361)
167 pfam02005 TRM N2,N2-dimethylgu  98.3 1.3E-05 3.4E-10   50.8   9.9  105    9-144    47-152 (375)
168 KOG1661 consensus               98.2 2.5E-06 6.5E-11   54.9   5.9  105    9-144    80-192 (237)
169 TIGR00138 gidB methyltransfera  98.2 1.3E-05 3.3E-10   50.9   9.4  112   11-153    49-161 (197)
170 pfam08123 DOT1 Histone methyla  98.2 3.1E-05   8E-10   48.7   9.9  114    5-143    36-156 (205)
171 COG4262 Predicted spermidine s  98.1 5.7E-05 1.4E-09   47.3  10.5  114   10-143   288-405 (508)
172 PRK13699 putative methylase; P  98.1 9.8E-06 2.5E-10   51.6   6.4   83   69-159     4-86  (227)
173 PRK11524 putative methyltransf  98.1   9E-06 2.3E-10   51.8   6.2   78   66-150     8-85  (284)
174 pfam05148 Methyltransf_8 Hypot  98.1 5.9E-05 1.5E-09   47.2  10.1  129   11-193    67-199 (214)
175 TIGR01177 TIGR01177 conserved   98.1 6.6E-06 1.7E-10   52.5   5.1  130    3-148   195-325 (358)
176 PRK04266 fibrillarin; Provisio  98.1 0.00055 1.4E-08   41.7  14.8  139    6-174    67-216 (226)
177 pfam01861 DUF43 Protein of unk  98.0 0.00015 3.7E-09   44.9  11.5  110    8-147    41-153 (243)
178 pfam11599 AviRa RRNA methyltra  98.0 3.2E-05 8.3E-10   48.6   8.0  126   10-146    50-215 (249)
179 TIGR00740 TIGR00740 methyltran  98.0 1.2E-05   3E-10   51.1   5.6  109    9-145    59-169 (247)
180 KOG4589 consensus               98.0 7.7E-05   2E-09   46.5   9.3  114    9-144    67-183 (232)
181 KOG1709 consensus               98.0 3.2E-05 8.1E-10   48.7   7.1  108   10-146   100-207 (271)
182 TIGR03587 Pse_Me-ase pseudamin  98.0 5.2E-05 1.3E-09   47.5   8.0   74    9-99     41-114 (204)
183 smart00138 MeTrc Methyltransfe  97.9 0.00013 3.2E-09   45.3   9.9  114    9-145    97-242 (264)
184 PRK00536 speE spermidine synth  97.9 0.00036 9.2E-09   42.7  12.1  117   10-161    71-192 (262)
185 COG1867 TRM1 N2,N2-dimethylgua  97.9 7.4E-05 1.9E-09   46.6   8.6  101   12-144    53-153 (380)
186 KOG3115 consensus               97.9 8.1E-05 2.1E-09   46.4   8.8  131   11-152    60-190 (249)
187 COG3897 Predicted methyltransf  97.9 2.1E-05 5.3E-10   49.7   4.8  106    9-149    77-182 (218)
188 pfam01269 Fibrillarin Fibrilla  97.9  0.0011 2.7E-08   40.1  13.3  139    6-174    68-218 (229)
189 pfam01739 CheR CheR methyltran  97.8 0.00015 3.9E-09   44.9   8.3  116    9-149    28-176 (194)
190 PTZ00146 fibrillarin; Provisio  97.8  0.0016 4.2E-08   39.0  13.0  138    6-173   130-279 (296)
191 pfam04445 DUF548 Protein of un  97.7 0.00043 1.1E-08   42.3   9.7   93    2-102    64-163 (235)
192 pfam05891 Hydroxy-O-Methy Puta  97.7 0.00039   1E-08   42.5   9.3  103   12-143    56-159 (217)
193 cd00315 Cyt_C5_DNA_methylase C  97.7 0.00012   3E-09   45.4   6.4   72   14-102     2-74  (275)
194 PRK00050 mraW S-adenosyl-methy  97.7 0.00021 5.4E-09   44.0   7.4   91    5-100    17-109 (309)
195 pfam00145 DNA_methylase C-5 cy  97.7 0.00017 4.4E-09   44.6   6.9   70   14-102     2-72  (319)
196 pfam09243 Rsm22 Mitochondrial   97.7   0.001 2.5E-08   40.2  10.7   48   10-57     33-81  (275)
197 COG1352 CheR Methylase of chem  97.7 0.00044 1.1E-08   42.2   8.7  112   11-145    96-241 (268)
198 KOG1501 consensus               97.6 0.00013 3.4E-09   45.2   5.5   57   13-73     68-124 (636)
199 PRK11524 putative methyltransf  97.6 0.00058 1.5E-08   41.6   8.8   49    9-59    206-254 (284)
200 PRK10611 chemotaxis methyltran  97.6 0.00087 2.2E-08   40.6   9.5  118    4-145   107-262 (287)
201 pfam07942 N2227 N2227-like pro  97.6  0.0013 3.3E-08   39.6  10.2   43   10-54     56-98  (268)
202 TIGR03438 probable methyltrans  97.6   0.005 1.3E-07   36.3  14.4  184   10-217    62-279 (301)
203 KOG3045 consensus               97.6  0.0004   1E-08   42.4   7.5  123   11-189   180-306 (325)
204 PRK09880 L-idonate 5-dehydroge  97.5  0.0014 3.6E-08   39.4  10.0  102    6-145   164-266 (343)
205 pfam05185 PRMT5 PRMT5 arginine  97.5  0.0017 4.4E-08   38.9  10.4  103   13-142   188-294 (447)
206 pfam01234 NNMT_PNMT_TEMT NNMT/  97.5  0.0011 2.8E-08   40.0   9.4  119   10-145    55-199 (261)
207 KOG1253 consensus               97.5 9.8E-05 2.5E-09   45.9   4.0  109    8-144   106-215 (525)
208 COG1064 AdhP Zn-dependent alco  97.5  0.0017 4.4E-08   38.9   9.9   98    7-146   162-260 (339)
209 PRK10742 putative methyltransf  97.5   0.002 5.1E-08   38.5   9.8   94    2-103    77-177 (250)
210 pfam01795 Methyltransf_5 MraW   97.4   0.001 2.6E-08   40.2   7.8   69    5-78     14-83  (310)
211 pfam03141 DUF248 Putative meth  97.4 9.1E-05 2.3E-09   46.1   2.3  104    3-146   105-220 (506)
212 COG0500 SmtA SAM-dependent met  97.3  0.0037 9.5E-08   37.0  10.1  103   15-146    52-156 (257)
213 PRK13699 putative methylase; P  97.3 0.00096 2.4E-08   40.3   6.8   47    9-57    161-207 (227)
214 KOG1099 consensus               97.3 0.00036 9.1E-09   42.8   4.2  116   13-150    43-169 (294)
215 TIGR03451 mycoS_dep_FDH mycoth  97.3  0.0071 1.8E-07   35.4  10.8  104    6-145   171-276 (358)
216 KOG2793 consensus               97.3   0.013 3.2E-07   34.0  12.9  119   11-150    86-204 (248)
217 KOG2940 consensus               97.2 0.00043 1.1E-08   42.3   4.5  101   10-142    71-171 (325)
218 TIGR00452 TIGR00452 methyltran  97.2  0.0038 9.6E-08   37.0   9.1  107    9-143   119-225 (316)
219 TIGR00497 hsdM type I restrict  97.2 0.00064 1.6E-08   41.3   5.1  135   11-147   223-371 (516)
220 COG0270 Dcm Site-specific DNA   97.2 0.00092 2.3E-08   40.4   5.8   76   12-101     3-78  (328)
221 TIGR03439 methyl_EasF probable  97.2   0.014 3.7E-07   33.7  15.4  191    9-218    74-299 (319)
222 PRK13256 thiopurine S-methyltr  97.2  0.0058 1.5E-07   35.9   9.5  117    7-145    39-163 (226)
223 PRK09422 alcohol dehydrogenase  97.1   0.015 3.7E-07   33.7  11.2  105    5-145   156-261 (338)
224 KOG0024 consensus               97.1  0.0071 1.8E-07   35.4   9.7  174    6-220   164-343 (354)
225 KOG2078 consensus               97.1 0.00019 4.9E-09   44.3   1.6   66    9-78    247-312 (495)
226 pfam04672 DUF574 Protein of un  97.1  0.0065 1.7E-07   35.6   9.4  119   11-146    68-192 (268)
227 pfam07669 Eco57I Eco57I restri  97.1 0.00065 1.6E-08   41.3   3.9   78   90-173     2-82  (106)
228 PRK10083 putative dehydrogenas  97.0   0.009 2.3E-07   34.9   9.4  104    5-145   154-259 (339)
229 TIGR00417 speE spermidine synt  97.0  0.0016 4.2E-08   39.0   5.5  118   11-143    75-193 (284)
230 TIGR03366 HpnZ_proposed putati  97.0   0.014 3.5E-07   33.8  10.2  103    6-145   115-218 (280)
231 TIGR01444 fkbM_fam methyltrans  97.0  0.0019 4.8E-08   38.7   5.7   49   14-62      1-51  (142)
232 KOG3201 consensus               97.0 0.00039   1E-08   42.5   2.2  123   10-158    28-155 (201)
233 KOG3178 consensus               97.0  0.0064 1.6E-07   35.7   8.4   97   13-145   179-275 (342)
234 pfam12147 Hydrolase_5 Putative  97.0   0.011 2.8E-07   34.4   9.5  117   10-148   134-252 (311)
235 KOG1269 consensus               97.0  0.0028 7.2E-08   37.7   6.5  108    7-143   106-213 (364)
236 TIGR03201 dearomat_had 6-hydro  97.0   0.014 3.5E-07   33.8   9.8   46    7-53    162-208 (349)
237 COG1063 Tdh Threonine dehydrog  96.9   0.019 4.8E-07   33.0  10.1  104    8-145   165-269 (350)
238 COG1189 Predicted rRNA methyla  96.8  0.0088 2.2E-07   34.9   8.1  100    9-144    77-177 (245)
239 pfam10354 DUF2431 Domain of un  96.8   0.018 4.5E-07   33.2   9.6  117   18-145     3-125 (166)
240 COG2384 Predicted SAM-dependen  96.7  0.0062 1.6E-07   35.8   6.6  117    4-154    11-128 (226)
241 COG0275 Predicted S-adenosylme  96.7   0.011 2.8E-07   34.3   7.5   70    5-79     17-87  (314)
242 KOG2352 consensus               96.6  0.0048 1.2E-07   36.4   5.5  109   14-143    51-159 (482)
243 PRK10309 galactitol-1-phosphat  96.6   0.045 1.2E-06   30.9  11.0  106    5-145   154-260 (347)
244 COG4798 Predicted methyltransf  96.6   0.006 1.5E-07   35.9   5.8  115    4-145    41-166 (238)
245 pfam03059 NAS Nicotianamine sy  96.6    0.05 1.3E-06   30.6  13.3  108   11-144   121-230 (277)
246 pfam04816 DUF633 Family of unk  96.6  0.0071 1.8E-07   35.4   5.9   60   15-77      1-60  (204)
247 TIGR00692 tdh L-threonine 3-de  96.4   0.033 8.5E-07   31.6   8.6  170    9-222   159-335 (341)
248 pfam07091 FmrO Ribosomal RNA m  96.4   0.005 1.3E-07   36.3   4.2   51    9-59    100-150 (248)
249 TIGR02716 C20_methyl_CrtF C-20  96.4   0.013 3.4E-07   33.9   6.3  113    2-143   140-252 (306)
250 PRK13771 putative alcohol dehy  96.3   0.072 1.8E-06   29.8  10.5   98    5-145   156-255 (332)
251 PRK05396 tdh L-threonine 3-deh  96.3   0.067 1.7E-06   29.9   9.6  102    9-145   161-263 (341)
252 COG5459 Predicted rRNA methyla  96.3   0.018 4.5E-07   33.2   6.5  116    8-146   110-226 (484)
253 COG1568 Predicted methyltransf  96.2   0.055 1.4E-06   30.4   8.8  110   10-148   151-263 (354)
254 COG1889 NOP1 Fibrillarin-like   96.2   0.083 2.1E-06   29.4  12.7  136    7-172    72-218 (231)
255 KOG2360 consensus               96.2   0.016 4.1E-07   33.4   6.0   91    3-102   205-296 (413)
256 pfam10237 N6-adenineMlase Prob  96.1   0.078   2E-06   29.5   9.2  124    9-171    23-146 (161)
257 pfam01555 N6_N4_Mtase DNA meth  96.1   0.013 3.3E-07   33.9   5.1   62   91-154     1-62  (221)
258 KOG1227 consensus               96.0   0.011 2.7E-07   34.4   4.3   73   11-95    194-267 (351)
259 KOG1331 consensus               96.0   0.009 2.3E-07   34.9   3.8   98   10-143    44-141 (293)
260 KOG2798 consensus               95.9   0.085 2.2E-06   29.3   8.7   42   10-53    149-190 (369)
261 TIGR00006 TIGR00006 S-adenosyl  95.9   0.025 6.3E-07   32.4   5.9   88    7-100    23-117 (323)
262 TIGR00675 dcm DNA-cytosine met  95.8   0.038 9.7E-07   31.3   6.3   79   15-101     1-86  (425)
263 COG4889 Predicted helicase [Ge  95.4   0.024 6.1E-07   32.5   4.3  136   10-146   844-1023(1518)
264 TIGR00308 TRM1 N2,N2-dimethylg  95.4   0.029 7.5E-07   32.0   4.7   80   13-98     96-178 (462)
265 KOG4058 consensus               95.3   0.021 5.4E-07   32.7   3.9   68    5-76     66-133 (199)
266 pfam00107 ADH_zinc_N Zinc-bind  95.0    0.24 6.1E-06   26.8   9.2   90   21-145     1-90  (131)
267 COG0863 DNA modification methy  94.7   0.074 1.9E-06   29.7   5.1   74   86-159    31-113 (302)
268 pfam04989 CmcI Cephalosporin h  94.6    0.11 2.9E-06   28.7   5.9   62   10-80     31-96  (202)
269 TIGR02817 adh_fam_1 zinc-bindi  94.5    0.13 3.2E-06   28.4   5.9  105   10-152   149-256 (338)
270 smart00829 PKS_ER Enoylreducta  94.3    0.35   9E-06   25.8  10.0  106    5-145    98-205 (288)
271 KOG1596 consensus               94.1    0.39 9.9E-06   25.6   9.5  135    7-175   152-302 (317)
272 PRK13341 recombination factor   94.1     0.4   1E-05   25.6  10.8  117    5-145   486-602 (726)
273 KOG0022 consensus               93.9    0.21 5.4E-06   27.1   6.1   49    5-53    186-235 (375)
274 TIGR00478 tly hemolysin A; Int  93.9   0.094 2.4E-06   29.1   4.2   52   10-71     76-127 (240)
275 KOG0822 consensus               93.9    0.21 5.3E-06   27.2   6.0  104   11-141   367-474 (649)
276 KOG1098 consensus               93.8    0.06 1.5E-06   30.2   3.1  119    9-149    42-163 (780)
277 PRK11760 putative RNA 2'-O-rib  93.8    0.18 4.5E-06   27.5   5.5   71    9-99    208-278 (356)
278 KOG3987 consensus               93.7  0.0085 2.2E-07   35.0  -1.4   42   10-53    111-152 (288)
279 PRK07102 short chain dehydroge  93.6    0.49 1.2E-05   25.1   8.5   85   13-102     2-88  (243)
280 COG1062 AdhC Zn-dependent alco  93.5    0.36 9.1E-06   25.8   6.6   49    5-53    179-228 (366)
281 PRK05786 fabG 3-ketoacyl-(acyl  93.4    0.54 1.4E-05   24.8   9.1  124   11-144     4-134 (238)
282 pfam03492 Methyltransf_7 SAM d  92.9    0.65 1.6E-05   24.4   7.6   23   10-32     15-37  (331)
283 KOG2651 consensus               92.8    0.12   3E-06   28.5   3.3   41   12-53    154-194 (476)
284 PRK10754 quinone oxidoreductas  92.5    0.73 1.9E-05   24.1   9.5  104    4-145   133-239 (327)
285 PRK06125 short chain dehydroge  92.1    0.82 2.1E-05   23.8  11.2  126   11-143     6-137 (259)
286 pfam11899 DUF3419 Protein of u  91.8    0.61 1.5E-05   24.5   6.0   47    6-54     30-76  (376)
287 pfam07757 AdoMet_MTase Predict  91.8    0.12   3E-06   28.5   2.3   32   11-44     58-89  (112)
288 KOG4174 consensus               91.4    0.99 2.5E-05   23.3   8.0  129    8-145    53-190 (282)
289 PRK05876 short chain dehydroge  91.3    0.99 2.5E-05   23.3   9.2   90   11-106     5-99  (275)
290 KOG2782 consensus               91.2    0.17 4.5E-06   27.6   2.7   89    5-97     37-125 (303)
291 KOG2920 consensus               91.2    0.16 4.2E-06   27.7   2.6   39   10-49    115-153 (282)
292 PRK08507 prephenate dehydrogen  91.2       1 2.6E-05   23.2  11.5   40   14-53      2-43  (275)
293 PRK06139 short chain dehydroge  91.0     1.1 2.8E-05   23.1   9.6  161    9-176     3-192 (324)
294 PRK09186 flagellin modificatio  90.5     1.2   3E-05   22.9   8.2   83   11-98      3-90  (255)
295 PRK06101 short chain dehydroge  90.4     1.2 3.1E-05   22.8   9.3  120   14-144     3-126 (241)
296 PRK06113 7-alpha-hydroxysteroi  90.3     1.2 3.2E-05   22.8  10.1  128   11-144    10-144 (255)
297 PRK12826 3-ketoacyl-(acyl-carr  89.6     1.4 3.7E-05   22.4   8.6  128   11-144     5-140 (253)
298 PRK07024 short chain dehydroge  89.6     1.4 3.7E-05   22.4   7.7   83   12-102     2-89  (256)
299 PRK05866 short chain dehydroge  89.5     1.4 3.7E-05   22.4   8.9   85   11-101    39-128 (290)
300 pfam05869 Dam DNA N-6-adenine-  89.3    0.99 2.5E-05   23.3   5.2   61   93-173    64-130 (179)
301 PRK07576 short chain dehydroge  89.2     1.5 3.9E-05   22.3  10.5  127   11-144     7-141 (260)
302 KOG0821 consensus               89.1    0.69 1.8E-05   24.2   4.3   91    6-102    45-141 (326)
303 PRK06194 hypothetical protein;  88.9     1.6 4.1E-05   22.2   7.8   89   11-105     5-98  (301)
304 pfam02636 DUF185 Uncharacteriz  88.5     1.7 4.4E-05   22.0   9.9   47   12-58     18-72  (240)
305 PRK07109 short chain dehydroge  88.5     1.7 4.4E-05   22.0   9.4  163    7-176     3-195 (338)
306 KOG1562 consensus               88.1       1 2.6E-05   23.3   4.6  118   10-146   120-237 (337)
307 PRK05872 short chain dehydroge  88.1     1.8 4.6E-05   21.8  10.1  125   10-144     7-139 (296)
308 pfam02086 MethyltransfD12 D12   88.1     1.8 4.6E-05   21.8   6.0   47    4-52     13-59  (254)
309 PRK07890 short chain dehydroge  88.1     1.8 4.6E-05   21.8  10.2  128   11-144     4-139 (258)
310 COG1743 Adenine-specific DNA m  88.0    0.65 1.7E-05   24.3   3.6   68  123-190   566-647 (875)
311 PRK07062 short chain dehydroge  87.9     1.9 4.8E-05   21.8  10.0  129   11-144     7-144 (265)
312 PRK07677 short chain dehydroge  87.3       2 5.2E-05   21.6   9.7   84   11-100     2-90  (254)
313 PRK07041 short chain dehydroge  87.1     2.1 5.3E-05   21.5  10.2  124   11-144     6-132 (240)
314 PRK13394 3-hydroxybutyrate deh  87.1     2.1 5.3E-05   21.5   9.2  128   11-145     6-143 (262)
315 PRK05653 fabG 3-ketoacyl-(acyl  86.9     2.2 5.5E-05   21.4  10.3  127   11-144     4-139 (246)
316 PRK04148 hypothetical protein;  86.8     1.3 3.2E-05   22.7   4.5   42   10-53     15-57  (135)
317 PRK05650 short chain dehydroge  86.7     2.2 5.6E-05   21.4   9.5  123   14-144     2-134 (270)
318 PRK08324 short chain dehydroge  86.5     2.3 5.8E-05   21.3   8.5  127   11-145   420-556 (676)
319 PRK07201 short chain dehydroge  85.9     2.4 6.2E-05   21.1   9.9   88    9-102   373-465 (663)
320 PRK09072 short chain dehydroge  85.4     2.6 6.6E-05   21.0   9.4  125   11-144     4-136 (262)
321 pfam02153 PDH Prephenate dehyd  84.7     2.8 7.1E-05   20.8   8.2   28   26-53      2-29  (258)
322 PRK07502 cyclohexadienyl dehyd  84.6     2.8 7.2E-05   20.8  12.7   42   13-54      7-50  (307)
323 KOG3924 consensus               84.5    0.88 2.2E-05   23.6   2.8   92    6-101   187-283 (419)
324 PRK06500 short chain dehydroge  84.2     2.9 7.5E-05   20.7  10.2  124   11-144     5-135 (249)
325 pfam02254 TrkA_N TrkA-N domain  83.5     3.1   8E-05   20.5   7.9  101   20-155     4-105 (115)
326 COG1565 Uncharacterized conser  83.4     3.2 8.1E-05   20.5   7.2   48   11-58     77-132 (370)
327 PRK12744 short chain dehydroge  83.1     3.3 8.4E-05   20.4   9.0  130   11-144     7-144 (257)
328 PRK06940 short chain dehydroge  82.8     3.4 8.6E-05   20.3   9.1   81   13-99      5-88  (277)
329 PRK07832 short chain dehydroge  82.2     3.5   9E-05   20.2   9.8  125   14-144     2-136 (272)
330 PRK06181 short chain dehydroge  82.2     3.5   9E-05   20.2  10.4  127   12-144     1-135 (263)
331 PRK05855 short chain dehydroge  81.9     3.6 9.3E-05   20.1   9.4   90   10-105   313-407 (582)
332 PRK06200 2,3-dihydroxy-2,3-dih  81.8     3.7 9.4E-05   20.1   7.7   82   10-100     4-90  (263)
333 PRK07231 fabG 3-ketoacyl-(acyl  81.5     3.8 9.6E-05   20.1   7.5  125   11-144     5-139 (250)
334 PRK07479 consensus              81.2     3.9 9.8E-05   20.0   8.9  127   11-144     4-140 (252)
335 PRK08220 2,3-dihydroxybenzoate  81.2     3.9 9.8E-05   20.0   7.9  120   11-144     7-134 (253)
336 PRK08267 short chain dehydroge  80.6       4  0.0001   19.9   9.2  122   14-144     3-134 (258)
337 PRK07666 fabG 3-ketoacyl-(acyl  80.5     4.1  0.0001   19.8   9.2  128   10-144     4-140 (238)
338 COG0604 Qor NADPH:quinone redu  80.4     4.1  0.0001   19.8   9.4  108    3-148   134-244 (326)
339 PRK07814 short chain dehydroge  80.4     4.1 0.00011   19.8   9.6  127   11-144     9-145 (263)
340 COG2961 ComJ Protein involved   80.2     4.2 0.00011   19.8  10.5  120   10-159    88-212 (279)
341 PRK07417 arogenate dehydrogena  80.0     4.2 0.00011   19.8  11.2   40   14-53      3-42  (280)
342 PRK06720 hypothetical protein;  80.0     4.2 0.00011   19.8   9.6   86   11-102    15-105 (169)
343 PRK06172 short chain dehydroge  78.8     4.6 0.00012   19.5   9.0   85   11-101     6-95  (253)
344 PRK05884 short chain dehydroge  78.7     4.7 0.00012   19.5   6.2  121   14-145     2-130 (223)
345 pfam11968 DUF3321 Protein of u  78.5     4.8 0.00012   19.5   7.2  105   13-158    54-174 (220)
346 PRK12937 short chain dehydroge  78.4     4.8 0.00012   19.5   9.1  129   10-145     3-139 (245)
347 TIGR00571 dam DNA adenine meth  78.3     2.9 7.5E-05   20.7   3.6   37   14-50     33-70  (327)
348 PRK08125 bifunctional UDP-gluc  78.3     4.8 0.00012   19.5   6.1   73    9-95    312-387 (660)
349 PRK08340 glucose-1-dehydrogena  78.0     4.9 0.00013   19.4   7.6   81   14-101     2-87  (259)
350 pfam06859 Bin3 Bicoid-interact  77.5     5.1 0.00013   19.3   5.8   49  120-168    19-71  (110)
351 PRK08628 short chain dehydroge  77.3     5.1 0.00013   19.3   8.9  125   11-144     6-138 (258)
352 PRK06914 short chain dehydroge  76.9     5.3 0.00013   19.2  10.4  128   12-144     3-138 (280)
353 PRK12429 3-hydroxybutyrate deh  76.7     5.4 0.00014   19.2   9.1  127   11-144     3-138 (258)
354 PRK12746 short chain dehydroge  76.2     5.5 0.00014   19.1   9.6  129   11-145     5-146 (254)
355 PRK07825 short chain dehydroge  76.0     5.6 0.00014   19.1   8.5  123   11-144     4-135 (273)
356 PRK05875 short chain dehydroge  75.8     5.7 0.00014   19.1   9.4   87   11-100     6-97  (277)
357 PRK06346 consensus              75.3     5.9 0.00015   19.0  10.7  127   11-144     4-140 (251)
358 PRK06227 consensus              75.2     5.9 0.00015   18.9   9.7  127   11-144     4-139 (256)
359 PRK08945 short chain dehydroge  75.1     5.9 0.00015   18.9  10.4  128   11-144    12-151 (245)
360 PRK06124 gluconate 5-dehydroge  74.4     6.2 0.00016   18.8   8.9  128   11-144    13-148 (259)
361 PRK07063 short chain dehydroge  73.9     6.4 0.00016   18.8   9.6  128   11-144     6-142 (259)
362 COG1748 LYS9 Saccharopine dehy  73.8     6.4 0.00016   18.7   6.8   75   13-101     2-79  (389)
363 PRK08277 D-mannonate oxidoredu  72.8     6.8 0.00017   18.6   8.3   83   11-99      9-96  (278)
364 PRK08265 short chain dehydroge  72.8     6.8 0.00017   18.6   9.3  123   11-144     5-135 (261)
365 PRK06077 fabG 3-ketoacyl-(acyl  72.2       7 0.00018   18.5  10.4  129   11-145     2-137 (249)
366 PRK08251 short chain dehydroge  72.2       7 0.00018   18.5   8.9  128   12-144     2-138 (248)
367 PRK06505 enoyl-(acyl carrier p  72.2       7 0.00018   18.5   7.9  129   10-144     5-144 (271)
368 PRK09134 short chain dehydroge  72.0     7.1 0.00018   18.5   9.7  132    7-144     4-144 (256)
369 PRK07326 short chain dehydroge  71.7     7.2 0.00018   18.5   9.0  125   11-144     4-137 (235)
370 KOG0023 consensus               71.0     7.5 0.00019   18.4   6.3  104    8-148   178-282 (360)
371 PRK08703 short chain dehydroge  71.0     7.5 0.00019   18.4  10.8  128   11-144     5-145 (239)
372 PRK07097 gluconate 5-dehydroge  71.0     7.5 0.00019   18.4  10.1  128   11-144     9-144 (265)
373 PRK06079 enoyl-(acyl carrier p  70.7     7.6 0.00019   18.3   8.3  127   10-144     5-142 (252)
374 PRK03562 glutathione-regulated  70.0     6.1 0.00016   18.9   3.6   53   14-79    401-455 (615)
375 pfam05206 TRM13 Methyltransfer  69.9     7.9  0.0002   18.2   4.6   67    9-80     16-87  (256)
376 PRK06701 short chain dehydroge  69.4     8.1 0.00021   18.2  10.6  128   11-144    44-179 (289)
377 PRK09242 tropinone reductase;   68.8     8.4 0.00021   18.1   9.5  129   11-144     9-146 (258)
378 PRK05565 fabG 3-ketoacyl-(acyl  67.7     8.8 0.00023   18.0   9.7  128   11-144     4-140 (247)
379 PRK10669 putative cation:proto  67.7     8.8 0.00023   18.0   4.2   66   18-97    421-488 (558)
380 PRK06484 short chain dehydroge  67.6     8.9 0.00023   17.9   9.3   84    9-101   271-359 (530)
381 PRK07478 short chain dehydroge  67.2       9 0.00023   17.9   9.4   85   11-101     5-94  (254)
382 PRK08339 short chain dehydroge  67.0     9.1 0.00023   17.9   9.9  129   11-144     7-142 (263)
383 PRK09291 short chain dehydroge  66.5     9.3 0.00024   17.8  11.0  123   12-144     2-130 (257)
384 PRK05867 short chain dehydroge  66.4     9.4 0.00024   17.8  10.2   87   11-103     8-99  (253)
385 TIGR03206 benzo_BadH 2-hydroxy  66.1     9.5 0.00024   17.8   8.9  127   11-144     2-137 (250)
386 PRK06949 short chain dehydroge  65.9     9.6 0.00025   17.8  10.7   88   11-104     8-100 (258)
387 PRK07074 short chain dehydroge  65.8     9.6 0.00025   17.8   7.2  123   13-144     3-133 (256)
388 PRK08159 enoyl-(acyl carrier p  65.6     9.7 0.00025   17.7   8.5  129   10-144     8-147 (272)
389 PRK07806 short chain dehydroge  65.3     9.9 0.00025   17.7   9.5  124   11-145     5-134 (248)
390 PRK06057 short chain dehydroge  65.1      10 0.00025   17.7   8.2   80   11-101     6-90  (255)
391 PRK01747 mnmC 5-methylaminomet  65.1      10 0.00025   17.7   8.7   40   10-49     56-102 (660)
392 pfam04378 DUF519 Protein of un  64.9      10 0.00026   17.6  14.1  116   15-159    61-181 (245)
393 PRK08226 short chain dehydroge  64.8      10 0.00026   17.6   7.9  126   11-144     5-139 (263)
394 pfam03686 UPF0146 Uncharacteri  64.4     7.1 0.00018   18.5   3.0   43    4-48      5-49  (127)
395 PRK08263 short chain dehydroge  64.4      10 0.00026   17.6   8.2  123   12-144     3-134 (275)
396 PRK12825 fabG 3-ketoacyl-(acyl  63.9      11 0.00027   17.5  10.4  128   10-144     5-142 (250)
397 PRK08594 enoyl-(acyl carrier p  63.6      11 0.00027   17.5   9.9  130   11-144     5-145 (256)
398 PRK08217 fabG 3-ketoacyl-(acyl  63.2      11 0.00028   17.5   9.0   85   11-101     4-93  (253)
399 PRK07035 short chain dehydroge  63.2      11 0.00028   17.5   9.2  127   11-144     7-143 (252)
400 PRK12939 short chain dehydroge  63.1      11 0.00028   17.5   9.9  127   11-144     6-141 (250)
401 PRK12823 benD 1,6-dihydroxycyc  62.5      11 0.00028   17.4   9.0   82   11-99      7-93  (260)
402 PRK12824 acetoacetyl-CoA reduc  62.5      11 0.00029   17.4   7.6  125   14-144     4-137 (245)
403 PRK08213 gluconate 5-dehydroge  62.1      11 0.00029   17.3  11.6   86   11-102    11-101 (259)
404 PRK03659 glutathione-regulated  61.3      12  0.0003   17.3   6.4   49   20-79    406-456 (602)
405 COG5379 BtaA S-adenosylmethion  61.2      12  0.0003   17.2   5.3   47    7-55     59-105 (414)
406 PRK05993 short chain dehydroge  61.1      12  0.0003   17.2   8.9  120   12-144     4-133 (277)
407 PRK12747 short chain dehydroge  60.9      12  0.0003   17.2   8.0  128   11-144     3-143 (252)
408 PRK06545 prephenate dehydrogen  60.5      12 0.00031   17.2   5.4   40   14-53      2-43  (357)
409 PRK08643 acetoin reductase; Va  60.5      12 0.00031   17.2   7.9  124   14-144     4-137 (256)
410 PRK07776 consensus              60.5      12 0.00031   17.2   9.8   83   11-101     7-94  (252)
411 PRK12428 3-alpha-hydroxysteroi  59.7      13 0.00032   17.1   3.9   71   11-98      4-76  (261)
412 PRK05693 short chain dehydroge  59.4      13 0.00032   17.1   8.4  118   14-144     3-128 (274)
413 PRK06138 short chain dehydroge  59.0      13 0.00033   17.0   9.2  126   11-144     4-138 (252)
414 TIGR02824 quinone_pig3 putativ  58.7      13 0.00033   17.0   9.2  104    5-145   138-245 (334)
415 PRK08862 short chain dehydroge  58.5      13 0.00034   17.0   9.4   82   11-98      4-91  (227)
416 PRK08085 gluconate 5-dehydroge  56.9      14 0.00036   16.8   9.6   87   11-103     8-99  (254)
417 PRK06482 short chain dehydroge  56.3      14 0.00037   16.8   8.5  121   14-144     4-133 (276)
418 PRK06841 short chain dehydroge  56.2      14 0.00037   16.8   8.4  124   11-144    14-146 (255)
419 PRK07775 short chain dehydroge  55.9      15 0.00037   16.7  10.7  131    8-145     6-145 (275)
420 PRK06128 oxidoreductase; Provi  55.8      15 0.00037   16.7   8.7  127   11-144    54-190 (300)
421 PRK08415 enoyl-(acyl carrier p  55.5      15 0.00038   16.7   7.6  128   11-144     4-142 (274)
422 PRK12828 short chain dehydroge  54.5      15 0.00039   16.6   8.4  125   11-144     6-139 (239)
423 pfam04072 LCM Leucine carboxyl  54.1      16  0.0004   16.6   4.1   70    5-76     63-133 (175)
424 PRK05557 fabG 3-ketoacyl-(acyl  53.8      16  0.0004   16.5   9.1  128   11-144     4-140 (248)
425 PRK12829 short chain dehydroge  53.5      16 0.00041   16.5   8.9   88    6-101     5-97  (264)
426 PRK06180 short chain dehydroge  53.5      16 0.00041   16.5   6.8  124   11-144     3-135 (277)
427 PRK06198 short chain dehydroge  53.3      16 0.00041   16.5  10.3  127   11-144     5-142 (268)
428 PRK06603 enoyl-(acyl carrier p  52.7      17 0.00042   16.4   7.2  129   10-144     6-145 (260)
429 PRK07370 enoyl-(acyl carrier p  52.7      17 0.00042   16.4   7.4  129   11-144     6-147 (259)
430 PRK07533 enoyl-(acyl carrier p  52.2      17 0.00043   16.4   9.1  128   11-144     5-143 (254)
431 PRK08261 fabG 3-ketoacyl-(acyl  51.6      17 0.00044   16.3   9.6   90    4-102   199-293 (447)
432 PRK07985 oxidoreductase; Provi  51.2      18 0.00045   16.3   9.2  128   11-145    48-185 (294)
433 PRK07454 short chain dehydroge  50.0      18 0.00047   16.2   9.9  128   10-144     4-140 (241)
434 PRK10538 3-hydroxy acid dehydr  49.7      19 0.00047   16.1   8.1   78   15-101     3-85  (248)
435 PRK12770 putative glutamate sy  48.9      19 0.00049   16.1   4.5   40    5-44     10-49  (350)
436 PRK12384 sorbitol-6-phosphate   47.9      20 0.00051   16.0   9.6   87   13-103     3-94  (259)
437 PRK06550 fabG 3-ketoacyl-(acyl  47.8      20 0.00051   16.0   7.9   73   11-100     4-78  (237)
438 TIGR03325 BphB_TodD cis-2,3-di  47.4      20 0.00052   15.9   8.1   81   11-100     4-89  (262)
439 pfam03435 Saccharop_dh Sacchar  47.3      20 0.00052   15.9   7.1   76   15-101     1-78  (384)
440 PRK12859 3-ketoacyl-(acyl-carr  46.6      21 0.00053   15.9   8.9  128   11-144     5-153 (257)
441 TIGR02818 adh_III_F_hyde S-(hy  46.2      21 0.00054   15.8   5.5   49    5-53    179-228 (368)
442 pfam03269 DUF268 Caenorhabditi  46.0      21 0.00054   15.8   4.9  108   12-147     2-113 (177)
443 COG0827 Adenine-specific DNA m  45.4      22 0.00055   15.8   4.1  135   10-150   151-294 (381)
444 KOG1209 consensus               45.2      22 0.00056   15.7   4.7   79   11-100     6-91  (289)
445 PRK05717 oxidoreductase; Valid  44.6      22 0.00057   15.7   8.5  125   10-144     8-142 (255)
446 PRK07774 short chain dehydroge  44.5      22 0.00057   15.7   9.2   84   11-100     5-93  (250)
447 PRK09496 trkA potassium transp  43.8      23 0.00059   15.6   5.3   64   20-96      6-71  (455)
448 pfam02737 3HCDH_N 3-hydroxyacy  43.5      23 0.00059   15.6   6.5   44   15-58      2-45  (180)
449 COG0338 Dam Site-specific DNA   43.0     6.6 0.00017   18.7  -0.1   35   13-50     27-61  (274)
450 PRK07067 sorbitol dehydrogenas  43.0      24 0.00061   15.5   9.6  124   11-144     4-137 (256)
451 PRK03369 murD UDP-N-acetylmura  42.9      24 0.00061   15.5   7.6   47    5-51      5-51  (487)
452 PRK08589 short chain dehydroge  42.4      24 0.00062   15.5   9.9  126   11-144     5-139 (272)
453 KOG1197 consensus               42.3      24 0.00062   15.5   6.7   54    2-56    137-192 (336)
454 pfam11312 DUF3115 Protein of u  42.0      25 0.00063   15.5   7.0  126   11-150    79-221 (288)
455 PRK12354 carbamate kinase; Rev  41.7      25 0.00063   15.4   4.6   11   12-22     42-52  (302)
456 COG2933 Predicted SAM-dependen  41.6      25 0.00064   15.4   2.9   39    9-49    209-247 (358)
457 PRK11730 fadB multifunctional   41.5      25 0.00064   15.4  11.8   48    9-56    310-357 (715)
458 TIGR01137 cysta_beta cystathio  40.8      26 0.00066   15.3   3.3   33    9-41     61-94  (527)
459 PRK09260 3-hydroxybutyryl-CoA   40.7      26 0.00066   15.3   6.6   46   13-58      3-48  (289)
460 PRK06197 short chain dehydroge  40.6      26 0.00066   15.3  10.6   92    7-102    11-107 (306)
461 PRK07069 short chain dehydroge  40.4      26 0.00067   15.3   6.9  118   23-144     9-136 (251)
462 PRK07523 gluconate 5-dehydroge  40.0      27 0.00068   15.3   8.0   84   11-103     8-96  (251)
463 PRK09424 pntA NAD(P) transhydr  39.8      27 0.00068   15.3   5.9   42   10-52    163-205 (510)
464 KOG0919 consensus               39.5      27 0.00069   15.2   2.9   78   12-102     3-81  (338)
465 PRK11154 fadJ multifunctional   38.9      28  0.0007   15.2  11.4   49    9-57    306-355 (706)
466 PRK07831 short chain dehydroge  37.5      29 0.00074   15.0  10.0  131   10-144    14-154 (261)
467 PRK06129 3-hydroxyacyl-CoA deh  37.1      29 0.00075   15.0   6.8   45   13-57      3-47  (308)
468 PRK05854 short chain dehydroge  36.9      30 0.00076   15.0  10.7   91    7-101     9-104 (314)
469 KOG1201 consensus               36.0      31 0.00078   14.9   9.2  127   10-144    36-171 (300)
470 COG4627 Uncharacterized protei  35.6      31  0.0008   14.9   2.8   24  125-148    66-89  (185)
471 KOG2098 consensus               35.2      29 0.00073   15.1   2.2   95   32-143   323-431 (591)
472 COG0698 RpiB Ribose 5-phosphat  35.0      32 0.00082   14.8   3.8   35   18-53     64-98  (151)
473 PRK07819 3-hydroxybutyryl-CoA   34.0      33 0.00085   14.7   7.0   46   13-58      3-48  (284)
474 COG1255 Uncharacterized protei  33.4      34 0.00087   14.7   3.8   33   12-46     14-47  (129)
475 PRK06114 short chain dehydroge  32.5      35  0.0009   14.6   9.6   86   11-102    15-106 (262)
476 TIGR00057 TIGR00057 Sua5/YciO/  32.5     8.3 0.00021   18.1  -0.9   14   65-78     59-72  (215)
477 TIGR02207 lipid_A_htrB lipid A  32.0      29 0.00073   15.1   1.8   30  115-144   167-198 (308)
478 PRK06182 short chain dehydroge  31.3      37 0.00094   14.5   7.3  121   11-144     2-131 (273)
479 PRK07588 hypothetical protein;  31.0      37 0.00095   14.4   3.6   33   14-46      2-34  (391)
480 PRK06179 short chain dehydroge  30.5      38 0.00097   14.4   8.4  119   11-144     3-130 (270)
481 pfam05575 V_cholerae_RfbT Vibr  29.8      30 0.00076   15.0   1.5   49   10-58     78-126 (286)
482 KOG2356 consensus               29.6      25 0.00063   15.4   1.1   73   65-147   162-235 (366)
483 PRK05599 hypothetical protein;  29.0      41   0.001   14.2   9.5   83   14-101     2-88  (246)
484 PRK06997 enoyl-(acyl carrier p  29.0      41   0.001   14.2   7.8  128   10-143     4-143 (260)
485 pfam08659 KR KR domain. This e  28.5      41  0.0011   14.2   5.5   87   14-103     2-94  (181)
486 PRK04308 murD UDP-N-acetylmura  27.6      43  0.0011   14.1   5.8   74   11-100     4-77  (445)
487 pfam00106 adh_short short chai  27.2      44  0.0011   14.0   6.5   83   14-102     2-92  (167)
488 PRK12481 2-deoxy-D-gluconate 3  26.8      45  0.0011   14.0   9.2   87   11-105     7-98  (251)
489 PRK11908 NAD-dependent epimera  26.5      45  0.0011   14.0   4.0   68   14-95      3-73  (347)
490 PRK07660 consensus              26.2      46  0.0012   13.9   9.1   45   13-57      4-48  (283)
491 PRK07578 short chain dehydroge  25.8      47  0.0012   13.9   7.1  106   14-144     2-110 (199)
492 PRK07889 enoyl-(acyl carrier p  25.7      47  0.0012   13.9   8.7  128   10-144     5-144 (256)
493 PRK08268 3-hydroxybutyryl-CoA   25.7      47  0.0012   13.9  11.3   46   13-58      4-49  (503)
494 COG4301 Uncharacterized conser  25.4      47  0.0012   13.8   9.6  120    8-150    75-202 (321)
495 PRK07530 3-hydroxybutyryl-CoA   24.9      48  0.0012   13.8   6.7   45   13-57      5-49  (292)
496 pfam07101 DUF1363 Protein of u  24.8      22 0.00056   15.7   0.1   32   15-47      6-39  (124)
497 COG3510 CmcI Cephalosporin hyd  24.6      49  0.0012   13.8   2.6   63   10-81     68-134 (237)
498 TIGR01082 murC UDP-N-acetylmur  24.4      50  0.0013   13.7   3.5  158   19-202     9-186 (491)
499 TIGR02734 crtI_fam phytoene de  24.3      50  0.0013   13.7   3.7   25   18-42      4-28  (526)
500 PRK07060 short chain dehydroge  23.7      51  0.0013   13.7   9.9   81   11-103     8-90  (245)

No 1  
>COG4123 Predicted O-methyltransferase [General function prediction only]
Probab=100.00  E-value=0  Score=320.34  Aligned_cols=212  Identities=27%  Similarity=0.459  Sum_probs=199.4

Q ss_pred             CCCHHHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCC
Q ss_conf             96624389985578999587843899999986799889999889899998899999806645222530200444235310
Q gi|255764482|r    1 MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGEN   80 (225)
Q Consensus         1 vlLa~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~   80 (225)
                      |||++|+++....+|||+|||+|.+++++|+|.+.++++|||+++.|++.|++|+..|.   ++.+++++++|+.++...
T Consensus        34 iLL~~~~~~~~~~~IlDlGaG~G~l~L~la~r~~~a~I~~VEiq~~~a~~A~~nv~ln~---l~~ri~v~~~Di~~~~~~  110 (248)
T COG4123          34 ILLAAFAPVPKKGRILDLGAGNGALGLLLAQRTEKAKIVGVEIQEEAAEMAQRNVALNP---LEERIQVIEADIKEFLKA  110 (248)
T ss_pred             HHHHHHCCCCCCCEEEEECCCCCHHHHHHHCCCCCCCEEEEEECHHHHHHHHHHHHHCC---CHHHEEEEHHHHHHHHHC
T ss_conf             99976526566876988368946899997455877807999817999999999886186---134016764308876542


Q ss_pred             CCCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHC-
Q ss_conf             0001235765205772265446446547885455652056689899999999862469837870288889999998521-
Q gi|255764482|r   81 RNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-  159 (225)
Q Consensus        81 ~~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~~l~~~l~~~~~-  159 (225)
                      .     ...+||+|+|||||+..+....+++.+..||++....+++|++.+.++|||||++++|+|++|+.|+++++.. 
T Consensus       111 ~-----~~~~fD~Ii~NPPyf~~~~~~~~~~~~~~Ar~e~~~~le~~i~~a~~~lk~~G~l~~V~r~erl~ei~~~l~~~  185 (248)
T COG4123         111 L-----VFASFDLIICNPPYFKQGSRLNENPLRAIARHEITLDLEDLIRAAAKLLKPGGRLAFVHRPERLAEIIELLKSY  185 (248)
T ss_pred             C-----CCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHHHCCCHHHHHHHHHHHCCCCCEEEEEECHHHHHHHHHHHHHC
T ss_conf             3-----65654789959898787533486746655663222889999999999746797899995588889999999866


Q ss_pred             CCCCEEEEEECCCCCCCCEEEEEEEEECCCCCCEEECCEEEECCCCCHHHHHHHHHHCCCCC
Q ss_conf             78846999814589698309999999778887477075689838874001899999738763
Q gi|255764482|r  160 RIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRS  221 (225)
Q Consensus       160 ~~~~~~i~~v~~~~~~~~~~vlv~~~k~~~~~~~~~~~l~l~~~~g~~yt~~~~~l~~~~~~  221 (225)
                      ++.++++++|||+++++|+++|++++|++++++.++|||++|+++|+ ||++++++|+|...
T Consensus       186 ~~~~k~i~~V~p~~~k~A~~vLv~~~k~~~~~l~~~ppLii~~e~g~-yt~e~~~i~~~~~~  246 (248)
T COG4123         186 NLEPKRIQFVYPKIGKAANRVLVEAIKGGKSGLKVLPPLIIHDEDGE-YTEEVKEIYQGFYL  246 (248)
T ss_pred             CCCCEEEEEECCCCCCCCEEEEEEEECCCCCCCEECCCEEEECCCCC-CCHHHHHHHHHHHH
T ss_conf             98715899862788875169999986088878656687799888888-69999999756764


No 2  
>pfam05175 MTS Methyltransferase small domain. This domain is found in ribosomal RNA small subunit methyltransferase C as well as other methyltransferases .
Probab=99.93  E-value=1e-25  Score=164.27  Aligned_cols=120  Identities=24%  Similarity=0.323  Sum_probs=99.4

Q ss_pred             CCHHHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCC
Q ss_conf             66243899855789995878438999999867998899998898999988999998066452225302004442353100
Q gi|255764482|r    2 ILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENR   81 (225)
Q Consensus         2 lLa~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~   81 (225)
                      ||.+.++..++++|||+|||+|.+++.+|++.|.++|+++|+|+.+++.|++|++.|+..    ++++.++|+...    
T Consensus        22 lLl~~l~~~~~g~vLDlGcG~G~i~~~la~~~p~~~v~~vDi~~~Al~~a~~N~~~n~l~----~v~v~~~D~~~~----   93 (170)
T pfam05175        22 LLLSHLPKPLGGKVLDLGCGYGVLGAALAKRSPDLEVTMVDINARALESARANLAANGLE----NGEVFWSDLYSA----   93 (170)
T ss_pred             HHHHCCCCCCCCCEEEECCCCCHHHHHHHHHCCCCEEEECHHHHHHHHHHHHHHHHHCCC----EEEEEECCCCCC----
T ss_conf             999708977899499977648298999999789867985154499999999999980998----489997446665----


Q ss_pred             CCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECC
Q ss_conf             00123576520577226544644654788545565205668989999999986246983787028
Q gi|255764482|r   82 NLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIAR  146 (225)
Q Consensus        82 ~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~  146 (225)
                          .+.++||+|++||||+.....             .......|++.|.+.|+|||.+++|..
T Consensus        94 ----~~~~~fD~IvsNPP~h~g~~~-------------~~~~~~~~i~~A~~~L~pgG~l~~V~n  141 (170)
T pfam05175        94 ----VEPGKFDLIISNPPFHAGKAT-------------DYDVAQRFIAGAARHLKPGGELWIVAN  141 (170)
T ss_pred             ----CCCCCEEEEEECCCCCCCCCC-------------CHHHHHHHHHHHHHHCCCCCEEEEEEE
T ss_conf             ----778866089989772114203-------------289999999999996164979999998


No 3  
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific. Members of this protein family methylate ribosomal protein L3 on a glutamine side chain. This family is related to HemK, a protein-glutamine methyltranferase for peptide chain release factors.
Probab=99.91  E-value=1.8e-23  Score=151.61  Aligned_cols=134  Identities=21%  Similarity=0.261  Sum_probs=103.2

Q ss_pred             HHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC
Q ss_conf             43899855789995878438999999867998899998898999988999998066452225302004442353100001
Q gi|255764482|r    5 SLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA   84 (225)
Q Consensus         5 ~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~   84 (225)
                      .+.+..+..+|||+|||+|++++.+|+++|+++++|+|+|+.+++.|++|+..++   ..+++++.++|+...       
T Consensus       115 ~~~~~~~~~~iLDlGtGSG~Iai~la~~~p~~~v~a~DiS~~Al~~A~~N~~~~~---l~~rv~~~~~D~~~~-------  184 (284)
T TIGR03533       115 PWLEPEPVKRILDLCTGSGCIAIACAYAFPEAEVDAVDISPDALAVAEINIERHG---LEDRVTLIQSDLFAA-------  184 (284)
T ss_pred             HHHCCCCCCEEEEECCCCHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHC---CCCCEEEEECCHHHH-------
T ss_conf             9842367771555216807999999987899879999899999999999998608---543368883514331-------


Q ss_pred             CCCCCCCCEEEECCCCCCCCCCCCCCH----HHHHHHCCCC---CCHHHHHHHHHHHCCCCCEEEEECCHHH
Q ss_conf             235765205772265446446547885----4556520566---8989999999986246983787028888
Q gi|255764482|r   85 GLKNNFYDHVIMNPPFNERIGTMTPDK----IKEEAHVMLE---DSFEKWIRTACAIMRSSGQLSLIARPQS  149 (225)
Q Consensus        85 ~~~~~~fDlii~nPPy~~~~~~~~~~~----~~~~a~~~~~---~~~~~~~~~a~~lLkpgG~~~~i~~~~~  149 (225)
                       ....+||+|+|||||..........+    ....|-....   ..+..++..+.++|+|||.+++-+-.++
T Consensus       185 -~~~~~fDlIVSNPPYI~~~e~~~l~~ev~~EP~~AL~gG~dGL~~yr~Ii~~a~~~L~pgG~l~lEiG~~Q  255 (284)
T TIGR03533       185 -LPGRKYDLIVSNPPYVDAEDMADLPAEYHHEPELALASGEDGLDLVRRILAEAADHLNENGVLVVEVGNSM  255 (284)
T ss_pred             -CCCCCCCEEEECCCCCCHHHHHHCCHHHCCCCHHHHCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCH
T ss_conf             -45777787997799788465544976411586998758955879999999988984256978999979788


No 4  
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional
Probab=99.91  E-value=2e-23  Score=151.44  Aligned_cols=134  Identities=19%  Similarity=0.258  Sum_probs=102.5

Q ss_pred             HHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC
Q ss_conf             43899855789995878438999999867998899998898999988999998066452225302004442353100001
Q gi|255764482|r    5 SLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA   84 (225)
Q Consensus         5 ~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~   84 (225)
                      .+.+..+..+|||+|||+|++++.+|+.+|+++|+++|+|+.+++.|++|+..++   ..+++++.++|+...       
T Consensus       127 ~~~~~~~~~rilDlGtGSG~Iaisla~~~p~~~v~a~Dis~~AL~vA~~N~~~~~---l~~rv~~~~~D~~~~-------  196 (307)
T PRK11805        127 PWLEDEQPTRILDLCTGSGCIAIACAYAFPDAEVDAVDISPDALAVAEINIERHG---LEDRVTLIQSDLFAA-------  196 (307)
T ss_pred             HHHCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHC---CCCCEEEEECCHHHC-------
T ss_conf             9733578872777427827999999987899889998589999999999999838---877389980402212-------


Q ss_pred             CCCCCCCCEEEECCCCCCCCCCCCCCH----HHHHHHCCCCC---CHHHHHHHHHHHCCCCCEEEEECCHHH
Q ss_conf             235765205772265446446547885----45565205668---989999999986246983787028888
Q gi|255764482|r   85 GLKNNFYDHVIMNPPFNERIGTMTPDK----IKEEAHVMLED---SFEKWIRTACAIMRSSGQLSLIARPQS  149 (225)
Q Consensus        85 ~~~~~~fDlii~nPPy~~~~~~~~~~~----~~~~a~~~~~~---~~~~~~~~a~~lLkpgG~~~~i~~~~~  149 (225)
                       ...++||+|+|||||...........    ....|-.....   .+..++..+.++|+|||.+.+-+-.++
T Consensus       197 -l~~~~fDlIvSNPPYI~~~~~~~L~~ev~~EP~~AL~gG~DGLd~~r~i~~~A~~~L~pgG~L~~EiG~~q  267 (307)
T PRK11805        197 -LPGRRYDLIVSNPPYVDAEDMADLPAEYRHEPELALAAGDDGLDLVRRILAEAADYLTEDGVLVCEVGNSM  267 (307)
T ss_pred             -CCCCCCCEEEECCCCCCHHHHHHCCHHHCCCCHHHHCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCH
T ss_conf             -68875077996799788565633977531587888768924889999999988974476968999979788


No 5  
>TIGR03534 RF_mod_HemK protein-(glutamine-N5) methyltransferase, release factor-specific. Members of this protein family are HemK, a protein once thought to be involved in heme biosynthesis but now recognized to be a protein-glutamine methyltransferase that modifies the peptide chain release factors. All members of the seed alignment are encoded next to the release factor 1 gene (prfA) and confirmed by phylogenetic analysis. However, the family is diverse enough that even many members of the seed alignment do not score above the seed alignment, which was set high enough to exclude all instances of PrmB.
Probab=99.90  E-value=4.4e-22  Score=143.81  Aligned_cols=153  Identities=22%  Similarity=0.260  Sum_probs=110.9

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             55789995878438999999867998899998898999988999998066452225302004442353100001235765
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNF   90 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~   90 (225)
                      .+.+|||+|||+|++++.+|+++++++++|+|+|+.+++.|++|+..++..    ++++.++|+...        ...++
T Consensus        87 ~~~~ilDlgtGSG~I~i~la~~~~~~~v~~~Dis~~Al~~A~~N~~~~~~~----~v~~~~~d~~~~--------~~~~~  154 (251)
T TIGR03534        87 GPLKVLDLGTGSGAIALALAKERPDARVTAVDISPEALAVARKNAKRLGLE----NVRFLKSDWFEP--------LPGGK  154 (251)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHCCCC----EEEEEECCHHHC--------CCCCC
T ss_conf             898699955671699999999679978999989879999999999980998----268651314321--------56898


Q ss_pred             CCEEEECCCCCCCCCCCC--CCH---HHHHHHCCCC---CCHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHCCCC
Q ss_conf             205772265446446547--885---4556520566---89899999999862469837870288889999998521788
Q gi|255764482|r   91 YDHVIMNPPFNERIGTMT--PDK---IKEEAHVMLE---DSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIG  162 (225)
Q Consensus        91 fDlii~nPPy~~~~~~~~--~~~---~~~~a~~~~~---~~~~~~~~~a~~lLkpgG~~~~i~~~~~l~~~l~~~~~~~~  162 (225)
                      ||+|+|||||-.......  ++.   ....|-....   ..+..++..+.++|+|+|.+++-+-..+...+...+.. .+
T Consensus       155 fDlIvsNPPYI~~~e~~~l~~eV~~~EP~~AL~gg~dGl~~~~~ii~~a~~~L~~~G~l~~Eig~~q~~~v~~l~~~-~g  233 (251)
T TIGR03534       155 FDLIVSNPPYIPEADIHLLDPEVRFHEPKLALFAGEDGLDFYRRIIAQAPRYLKPGGWLLLEIGYDQGEAVRALFEA-AG  233 (251)
T ss_pred             CCEEEECCCCCCHHHHHHCCCHHCCCCHHHHHCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECHHHHHHHHHHHHH-CC
T ss_conf             66899789988745666328601026729997179846999999999999853679889999683789999999996-89


Q ss_pred             CEEEEEECCCCCCC
Q ss_conf             46999814589698
Q gi|255764482|r  163 SLEITPLHPREGEC  176 (225)
Q Consensus       163 ~~~i~~v~~~~~~~  176 (225)
                      ...+..+....+.+
T Consensus       234 f~~i~~~kDl~g~~  247 (251)
T TIGR03534       234 FADVETRKDLAGKD  247 (251)
T ss_pred             CCEEEEEECCCCCC
T ss_conf             97068850789897


No 6  
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional
Probab=99.90  E-value=5.9e-22  Score=143.11  Aligned_cols=153  Identities=19%  Similarity=0.221  Sum_probs=110.8

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             55789995878438999999867998899998898999988999998066452225302004442353100001235765
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNF   90 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~   90 (225)
                      ...+|||+|||||++++.+++.+|+++++|+|+|+.+++.|++|+..++..    ++.+.++|+...        ....+
T Consensus       109 ~~~~ilDlgtGSGcI~isLa~~~p~~~v~a~DiS~~Al~~A~~Na~~~~l~----~v~~~~~d~~~~--------~~~~~  176 (277)
T PRK09328        109 QPCRILDLGTGTGAIALALASERPDCEVTAVDRMPDAVALAQRNAQHLAIK----NVRILQSDWFSA--------LSGQQ  176 (277)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHCCCC----EEEEEECCCHHH--------CCCCC
T ss_conf             788189954556999999998677989999648999999999999980988----699994475211--------37877


Q ss_pred             CCEEEECCCCCCCCCCCCCC----HHHHHHHCCCCC---CHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHCCCCC
Q ss_conf             20577226544644654788----545565205668---98999999998624698378702888899999985217884
Q gi|255764482|r   91 YDHVIMNPPFNERIGTMTPD----KIKEEAHVMLED---SFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGS  163 (225)
Q Consensus        91 fDlii~nPPy~~~~~~~~~~----~~~~~a~~~~~~---~~~~~~~~a~~lLkpgG~~~~i~~~~~l~~~l~~~~~~~~~  163 (225)
                      ||+|+|||||.+........    .....|-.....   .+..++..+.++|+|||.+++-+-..+...+-..+.. .+.
T Consensus       177 fDlIVSNPPYI~~~~~~~~~~~v~~EP~~AL~gg~dGl~~~~~ii~~a~~~L~~~G~l~~Eig~~Q~~~v~~l~~~-~gf  255 (277)
T PRK09328        177 FAMIVSNPPYIDAQDPHLQQGDVRFEPLSALVAADNGMADLAHIIEQARQYLVPGGWLLLEHGWQQGEAVRQLFIR-AGY  255 (277)
T ss_pred             CCEEEECCCCCCCCHHHHCCHHCCCCCHHHHHCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECHHHHHHHHHHHHH-CCC
T ss_conf             7889978998770003438242166838998179758999999999999844669899999681589999999996-799


Q ss_pred             EEEEEECCCCCCC
Q ss_conf             6999814589698
Q gi|255764482|r  164 LEITPLHPREGEC  176 (225)
Q Consensus       164 ~~i~~v~~~~~~~  176 (225)
                      ..+..+....+.+
T Consensus       256 ~~i~~~kDl~g~~  268 (277)
T PRK09328        256 SDVETCRDYGDNE  268 (277)
T ss_pred             CEEEEECCCCCCC
T ss_conf             7047861789992


No 7  
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional
Probab=99.89  E-value=4e-22  Score=144.03  Aligned_cols=117  Identities=26%  Similarity=0.363  Sum_probs=93.6

Q ss_pred             CCHHHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCC
Q ss_conf             66243899855789995878438999999867998899998898999988999998066452225302004442353100
Q gi|255764482|r    2 ILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENR   81 (225)
Q Consensus         2 lLa~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~   81 (225)
                      ||...++....++|||+|||.|.+++.++++.|..+++.+|+|..+++.|++|+..|+...     ++...|....    
T Consensus       187 lLL~~l~~~~~g~VLDlGCG~Gvi~~~la~~~p~~~v~l~Dv~a~Al~~ar~nl~~N~l~~-----~v~~sd~~~~----  257 (342)
T PRK09489        187 LLLSTLTPHTKGKVLDVGCGAGVLSAVLAQHSPKIRLTLCDVSAPAVEASRATLAANGLEG-----EVFASNVFSE----  257 (342)
T ss_pred             HHHHHCCCCCCCCEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCC-----EEEECCCCCC----
T ss_conf             9997378324884786067817999999986999769999688999999999899809886-----8997564456----


Q ss_pred             CCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             0012357652057722654464465478854556520566898999999998624698378702
Q gi|255764482|r   82 NLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIA  145 (225)
Q Consensus        82 ~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~  145 (225)
                           ..++||+|++|||||.+...             .....+.|++.|.+.|+|||.+++|.
T Consensus       258 -----v~~~fD~IvsNPPFH~G~~~-------------~~~i~~~fi~~A~~~L~~gG~L~iVA  303 (342)
T PRK09489        258 -----IKGRFDMIISNPPFHDGIQT-------------SLDAAQTLIRGAVRHLNSGGELRIVA  303 (342)
T ss_pred             -----CCCCCCEEEECCCCCCCCCC-------------CHHHHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             -----55678989968852157526-------------58999999999998612498899998


No 8  
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed
Probab=99.89  E-value=5.5e-22  Score=143.28  Aligned_cols=134  Identities=17%  Similarity=0.261  Sum_probs=102.4

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             85578999587843899999986799889999889899998899999806645222530200444235310000123576
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNN   89 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~   89 (225)
                      .+.-+|||+|||||++++.++..+|+++++|+|+|+++++.|++|+..++   ..+++.++++|++..        ...+
T Consensus       134 ~~~~~ILDLGTGSGcIaISLa~e~p~a~v~avDIS~~AL~vAk~Na~~~~---v~~ri~fi~sdwfe~--------l~~~  202 (503)
T PRK01544        134 DKFLNILELGTGSGCIAISLLCELPNANVIATDISLDAIEVAKSNAIKYE---VTDRIQIIHSNWFEN--------IGKQ  202 (503)
T ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHCC---CCCCEEEEECCCHHC--------CCCC
T ss_conf             55772788466679999999986789989999898999999999999808---820179996553101--------5888


Q ss_pred             CCCEEEECCCCCCCCCCCC--CCH---HHHHHHCCCCC---CHHHHHHHHHHHCCCCCEEEEECCHHH---HHHHH
Q ss_conf             5205772265446446547--885---45565205668---989999999986246983787028888---99999
Q gi|255764482|r   90 FYDHVIMNPPFNERIGTMT--PDK---IKEEAHVMLED---SFEKWIRTACAIMRSSGQLSLIARPQS---LIQIV  154 (225)
Q Consensus        90 ~fDlii~nPPy~~~~~~~~--~~~---~~~~a~~~~~~---~~~~~~~~a~~lLkpgG~~~~i~~~~~---l~~~l  154 (225)
                      +||+|+|||||........  ++.   ....|-.....   .+..++..|.++|+|+|++.+-+-.++   ..++|
T Consensus       203 kFDlIVSNPPYI~~~e~~~L~~eV~~yEP~lAL~ggeDGL~~Yr~Ia~~a~~~Lkp~G~l~lEIGy~Q~e~V~~IF  278 (503)
T PRK01544        203 KFDFIVSNPPYISHSEKSEMAIETINYEPSIALFAEEDGLQAYFIIAENAKQFLKPNGKIILEIGFKQAEAVTQIF  278 (503)
T ss_pred             CCCEEEECCCCCCHHHHHHCCHHHHCCCCHHHHCCCCCCHHHHHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHH
T ss_conf             7247983899887566665276653169378864887628999999998898528898899997878689999999


No 9  
>PRK09329 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional
Probab=99.87  E-value=8.4e-21  Score=136.59  Aligned_cols=151  Identities=16%  Similarity=0.108  Sum_probs=108.6

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             85578999587843899999986799889999889899998899999806645222530200444235310000123576
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNN   89 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~   89 (225)
                      ++...+||+|||+|++++.+++.+|+++++|+|+|+.+++.|++|+..++.     ++++.++|+...         ...
T Consensus       108 ~~~~~~lDlGtGSG~I~isla~~~p~~~v~avDiS~~Al~~A~~Na~~~~~-----~v~~~~~dl~~~---------~~~  173 (285)
T PRK09329        108 KEIQTFYDVCCGSGCIGLAIKKHCPHVHVVLSDICPQALAVAKSNAKSNGL-----DVDFLLGDLFAP---------FSR  173 (285)
T ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCCCEEEHHHCCHHHHHHHHHHHHHCCC-----CEEEEECCHHHH---------HCC
T ss_conf             777778884541799999999858986588033769999999999997299-----479997630033---------347


Q ss_pred             CCCEEEECCCCCCCCCCCC--CCH---HHHHHHCCCCC---CHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHCCC
Q ss_conf             5205772265446446547--885---45565205668---989999999986246983787028888999999852178
Q gi|255764482|r   90 FYDHVIMNPPFNERIGTMT--PDK---IKEEAHVMLED---SFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRI  161 (225)
Q Consensus        90 ~fDlii~nPPy~~~~~~~~--~~~---~~~~a~~~~~~---~~~~~~~~a~~lLkpgG~~~~i~~~~~l~~~l~~~~~~~  161 (225)
                      +||+|+|||||........  ++.   ....|-.....   .+..++..+.++|+|||.+++-+-.++...+-..+....
T Consensus       174 ~~DlIvSNPPYI~~~e~~~l~~eV~~~EP~~AL~gg~dGl~~~r~i~~~a~~~L~~~G~l~~Eig~~Q~~~v~~l~~~~g  253 (285)
T PRK09329        174 PADAFVCNPPYLSFKEFFHVDPEVRCHEPWKALVGGSSGLEFYQRIAQELPKILVPGGVGWLEIGSSQGESVKKIFAKHG  253 (285)
T ss_pred             CCCEEEECCCCCCHHHHHHCCHHHHHCCCHHHHHCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHCC
T ss_conf             67889989998884445449875543670998847973899999999999996004988999968548999999999669


Q ss_pred             CCEEEEEECCCCCCC
Q ss_conf             846999814589698
Q gi|255764482|r  162 GSLEITPLHPREGEC  176 (225)
Q Consensus       162 ~~~~i~~v~~~~~~~  176 (225)
                      ...  ..+....+.+
T Consensus       254 ~~~--~v~kDl~G~~  266 (285)
T PRK09329        254 ISG--RVLQDLAGLD  266 (285)
T ss_pred             CCC--EEEECCCCCC
T ss_conf             964--2811799995


No 10 
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis]
Probab=99.87  E-value=2.6e-21  Score=139.45  Aligned_cols=119  Identities=23%  Similarity=0.344  Sum_probs=93.9

Q ss_pred             CCHHHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCC
Q ss_conf             66243899855789995878438999999867998899998898999988999998066452225302004442353100
Q gi|255764482|r    2 ILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENR   81 (225)
Q Consensus         2 lLa~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~   81 (225)
                      ||+...+...+.+|||+|||.|.+++.+|++.|..+++.+|+|..+++.||+|+..|+..+.    ++...|+...    
T Consensus       149 lLl~~l~~~~~~~vlDlGCG~Gvlg~~la~~~p~~~vtmvDvn~~Av~~ar~Nl~~N~~~~~----~v~~s~~~~~----  220 (300)
T COG2813         149 LLLETLPPDLGGKVLDLGCGYGVLGLVLAKKSPQAKLTLVDVNARAVESARKNLAANGVENT----EVWASNLYEP----  220 (300)
T ss_pred             HHHHHCCCCCCCCEEEECCCCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHCCCCCC----EEEEECCCCC----
T ss_conf             99973775569968870788429999999868987289982669999998876997398763----7998124466----


Q ss_pred             CCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECC
Q ss_conf             00123576520577226544644654788545565205668989999999986246983787028
Q gi|255764482|r   82 NLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIAR  146 (225)
Q Consensus        82 ~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~  146 (225)
                          .. ++||+|+|||||+......             ......+++.|.+.|++||.+++|..
T Consensus       221 ----v~-~kfd~IisNPPfh~G~~v~-------------~~~~~~ii~~A~~~L~~gGeL~iVan  267 (300)
T COG2813         221 ----VE-GKFDLIISNPPFHAGKAVV-------------HSLAQEIIAAAARHLKPGGELWIVAN  267 (300)
T ss_pred             ----CC-CCCCEEEECCCCCCCCCHH-------------HHHHHHHHHHHHHHHCCCCEEEEEEC
T ss_conf             ----54-4006898488846771016-------------78899999999976045977999975


No 11 
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis]
Probab=99.86  E-value=1.8e-20  Score=134.73  Aligned_cols=133  Identities=20%  Similarity=0.257  Sum_probs=97.0

Q ss_pred             EEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCE
Q ss_conf             89995878438999999867998899998898999988999998066452225302004442353100001235765205
Q gi|255764482|r   14 HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFYDH   93 (225)
Q Consensus        14 ~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~fDl   93 (225)
                      +|||+|||||++++.+|++++.++|+|+|+|+.++++|++|+..++.    .++.++++|++..         ..++||+
T Consensus       113 ~ilDlGTGSG~iai~la~~~~~~~V~a~Dis~~Al~~A~~Na~~~~l----~~~~~~~~dlf~~---------~~~~fDl  179 (280)
T COG2890         113 RILDLGTGSGAIAIALAKEGPDAEVIAVDISPDALALARENAERNGL----VRVLVVQSDLFEP---------LRGKFDL  179 (280)
T ss_pred             CEEEECCCCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCC----CCEEEEECCHHHC---------CCCCCCE
T ss_conf             18996588319999999618988799998999999999999998289----7479874003334---------6888577


Q ss_pred             EEECCCCCCCCC-CCCCC---HHHHHHHCCCC---CCHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHC
Q ss_conf             772265446446-54788---54556520566---89899999999862469837870288889999998521
Q gi|255764482|r   94 VIMNPPFNERIG-TMTPD---KIKEEAHVMLE---DSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR  159 (225)
Q Consensus        94 ii~nPPy~~~~~-~~~~~---~~~~~a~~~~~---~~~~~~~~~a~~lLkpgG~~~~i~~~~~l~~~l~~~~~  159 (225)
                      |++||||.+... ...+.   .....+-....   .....|+..+.+.|+|||.+.+-+-..+...+...+..
T Consensus       180 IVsNPPYip~~~~~~~~~~~~~EP~~Al~~g~dGl~~~~~i~~~a~~~l~~~g~l~le~g~~q~~~v~~~~~~  252 (280)
T COG2890         180 IVSNPPYIPAEDPELLPEVVRYEPLLALVGGGDGLEVYRRILGEAPDILKPGGVLILEIGLTQGEAVKALFED  252 (280)
T ss_pred             EEECCCCCCCCCCCCCCCCCCCCHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHHH
T ss_conf             9968998888521137421358979987248777899999999899872868289999769848999999997


No 12 
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed
Probab=99.84  E-value=5.6e-20  Score=131.97  Aligned_cols=111  Identities=19%  Similarity=0.273  Sum_probs=93.9

Q ss_pred             HHCCCCCCCEEEEECCCHHHHHHHHHHHC-CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC
Q ss_conf             43899855789995878438999999867-99889999889899998899999806645222530200444235310000
Q gi|255764482|r    5 SLVNATGSFHLADLGAGAGAAGLAVASRL-HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL   83 (225)
Q Consensus         5 ~~~~~~~~~~VLDlGcG~G~~~l~la~r~-~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~   83 (225)
                      +++..++|++|||+|||+|..++.+|++. +..+|+|+|+++.|++.||+|.+..+..|    ++|.++|+.+..     
T Consensus        67 ~~a~l~pGe~VLDLGcG~G~d~~~aA~~VG~~G~ViGVD~s~~ML~~Ar~~a~~~G~~N----VeF~~Gdae~LP-----  137 (258)
T PRK11873         67 ALAELKPGETVLDLGSGAGFDCFLAARRVGPTGKVIGVDMTPEMLAKARANARKAGYTN----VEFRLGEIEALP-----  137 (258)
T ss_pred             CCCCCCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHCCCCC----EEEEEECCCCCC-----
T ss_conf             54657999989994788777599999986999779998599999999999999759975----599995553136-----


Q ss_pred             CCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             1235765205772265446446547885455652056689899999999862469837870
Q gi|255764482|r   84 AGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLI  144 (225)
Q Consensus        84 ~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i  144 (225)
                        .++++||+|++|--.+..                  ......+..+.|+|||||++++.
T Consensus       138 --l~D~SfDvViSncVlnl~------------------pDk~~vl~E~~RVLKPGGRl~IS  178 (258)
T PRK11873        138 --VADGSVDVIISNCVINLS------------------PDKERVFREAFRVLKPGGRFAIS  178 (258)
T ss_pred             --CCCCCEEEEEECCEEECC------------------CCHHHHHHHHHHHCCCCCEEEEE
T ss_conf             --898835199882467607------------------98799999999962889789999


No 13 
>PRK01683 trans-aconitate 2-methyltransferase; Provisional
Probab=99.83  E-value=5.7e-20  Score=131.90  Aligned_cols=109  Identities=21%  Similarity=0.245  Sum_probs=90.4

Q ss_pred             CHHHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCC
Q ss_conf             62438998557899958784389999998679988999988989999889999980664522253020044423531000
Q gi|255764482|r    3 LASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRN   82 (225)
Q Consensus         3 La~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~   82 (225)
                      |.+.++.+++++|||+|||+|.++..++.++|+++|+|+|.|+.|++.|+++.         ..+++.++|+..+.    
T Consensus        23 Ll~~l~~~~~~~vlDlGCG~G~~t~~l~~r~p~a~v~GiD~S~~Ml~~Ar~~~---------~~~~f~~~D~~~~~----   89 (252)
T PRK01683         23 LLARVPLENVEYVADLGCGPGNSTALLHQRWPAARITGIDSSPAMLAEARQAL---------PDCQFVEADIRNWQ----   89 (252)
T ss_pred             HHHCCCCCCCCEEEEECCCCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHC---------CCCEEEECCHHCCC----
T ss_conf             98418888999899937749899999999779987999989899999999758---------99838725042078----


Q ss_pred             CCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECC
Q ss_conf             0123576520577226544644654788545565205668989999999986246983787028
Q gi|255764482|r   83 LAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIAR  146 (225)
Q Consensus        83 ~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~  146 (225)
                          +.+.||+|+||--.+..                  ......+....+.|+|||++++-+|
T Consensus        90 ----~~~~~D~ifSNaalhW~------------------~d~~~~~~~~~~~L~PGG~la~Q~p  131 (252)
T PRK01683         90 ----PEQALDLIYANASLQWL------------------PDHYELFPHLVSLLAPQGVLAVQMP  131 (252)
T ss_pred             ----CCCCCCEEEEEEEHHHC------------------CCHHHHHHHHHHHCCCCCEEEEECC
T ss_conf             ----76787889561004507------------------8779999999982487879999889


No 14 
>pfam01170 UPF0020 Putative RNA methylase family UPF0020. This domain is probably a methylase. It is associated with the THUMP domain that also occurs with RNA modification domains.
Probab=99.79  E-value=2.1e-18  Score=123.07  Aligned_cols=125  Identities=20%  Similarity=0.285  Sum_probs=98.6

Q ss_pred             CHHHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCC
Q ss_conf             62438998557899958784389999998679988999988989999889999980664522253020044423531000
Q gi|255764482|r    3 LASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRN   82 (225)
Q Consensus         3 La~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~   82 (225)
                      |.+++..++++.|+|++||+|++.+..|...++..++|+|+|+.|++.|+.|++.++.   .+.+.+.++|+....    
T Consensus        20 l~~la~~~~g~~vlDP~CGSGtilIEAa~~~~~~~~~G~Did~~~v~~A~~N~~~~g~---~~~i~~~~~D~~~l~----   92 (171)
T pfam01170        20 MVNLAGWKPGDPLLDPFCGSGTILIEAALMGANVALYGSDIDRRMVRGARINAEAAGV---GDKIEFVQADAADLP----   92 (171)
T ss_pred             HHHHHCCCCCCEEEECCCCCCHHHHHHHHHHCCCCCEEEECCHHHHHHHHHHHHHHCC---CCCEEEEECCHHHCC----
T ss_conf             9998589999978868998789999999961358953675879999999999998289---984699976665387----


Q ss_pred             CCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHHH
Q ss_conf             0123576520577226544644654788545565205668989999999986246983787028888
Q gi|255764482|r   83 LAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQS  149 (225)
Q Consensus        83 ~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~~  149 (225)
                         .+.++||.|++||||+...+...          .....+..+.+.+.+.++  |+.+++.+...
T Consensus        93 ---~~~~~~d~Iv~nPPYG~r~~~~~----------~~~~ly~~~~~~~~~~~~--g~~~~i~~~~~  144 (171)
T pfam01170        93 ---LLNGSVDTIVTDPPYGIRIGSKG----------ALEKLYPAFLDEAKRVLR--GRLVFATPEKK  144 (171)
T ss_pred             ---CCCCCCEEEEECCCCCCCCCCHH----------HHHHHHHHHHHHHHHHCC--CCEEEEEECCH
T ss_conf             ---98788318998898201136545----------699999999999998689--97899996868


No 15 
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed
Probab=99.79  E-value=1.7e-18  Score=123.53  Aligned_cols=114  Identities=17%  Similarity=0.280  Sum_probs=91.5

Q ss_pred             CHHHCCCCCCCEEEEECCCHHHHHHHHHHHCC-CCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCC
Q ss_conf             62438998557899958784389999998679-98899998898999988999998066452225302004442353100
Q gi|255764482|r    3 LASLVNATGSFHLADLGAGAGAAGLAVASRLH-EAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENR   81 (225)
Q Consensus         3 La~~~~~~~~~~VLDlGcG~G~~~l~la~r~~-~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~   81 (225)
                      +++.+.+++|++|||+|||||.++..++++.+ .++|+|+|+|+.|++.|++.+...+   ...++++.++|.....   
T Consensus        43 ~v~~l~~~~g~~vLDvgcGTG~~~~~l~~~~~~~~~v~g~D~S~~ML~~A~~k~~~~~---~~~~i~~~~~da~~lp---  116 (239)
T PRK00216         43 TIKWLGVRPGDKVLDLACGTGDLAIALAKAVGETGEVVGLDFSEGMLAVGREKLLDKG---LSGNVEFVQGDAEALP---  116 (239)
T ss_pred             HHHHCCCCCCCEEEEECCCCCHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHHCC---CCCCCEEEEECCCCCC---
T ss_conf             9986278999989884577638799999972997679999198899999999999738---9888507982355688---


Q ss_pred             CCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             001235765205772265446446547885455652056689899999999862469837870
Q gi|255764482|r   82 NLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLI  144 (225)
Q Consensus        82 ~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i  144 (225)
                          .++++||.|++.--.+.                  -.+....++.+.|.|||||++.+.
T Consensus       117 ----f~d~sfD~v~~~f~l~~------------------~~d~~~~l~E~~RVLkPGG~l~il  157 (239)
T PRK00216        117 ----FPDNSFDAVTIAFGLRN------------------VPDIDKALREMYRVLKPGGRLVIL  157 (239)
T ss_pred             ----CCCCCCCCCCCCCEEEE------------------CCCHHHHHHHHHHHCCCCEEEEEE
T ss_conf             ----87666765002615671------------------486799999999876648089999


No 16 
>pfam02384 N6_Mtase N-6 DNA Methylase. Restriction-modification (R-M) systems protect a bacterial cell against invasion of foreign DNA by endonucleolytic cleavage of DNA that lacks a site specific modification. The R-M system is a complex containing three polypeptides: M (this family), S (pfam01420), and R. This family consists of N-6 adenine-specific DNA methylase EC:2.1.1.72 from Type I and Type IC restriction systems. These methylases have the same sequence specificity as their corresponding restriction enzymes.
Probab=99.78  E-value=2.6e-17  Score=116.87  Aligned_cols=141  Identities=15%  Similarity=0.198  Sum_probs=98.4

Q ss_pred             CCHHHCCCCCCCEEEEECCCHHHHHHHHHHHC-------CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCC
Q ss_conf             66243899855789995878438999999867-------99889999889899998899999806645222530200444
Q gi|255764482|r    2 ILASLVNATGSFHLADLGAGAGAAGLAVASRL-------HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV   74 (225)
Q Consensus         2 lLa~~~~~~~~~~VLDlGcG~G~~~l~la~r~-------~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~   74 (225)
                      ||+.++.++++++|+|++||||.+.+...++.       .+.+++|+|+++.++.+|+-|+.+++...  ....+.++|.
T Consensus        37 lmv~ll~p~~~~~V~DPacGtGgfLi~a~~~i~~~~~~~~~~~i~G~E~~~~~~~la~mNm~lhgi~~--~~~~i~~gds  114 (312)
T pfam02384        37 LIVELLEPKPGESIYDPACGSGGFLIQADKFVKSHDGDTNDISIYGQELNPTTYRLARMNMILHGIEY--NDFGIRHGDT  114 (312)
T ss_pred             HHHHHHCCCCCCEEECCCCCCCHHHHHHHHHHHHHCCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCC--CCCCCCCCCC
T ss_conf             99998289999988216877337899999999984378556556368899899999999999847988--7455214776


Q ss_pred             CCCCCCCCCCCCCCCCCCEEEECCCCCCCCCC--CCCCHHHHHHHCC---CCCCHHHHHHHHHHHCCCCCEEEEECCHHH
Q ss_conf             23531000012357652057722654464465--4788545565205---668989999999986246983787028888
Q gi|255764482|r   75 TLVGENRNLAGLKNNFYDHVIMNPPFNERIGT--MTPDKIKEEAHVM---LEDSFEKWIRTACAIMRSSGQLSLIARPQS  149 (225)
Q Consensus        75 ~~~~~~~~~~~~~~~~fDlii~nPPy~~~~~~--~~~~~~~~~a~~~---~~~~~~~~~~~a~~lLkpgG~~~~i~~~~~  149 (225)
                      ......     ....+||+|++||||......  ...+..+. ....   ....--.|+.++...|++||++++|.|..-
T Consensus       115 l~~~~~-----~~~~kfD~IlsNPPFg~k~~~~~~~~~~~~~-~~~~~~~~~~~e~~Fiqh~l~~Lk~~GraaiVlp~g~  188 (312)
T pfam02384       115 LLSPKF-----EEDKKFDVVVANPPFNQKWDANDNLENDPRF-RAYGVPPKSNADFAFLQHIIYHLSPNGRAAVVLPNGV  188 (312)
T ss_pred             CCCCCC-----CCCCCCCEEEECCCCCCCCCCCCCCCCCCCH-HCCCCCCCCCHHHHHHHHHHHHCCCCCEEEEEECCCC
T ss_conf             557676-----6545511898378646676654321027211-0368788874429999999985699976999955823


Q ss_pred             H
Q ss_conf             9
Q gi|255764482|r  150 L  150 (225)
Q Consensus       150 l  150 (225)
                      |
T Consensus       189 L  189 (312)
T pfam02384       189 L  189 (312)
T ss_pred             C
T ss_conf             1


No 17 
>PRK08317 hypothetical protein; Provisional
Probab=99.78  E-value=4.4e-18  Score=121.25  Aligned_cols=111  Identities=17%  Similarity=0.261  Sum_probs=90.5

Q ss_pred             HHCCCCCCCEEEEECCCHHHHHHHHHHHC-CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC
Q ss_conf             43899855789995878438999999867-99889999889899998899999806645222530200444235310000
Q gi|255764482|r    5 SLVNATGSFHLADLGAGAGAAGLAVASRL-HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL   83 (225)
Q Consensus         5 ~~~~~~~~~~VLDlGcG~G~~~l~la~r~-~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~   83 (225)
                      ..+.+++|.+|||+|||+|.++..+|.+. |+++|+|+|+|+.|++.|++.....     ..++++.++|+....     
T Consensus        13 ~~L~l~pG~~vLDiGcG~G~~~~~la~~~g~~~~v~gvD~s~~~l~~a~~~~~~~-----~~~v~~~~~d~~~lp-----   82 (241)
T PRK08317         13 ELLAVQPGERVLDVGCGPGNDLRELADRVGPEGRVVGIDRSEAMLALARERAAGL-----LSNVEFVRGDADGLP-----   82 (241)
T ss_pred             HHCCCCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHC-----CCCEEEEECCHHHCC-----
T ss_conf             7369999799999664174999999997499978999969889999999998622-----896499955464358-----


Q ss_pred             CCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             12357652057722654464465478854556520566898999999998624698378702
Q gi|255764482|r   84 AGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIA  145 (225)
Q Consensus        84 ~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~  145 (225)
                        .++++||+|++.--++.                  .......++.+.|.|||||+++++-
T Consensus        83 --~~d~sfD~v~~~~~l~h------------------~~d~~~~l~e~~RvLkPGG~~vi~d  124 (241)
T PRK08317         83 --FPDESFDAVRSDRVLQH------------------LEDPRRALAEMARVLRPGGRAVVLD  124 (241)
T ss_pred             --CCCCCCCEEEHHHHHHH------------------CCCHHHHHHHHHHHCCCCCEEEEEE
T ss_conf             --98887045622115762------------------2589999999999818883899996


No 18 
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only]
Probab=99.76  E-value=3.2e-18  Score=122.06  Aligned_cols=177  Identities=20%  Similarity=0.216  Sum_probs=122.7

Q ss_pred             CHHHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCC
Q ss_conf             62438998557899958784389999998679988999988989999889999980664522253020044423531000
Q gi|255764482|r    3 LASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRN   82 (225)
Q Consensus         3 La~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~   82 (225)
                      |.+.++.....+|.|+|||+|..+-.|++|+|++.++|+|.|++|++.|+...         ..+++.++|+..+.    
T Consensus        22 Lla~Vp~~~~~~v~DLGCGpGnsTelL~~RwP~A~i~GiDsS~~Mla~Aa~rl---------p~~~f~~aDl~~w~----   88 (257)
T COG4106          22 LLARVPLERPRRVVDLGCGPGNSTELLARRWPDAVITGIDSSPAMLAKAAQRL---------PDATFEEADLRTWK----   88 (257)
T ss_pred             HHHHCCCCCCCEEEECCCCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHC---------CCCCEECCCHHHCC----
T ss_conf             98647866641034557788778899998688886760469999999999748---------99732105275449----


Q ss_pred             CCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECC----------------
Q ss_conf             0123576520577226544644654788545565205668989999999986246983787028----------------
Q gi|255764482|r   83 LAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIAR----------------  146 (225)
Q Consensus        83 ~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~----------------  146 (225)
                          +...+|++++|.-+..-.                  ...+.+......|.|||.+++-.|                
T Consensus        89 ----p~~~~dllfaNAvlqWlp------------------dH~~ll~rL~~~L~Pgg~LAVQmPdN~depsH~~mr~~A~  146 (257)
T COG4106          89 ----PEQPTDLLFANAVLQWLP------------------DHPELLPRLVSQLAPGGVLAVQMPDNLDEPSHRLMRETAD  146 (257)
T ss_pred             ----CCCCCCHHHHHHHHHHCC------------------CCHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHH
T ss_conf             ----987633033443664436------------------4089999999850888569997887647645799999874


Q ss_pred             --------------------HHHHHHHHHHHHCCCCCEEEEEECCCCCCCCEEEEEEEEECCCCCCE-EECCEEEECCCC
Q ss_conf             --------------------88899999985217884699981458969830999999977888747-707568983887
Q gi|255764482|r  147 --------------------PQSLIQIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLR-FRYPIVLHKPNG  205 (225)
Q Consensus       147 --------------------~~~l~~~l~~~~~~~~~~~i~~v~~~~~~~~~~vlv~~~k~~~~~~~-~~~~l~l~~~~g  205 (225)
                                          +..+.+++.....+...++..+-|+..+..+   ||+|.|+.  +++ ++.+|  -+++-
T Consensus       147 ~~p~~~~l~~~~~~r~~v~s~a~Yy~lLa~~~~rvDiW~T~Y~h~l~~a~a---IvdWvkgT--gLrP~L~~L--~e~~~  219 (257)
T COG4106         147 EAPFAQELGGRGLTRAPLPSPAAYYELLAPLACRVDIWHTTYYHQLPGADA---IVDWVKGT--GLRPYLDRL--DEEER  219 (257)
T ss_pred             CCCHHHHHCCCCCCCCCCCCHHHHHHHHCCCCCEEEEEEEECCCCCCCCCC---HHHHEECC--CCCEECCCC--CHHHH
T ss_conf             283666627665446778998999998576543255454123433798632---22110024--542002015--98999


Q ss_pred             CHHHHHHHHHHCCCCC
Q ss_conf             4001899999738763
Q gi|255764482|r  206 QPYSRFVTDLINGKRS  221 (225)
Q Consensus       206 ~~yt~~~~~l~~~~~~  221 (225)
                      ..|-+.+..++....+
T Consensus       220 ~~FL~~Y~~~l~~aYP  235 (257)
T COG4106         220 QRFLDRYLALLAEAYP  235 (257)
T ss_pred             HHHHHHHHHHHHHHCC
T ss_conf             9999999999997688


No 19 
>pfam01209 Ubie_methyltran ubiE/COQ5 methyltransferase family.
Probab=99.76  E-value=8.5e-18  Score=119.64  Aligned_cols=112  Identities=10%  Similarity=0.197  Sum_probs=90.5

Q ss_pred             HHHCCCCCCCEEEEECCCHHHHHHHHHHHC-CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCC
Q ss_conf             243899855789995878438999999867-9988999988989999889999980664522253020044423531000
Q gi|255764482|r    4 ASLVNATGSFHLADLGAGAGAAGLAVASRL-HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRN   82 (225)
Q Consensus         4 a~~~~~~~~~~VLDlGcG~G~~~l~la~r~-~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~   82 (225)
                      +..+.+++|++|||+|||||.++..++++. +.++++|+|+|+.|++.|++++...+.    .++++.++|..+..    
T Consensus        40 v~~~~~~~g~~vLDl~cGTG~~~~~l~~~~~~~~~v~gvD~S~~ML~~a~~k~~~~~~----~~i~~~~~da~~lp----  111 (233)
T pfam01209        40 MKCMGVKRGNKFLDVAGGTGDWTFGLSDSAGSSGKVVGLDINENMLKEGEKKAKEEGK----YNIEFLQGNAEELP----  111 (233)
T ss_pred             HHHCCCCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHCCC----CCCEEEEECCCCCC----
T ss_conf             9861899999899825405889999999849997499996999999999999985699----98369982166688----


Q ss_pred             CCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             01235765205772265446446547885455652056689899999999862469837870
Q gi|255764482|r   83 LAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLI  144 (225)
Q Consensus        83 ~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i  144 (225)
                         .++++||.|.+.--...                  -.+....++++.|.|||||++.++
T Consensus       112 ---f~d~sfD~v~~~fglrn------------------~~d~~~al~E~~RVLKPGG~l~il  152 (233)
T pfam01209       112 ---FEDDSFDIVTISFGLRN------------------FPDYLKVLKEAFRVLKPGGRVVCL  152 (233)
T ss_pred             ---CCCCCCCHHHHHHHHHC------------------CCCHHHHHHHHHHHCCCCCEEEEE
T ss_conf             ---66656573142101212------------------588899999999872789789999


No 20 
>TIGR00537 hemK_rel_arch methylase, putative; InterPro: IPR004557   These proteins exhibit homology to the Saccharomyces cerevisiae (yeast) ORF YDR140w (FYV9). No known function has been described for this yeast ORF though the null mutant is viable and exhibits K1 killer toxin hypersensitivity. Members of this entry are weakly related to the yeast ORF YNL063w which is a putative S-adenosyl-methionine-dependent methyltransferase . Members of this entry are found in archaeal, bacterial and eukaryotic lineages.; GO: 0008168 methyltransferase activity.
Probab=99.76  E-value=5.2e-18  Score=120.85  Aligned_cols=144  Identities=15%  Similarity=0.264  Sum_probs=109.7

Q ss_pred             CCHHHCCCCCCCE-EEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCC
Q ss_conf             6624389985578-999587843899999986799889999889899998899999806645222530200444235310
Q gi|255764482|r    2 ILASLVNATGSFH-LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGEN   80 (225)
Q Consensus         2 lLa~~~~~~~~~~-VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~   80 (225)
                      ||++-....++++ |||+|+|||.+++.++.+. .-.|+++|+||.++.++|+|+..|+.     .+.+.+.|+....  
T Consensus        11 LL~~nL~~~k~ddeVlEiG~GtGlvair~~~Kg-~k~i~~tDinP~Avk~~~~NA~~N~~-----~l~v~~~Dlf~~v--   82 (183)
T TIGR00537        11 LLEANLRELKPDDEVLEIGAGTGLVAIRLKEKG-KKKILTTDINPFAVKLLRENAKLNNV-----ELDVLETDLFEGV--   82 (183)
T ss_pred             HHHHHHHHHCCCCEEEEEECCHHHHHHHHHCCC-CCEEEEEECCHHHHHHHHHCCHHCCC-----CEEEEECCCCCCC--
T ss_conf             999986751699528997168048999985158-82078863687999987731000266-----4047611135785--


Q ss_pred             CCCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCC---CHHHHHHHHHHHCCCCCEEEEECCHHH-HHHHHHH
Q ss_conf             000123576520577226544644654788545565205668---989999999986246983787028888-9999998
Q gi|255764482|r   81 RNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLED---SFEKWIRTACAIMRSSGQLSLIARPQS-LIQIVNA  156 (225)
Q Consensus        81 ~~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~---~~~~~~~~a~~lLkpgG~~~~i~~~~~-l~~~l~~  156 (225)
                            ..++||+|+-||||.+..+....++....|--++..   ....|+...-.+||+||+..++..... -.+.+..
T Consensus        83 ------~geKFdviLFNpPYlp~~~d~~~gd~Ld~A~dGGkdGr~vidrFldelp~~lk~gGrv~l~~SSl~~e~~~~~k  156 (183)
T TIGR00537        83 ------RGEKFDVILFNPPYLPLEDDEKRGDYLDLAIDGGKDGRKVIDRFLDELPEYLKEGGRVQLIQSSLSDEKDTLDK  156 (183)
T ss_pred             ------CCCCEEEEEECCCCCCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHH
T ss_conf             ------55510277307898888765234766443331787305788888765688870599899996066886889988


Q ss_pred             HHC
Q ss_conf             521
Q gi|255764482|r  157 CAR  159 (225)
Q Consensus       157 ~~~  159 (225)
                      +..
T Consensus       157 l~~  159 (183)
T TIGR00537       157 LDE  159 (183)
T ss_pred             HHH
T ss_conf             761


No 21 
>smart00828 PKS_MT Methyltransferase  in polyketide synthase (PKS) enzymes.
Probab=99.75  E-value=1.7e-17  Score=117.90  Aligned_cols=103  Identities=19%  Similarity=0.178  Sum_probs=85.6

Q ss_pred             CEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             78999587843899999986799889999889899998899999806645222530200444235310000123576520
Q gi|255764482|r   13 FHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFYD   92 (225)
Q Consensus        13 ~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~fD   92 (225)
                      +||||+|||+|..+..+|+++|..+++|+|+++.|++.|+++++..+   ...++.+.++|......        .++||
T Consensus         1 krVLDiGCG~G~~~~~LA~~~p~~~v~GvDiS~~~ie~Ar~r~~~~g---l~~rv~~~~~Da~~lpf--------~d~FD   69 (224)
T smart00828        1 KRVLDFGCGYGSDLIDLAERHPHLQLHGYTISPEQAEVGRERIRALG---LQGRIRIFYRDSAKDPF--------PDTYD   69 (224)
T ss_pred             CEEEEEECCCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHCC---CCCCEEEEECCHHCCCC--------CCCCC
T ss_conf             90899836688889999997799889999799999999999999729---98651478521103999--------99835


Q ss_pred             EEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             5772265446446547885455652056689899999999862469837870
Q gi|255764482|r   93 HVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLI  144 (225)
Q Consensus        93 lii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i  144 (225)
                      +|++.--.+                  +......+++.+.|.|||||++.+.
T Consensus        70 ~V~s~evl~------------------Hi~D~~~~l~ei~RvLKPGG~lvia  103 (224)
T smart00828       70 LVFGFEVIH------------------HIKDKMDLFSNISRHLKDGGHLVLA  103 (224)
T ss_pred             EEEHHHHHH------------------CCCCHHHHHHHHHHHCCCCEEEEEE
T ss_conf             676853576------------------5399999999999871798499999


No 22 
>KOG2904 consensus
Probab=99.74  E-value=8.5e-17  Score=113.99  Aligned_cols=130  Identities=19%  Similarity=0.192  Sum_probs=92.1

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             55789995878438999999867998899998898999988999998066452225302004442353100001235765
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNF   90 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~   90 (225)
                      ++..+||+|||+|++++.+++..+.+.+++||.++.++.+|.+|+..+.   .+.++.+++.+.......  .-....++
T Consensus       148 ~~~~ildlgtGSGaIslsll~~L~~~~v~AiD~S~~Ai~La~eN~qr~~---l~g~i~v~~~~me~d~~~--~~~l~~~~  222 (328)
T KOG2904         148 KHTHILDLGTGSGAISLSLLHGLPQCTVTAIDVSKAAIKLAKENAQRLK---LSGRIEVIHNIMESDASD--EHPLLEGK  222 (328)
T ss_pred             CCCEEEEECCCCCHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHHHH---HCCCEEEEECCCCCCCCC--CCCCCCCC
T ss_conf             6666887057831889999834787348998532889999998899874---158468984122201256--55454575


Q ss_pred             CCEEEECCCCCCCCCCCCCC--HHHH---HH---HCCCCCCHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             20577226544644654788--5455---65---20566898999999998624698378702
Q gi|255764482|r   91 YDHVIMNPPFNERIGTMTPD--KIKE---EA---HVMLEDSFEKWIRTACAIMRSSGQLSLIA  145 (225)
Q Consensus        91 fDlii~nPPy~~~~~~~~~~--~~~~---~a---~~~~~~~~~~~~~~a~~lLkpgG~~~~i~  145 (225)
                      .|++++||||....+.....  ....   .|   ..+....+..+...+.|+|+|||.+.+-+
T Consensus       223 ~dllvsNPPYI~~dD~~~l~~eV~~yEp~lALdGg~eG~~~~~~~~~~a~R~Lq~gg~~~le~  285 (328)
T KOG2904         223 IDLLVSNPPYIRKDDNRQLKPEVRLYEPKLALDGGLEGYDNLVHYWLLATRMLQPGGFEQLEL  285 (328)
T ss_pred             EEEEECCCCCCCCCCHHHCCCHHEECCCHHHHCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEE
T ss_conf             248853899655551223271330237445430666326999999876675456688588973


No 23 
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair]
Probab=99.73  E-value=7e-17  Score=114.46  Aligned_cols=129  Identities=16%  Similarity=0.265  Sum_probs=96.6

Q ss_pred             CCHHHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECC-CCCCCCCC
Q ss_conf             66243899855789995878438999999867998899998898999988999998066452225302004-44235310
Q gi|255764482|r    2 ILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEV-DVTLVGEN   80 (225)
Q Consensus         2 lLa~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~-D~~~~~~~   80 (225)
                      .|++++.+++|+.|||+.||||++.+.+...  |++++|.|++..|+.-|+.|++.-+..   + ..+... |.....  
T Consensus       188 ~mVNLa~v~~G~~vlDPFcGTGgiLiEagl~--G~~viG~Did~~mv~gak~Nl~~y~i~---~-~~~~~~~Da~~lp--  259 (347)
T COG1041         188 AMVNLARVKRGELVLDPFCGTGGILIEAGLM--GARVIGSDIDERMVRGAKINLEYYGIE---D-YPVLKVLDATNLP--  259 (347)
T ss_pred             HHHHHHCCCCCCEEECCCCCCCHHHHHHHHC--CCEEEECCHHHHHHHHHHHHHHHHCCC---C-EEEEEECCCCCCC--
T ss_conf             9877741646987645767834888836642--756760323799985566415662767---6-1688730221277--


Q ss_pred             CCCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHHHHHH
Q ss_conf             000123576520577226544644654788545565205668989999999986246983787028888999
Q gi|255764482|r   81 RNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQ  152 (225)
Q Consensus        81 ~~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~~l~~  152 (225)
                           ....++|-|++.|||+.........         .+..+.++++.+...||+||+++|..|-....+
T Consensus       260 -----l~~~~vdaIatDPPYGrst~~~~~~---------l~~Ly~~~le~~~evLk~gG~~vf~~p~~~~~~  317 (347)
T COG1041         260 -----LRDNSVDAIATDPPYGRSTKIKGEG---------LDELYEEALESASEVLKPGGRIVFAAPRDPRHE  317 (347)
T ss_pred             -----CCCCCCCEEEECCCCCCCCCCCCCC---------HHHHHHHHHHHHHHHHHCCCEEEEECCCCCHHH
T ss_conf             -----8877423588469987100245552---------899999999999987304848999617860556


No 24 
>PRK10258 biotin biosynthesis protein BioC; Provisional
Probab=99.73  E-value=4e-17  Score=115.86  Aligned_cols=121  Identities=20%  Similarity=0.210  Sum_probs=92.9

Q ss_pred             CHHHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCC
Q ss_conf             62438998557899958784389999998679988999988989999889999980664522253020044423531000
Q gi|255764482|r    3 LASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRN   82 (225)
Q Consensus         3 La~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~   82 (225)
                      |+..++..+..+|||+|||+|.++..++++  +.+++|+|+++.|++.|+++..         ...++++|+....    
T Consensus        34 Ll~~l~~~~~~~vLDlGcGtG~~t~~l~~~--~~~v~~~Dls~~Ml~~a~~~~~---------~~~~~~~D~e~Lp----   98 (251)
T PRK10258         34 LLAMLPQRKFTHVLDAGCGPGWMSRYWRER--GSQVTALDLSPPMLAQARQKDA---------ADHYLAGDIESLP----   98 (251)
T ss_pred             HHHHCCCCCCCCEEEEEEHHHHHHHHHHHC--CCEEEEEECCHHHHHHHHHHCC---------CHHHHHCHHHHCC----
T ss_conf             997366578993999831002789999974--9969999598999999987486---------3343536063099----


Q ss_pred             CCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEEC-CHHHHHHHHHHHHC
Q ss_conf             012357652057722654464465478854556520566898999999998624698378702-88889999998521
Q gi|255764482|r   83 LAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIA-RPQSLIQIVNACAR  159 (225)
Q Consensus        83 ~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~-~~~~l~~~l~~~~~  159 (225)
                         ..+++||+|++|--+++.                  .+...++..+.+.|||||.++|.. -++.+.|+-.++..
T Consensus        99 ---~~~~sfDli~S~~~lqW~------------------~d~~~~l~e~~rvLkPgG~l~fst~g~~tl~ELr~a~~~  155 (251)
T PRK10258         99 ---LATATFDLAWSNLAVQWC------------------GNLSTALRELYRVVRPGGVVAFTTLVQGSLPELHQAWQA  155 (251)
T ss_pred             ---CCCCCCCEEEECCCHHHC------------------CCHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHH
T ss_conf             ---987882178550404525------------------999999999996458994999981575768999999998


No 25 
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional
Probab=99.72  E-value=1.2e-16  Score=113.25  Aligned_cols=109  Identities=12%  Similarity=0.160  Sum_probs=85.2

Q ss_pred             HCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCC
Q ss_conf             38998557899958784389999998679988999988989999889999980664522253020044423531000012
Q gi|255764482|r    6 LVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAG   85 (225)
Q Consensus         6 ~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~   85 (225)
                      -+..+++.+|||+|||.|..+..||+++ +++|+|+|+++.|++.|++....      ..++++..+|.....       
T Consensus        47 ~l~L~~~~kVLDvGCG~GG~a~~LA~~y-g~~V~GiDls~~~~~~A~er~~~------~~~v~f~~~d~~~~~-------  112 (263)
T PTZ00098         47 DIELDANSKVLDIGSGLGGGCKYINEKY-GAHTHGIDICEKIVNIAKERNQD------KAKIEFEAKDILKKD-------  112 (263)
T ss_pred             CCCCCCCCEEEEECCCCCHHHHHHHHHC-CCEEEEEECCHHHHHHHHHHCCC------CCCEEEEECCCCCCC-------
T ss_conf             0488999868886888788999999974-98799985889999999985512------585489967853677-------


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             35765205772265446446547885455652056689899999999862469837870
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLI  144 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i  144 (225)
                      .++++||+|.+---+.+                .....-..+++.+.|+|||||++.+.
T Consensus       113 f~d~sFDvV~S~dailH----------------ip~~DK~~l~~e~~RvLKPGG~llit  155 (263)
T PTZ00098        113 FPENNFDLIYSRDAILH----------------LSLADKKKLFEKCYKWLKPNGILLIT  155 (263)
T ss_pred             CCCCCEEEEEEEHHHHC----------------CCHHHHHHHHHHHHHHCCCCCEEEEE
T ss_conf             88674558987502230----------------88243999999999984688789997


No 26 
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism]
Probab=99.71  E-value=2.1e-16  Score=111.80  Aligned_cols=112  Identities=17%  Similarity=0.266  Sum_probs=90.3

Q ss_pred             HHHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC
Q ss_conf             24389985578999587843899999986799889999889899998899999806645222530200444235310000
Q gi|255764482|r    4 ASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL   83 (225)
Q Consensus         4 a~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~   83 (225)
                      ......++|.+|||+|||||-+++.+++..+.++|+|+|+|+.|++.|++.....+..   . ++++++|.....     
T Consensus        44 i~~~~~~~g~~vLDva~GTGd~a~~~~k~~g~g~v~~~D~s~~ML~~a~~k~~~~~~~---~-i~fv~~dAe~LP-----  114 (238)
T COG2226          44 ISLLGIKPGDKVLDVACGTGDMALLLAKSVGTGEVVGLDISESMLEVAREKLKKKGVQ---N-VEFVVGDAENLP-----  114 (238)
T ss_pred             HHHHCCCCCCEEEEECCCCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHCCCCC---C-EEEEEECHHHCC-----
T ss_conf             9860789998799966873199999999658844999979999999999874324766---3-279970565498-----


Q ss_pred             CCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             1235765205772265446446547885455652056689899999999862469837870
Q gi|255764482|r   84 AGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLI  144 (225)
Q Consensus        84 ~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i  144 (225)
                        .++++||.+.+.--.                  ..-...+..++.+.|.|||||++.++
T Consensus       115 --f~D~sFD~vt~~fgl------------------rnv~d~~~aL~E~~RVlKpgG~~~vl  155 (238)
T COG2226         115 --FPDNSFDAVTISFGL------------------RNVTDIDKALKEMYRVLKPGGRLLVL  155 (238)
T ss_pred             --CCCCCCCEEEEEEHH------------------HCCCCHHHHHHHHHHHHCCCEEEEEE
T ss_conf             --888765889865123------------------52787899999998762687499998


No 27 
>PRK05134 3-demethylubiquinone-9 3-methyltransferase; Provisional
Probab=99.70  E-value=1.5e-16  Score=112.67  Aligned_cols=110  Identities=14%  Similarity=0.105  Sum_probs=85.9

Q ss_pred             HCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCC
Q ss_conf             38998557899958784389999998679988999988989999889999980664522253020044423531000012
Q gi|255764482|r    6 LVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAG   85 (225)
Q Consensus         6 ~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~   85 (225)
                      .+.+-+|.+|||+|||.|.++..+|+.  +++|+|||.++++++.||...+..+.     .+++.++++.+...      
T Consensus        43 ~~~~l~G~~ILDVGCGgG~lse~LAr~--Ga~VtGID~S~~~I~~Ar~ha~~~~l-----~i~y~~~~~e~l~~------  109 (233)
T PRK05134         43 HAGGLFGKRVLDVGCGGGILSESMARL--GATVTGIDASEENIEVARLHALESGL-----KIDYRQITAEELAA------  109 (233)
T ss_pred             HCCCCCCCEEEEECCCCCHHHHHHHHC--CCEEEEECCCHHHHHHHHHHHHHCCC-----CCEEEECCHHHHHH------
T ss_conf             514668998999755897112899967--99799987998999999998564434-----51167514766543------


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECC
Q ss_conf             3576520577226544644654788545565205668989999999986246983787028
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIAR  146 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~  146 (225)
                      ..+++||.|++.--                  .++......+++.+.++|||||.+.+-..
T Consensus       110 ~~~~~FDvV~~~EV------------------lEHV~d~~~~l~~~~rlLKPGG~l~lsTi  152 (233)
T PRK05134        110 EHPGQFDVVTCMEM------------------LEHVPDPASFIRACAKLVKPGGLVFFSTL  152 (233)
T ss_pred             HCCCCEEEEEEEHH------------------HHHCCCHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             05786347744214------------------77538999999999997389914999726


No 28 
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase; InterPro: IPR010233   This entry represents an O-methyltransferase, which is believed to act at two points in the ubiquinone biosynthetic pathway in bacteria (UbiG) and mitochondria (COQ3) , . A separate methylase (MenG/UbiE) catalyses the single C-methylation step. The most commonly used names for genes in this family do not indicate whether this gene is an O-methyl, or C-methyl transferase.; GO: 0008425 2-polyprenyl-6-methoxy-14-benzoquinone methyltransferase activity, 0006744 ubiquinone biosynthetic process.
Probab=99.69  E-value=1.2e-16  Score=113.12  Aligned_cols=116  Identities=16%  Similarity=0.200  Sum_probs=92.3

Q ss_pred             CCCCCCEEEEECCCHHHHHHHHHHHCCCCE-EEEEECCHHHHHHHHHHHHHHCCCC-CCCCCEEECCCCCCCCCCCCCCC
Q ss_conf             998557899958784389999998679988-9999889899998899999806645-22253020044423531000012
Q gi|255764482|r    8 NATGSFHLADLGAGAGAAGLAVASRLHEAQ-ILLAERSPLMAHYARKTLALPANAQ-ISKRISLIEVDVTLVGENRNLAG   85 (225)
Q Consensus         8 ~~~~~~~VLDlGcG~G~~~l~la~r~~~~~-v~gvD~~~~~~~~A~~n~~~~~~~~-~~~~~~~~~~D~~~~~~~~~~~~   85 (225)
                      .-++|-+|||+|||-|.+|-.||+.  |+. |+|||.+++.++.|+.....++... ++.+++..+.++.......    
T Consensus        81 ~~~~G~~vLDVGCGGGlLsE~lAR~--Ga~~V~GID~~~~~i~~Ak~Ha~~~~~~~~~~K~i~Y~~~~~E~l~~~~----  154 (275)
T TIGR01983        81 LKDSGLRVLDVGCGGGLLSEPLARL--GANKVTGIDASEENIEVAKLHAKKDPLQEALDKKIEYRCTSVEELAEEQ----  154 (275)
T ss_pred             HCCCCCEEEEECCCHHHHHHHHHHC--CCCEEEEEECHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCC----
T ss_conf             1178977998427857888999755--8842577521177999999888733402331111454443078873055----


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEE--ECCH
Q ss_conf             3576520577226544644654788545565205668989999999986246983787--0288
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSL--IARP  147 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~--i~~~  147 (225)
                      +..++||.|+|.                  --.++-.....|++.|..+|||||.+.+  |.|.
T Consensus       155 h~~~~FD~V~~m------------------EvlEHV~dp~~f~~~c~~llkPgG~lF~STINRt  200 (275)
T TIGR01983       155 HTKKSFDVVTCM------------------EVLEHVPDPQAFIKACAQLLKPGGILFFSTINRT  200 (275)
T ss_pred             CCCCCCCEEEEE------------------EEEECCCCHHHHHHHHHHHCCCCCCEEEECCCHH
T ss_conf             784157337643------------------2000027888999999985089984897300021


No 29 
>pfam02353 CMAS Cyclopropane-fatty-acyl-phospholipid synthase. This family consist of Cyclopropane-fatty-acyl-phospholipid synthase or CFA synthase EC:2.1.1.79 this enzyme catalyse the reaction: S-adenosyl-L-methionine + phospholipid olefinic fatty acid <= S-adenosyl-L-homocysteine + phospholipid cyclopropane fatty acid.
Probab=99.69  E-value=3.6e-16  Score=110.43  Aligned_cols=111  Identities=14%  Similarity=0.276  Sum_probs=90.8

Q ss_pred             CHHHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCC
Q ss_conf             62438998557899958784389999998679988999988989999889999980664522253020044423531000
Q gi|255764482|r    3 LASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRN   82 (225)
Q Consensus         3 La~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~   82 (225)
                      ++..+.+++|++|||+|||.|.+++.+|+++ +++|+||.+|+.+.+.|++.++..+   ..+++++...|..+.     
T Consensus        54 i~~~l~l~~g~~vLDiGCGWG~~a~~~a~~~-g~~v~giTlS~~Q~~~~~~r~~~~g---l~~~v~v~~~Dyrd~-----  124 (273)
T pfam02353        54 ILDKLGLKPGMTLLDIGCGWGGLMRRAAERY-DVNVVGLTLSKNQYKLARQRVAAEG---LQRKVEVLLQDYRDF-----  124 (273)
T ss_pred             HHHHCCCCCCCEEEEECCCCHHHHHHHHHHC-CCEEEEEECCHHHHHHHHHHHHHCC---CCCCCCEEECCHHHC-----
T ss_conf             9986588999989997888089999999847-9518999797899999999998708---743212000626547-----


Q ss_pred             CCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEE
Q ss_conf             0123576520577226544644654788545565205668989999999986246983787
Q gi|255764482|r   83 LAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSL  143 (225)
Q Consensus        83 ~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~  143 (225)
                           .++||-|++---+                -+.....+..+++.+.++|||||++.+
T Consensus       125 -----~~~fD~IvSiem~----------------Ehvg~~~~~~~f~~i~~~LkpgG~~~i  164 (273)
T pfam02353       125 -----DEPFDRIVSVGMF----------------EHVGHENYDTFFKKLYNLLPPGGLMLL  164 (273)
T ss_pred             -----CCCCCEEEEEHHH----------------HHCCHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             -----6666667765168----------------762877799999999986588973999


No 30 
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy). There are at least five structurally distinct families of AdoMet-MTases, class I being the largest and most diverse. Within this class enzymes can be classified by different substrate specificities (small molecules, lipids, nucleic acids, etc.) and different target atoms for methylation (nitrogen, oxygen, carbon, sulfur, etc.).
Probab=99.68  E-value=4.2e-16  Score=110.07  Aligned_cols=103  Identities=25%  Similarity=0.432  Sum_probs=82.9

Q ss_pred             EEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCE
Q ss_conf             89995878438999999867998899998898999988999998066452225302004442353100001235765205
Q gi|255764482|r   14 HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFYDH   93 (225)
Q Consensus        14 ~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~fDl   93 (225)
                      ||||+|||+|..+..++++ ++.+++|+|+|+.|++.|+++.....    ..++++.++|+.....      ...++||+
T Consensus         1 rVLDiGcG~G~~~~~l~~~-~~~~v~~iD~s~~~~~~a~~~~~~~~----~~~~~~~~~d~~~~~~------~~~~~fD~   69 (107)
T cd02440           1 RVLDLGCGTGALALALASG-PGARVTGVDISPVALELARKAAAALL----ADNVEVLKGDAEELPP------EADESFDV   69 (107)
T ss_pred             CEEEEECCCCHHHHHHHHC-CCCEEEEEECCHHHHHHHHHHHHHCC----CCCEEEECCCHHHCCH------HHCCCEEE
T ss_conf             9999988879999999956-89889999898889999999875327----8864671488678863------20575319


Q ss_pred             EEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             772265446446547885455652056689899999999862469837870
Q gi|255764482|r   94 VIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLI  144 (225)
Q Consensus        94 ii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i  144 (225)
                      |+++++++..                 ......+++.+.++|||||++++.
T Consensus        70 V~~~~~~~~~-----------------~~~~~~~l~~~~~~LkpgG~~~is  103 (107)
T cd02440          70 IISDPPLHHL-----------------VEDLARFLEEARRLLKPGGVLVLT  103 (107)
T ss_pred             EEEECCEECC-----------------CCCHHHHHHHHHHHCCCCCEEEEE
T ss_conf             9991750106-----------------518999999999874858199999


No 31 
>pfam02475 Met_10 Met-10+ like-protein. The methionine-10 mutant allele of N. crassa codes for a protein of unknown function. However, homologous proteins have been found in yeast suggesting this protein may be involved in methionine biosynthesis, transport and/or utilisation.
Probab=99.67  E-value=5.9e-16  Score=109.24  Aligned_cols=102  Identities=23%  Similarity=0.292  Sum_probs=87.4

Q ss_pred             CCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCC
Q ss_conf             98557899958784389999998679988999988989999889999980664522253020044423531000012357
Q gi|255764482|r    9 ATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKN   88 (225)
Q Consensus         9 ~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~   88 (225)
                      .++|++|+|+.||.|.+++.+|+.....+|+++|+||.+++.+++|++.|+   .++++++.++|.....        +.
T Consensus        98 ~~~ge~VlD~faGvG~f~l~~ak~~~~~~V~a~DlNp~a~~~l~~N~~lN~---v~~~i~~~~gD~~~~~--------~~  166 (199)
T pfam02475        98 VKEGEVVVDMFAGIGPFSIPIAKHSKAKRVYAVELNPEAVKYLKENIKLNK---VEGVISPILGDVRDVI--------LE  166 (199)
T ss_pred             CCCCCEEEECCCCCCHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHHHC---CCCCEEEEECCHHHHC--------CC
T ss_conf             489988998168865778998640786489998289999999999999809---9983699928787860--------46


Q ss_pred             CCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEE
Q ss_conf             6520577226544644654788545565205668989999999986246983787
Q gi|255764482|r   89 NFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSL  143 (225)
Q Consensus        89 ~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~  143 (225)
                      +.||.|+.|||..                      ..+|+..|.++||+||.+.+
T Consensus       167 ~~~DrvimnlP~~----------------------a~~fL~~A~~~lk~gg~iHy  199 (199)
T pfam02475       167 GVADRVIMNLPKS----------------------AHEFLDKALRAVKDGGVIHY  199 (199)
T ss_pred             CCCCEEEECCCCC----------------------HHHHHHHHHHHHCCCCEEEC
T ss_conf             7400999489731----------------------69999999998558989839


No 32 
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed
Probab=99.65  E-value=2.3e-14  Score=100.29  Aligned_cols=147  Identities=16%  Similarity=0.077  Sum_probs=111.0

Q ss_pred             HHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC
Q ss_conf             43899855789995878438999999867998899998898999988999998066452225302004442353100001
Q gi|255764482|r    5 SLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA   84 (225)
Q Consensus         5 ~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~   84 (225)
                      +++...++++|||+.||+|.+++.+|.+  ..+|+|||+++.+++.|++|++.|+..|    +++..+|......     
T Consensus       227 ~~~~~~~~~~vlDlycG~G~~sl~lA~~--~~~V~gvE~~~~av~~A~~na~~ngi~n----v~f~~~d~~~~~~-----  295 (375)
T PRK03522        227 DWVRELPPKSMWDLFCGVGGFGLHCATP--DMQLTGIEISAEAIACAKQSAAELGLTN----VQFQALDSTQFAT-----  295 (375)
T ss_pred             HHHHCCCCCEEEEECCCCCHHHHHHHHC--CCEEEEEEECHHHHHHHHHHHHHCCCCC----EEEEECCHHHHHH-----
T ss_conf             9863158978999657853888987641--7889999845999999999999869987----6999737788876-----


Q ss_pred             CCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHCCCCCE
Q ss_conf             23576520577226544644654788545565205668989999999986246983787028888999999852178846
Q gi|255764482|r   85 GLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSL  164 (225)
Q Consensus        85 ~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~~l~~~l~~~~~~~~~~  164 (225)
                       ...+.+|.|+.+||-..                    ....+++...+ ++|.-.+|+-+.|.-+..=+..+ .++...
T Consensus       296 -~~~~~~d~vvvDPPR~G--------------------l~~~~~~~l~~-~~p~~IvYVSCnP~TlaRDl~~L-~gy~l~  352 (375)
T PRK03522        296 -AQGEVPELVLVNPPRRG--------------------IGKPLCDYLSQ-MAPRFILYSSCNAQTMAKDLAHL-PGYRIE  352 (375)
T ss_pred             -HCCCCCCEEEECCCCCC--------------------CHHHHHHHHHH-CCCCEEEEEECCHHHHHHHHHHH-CCCEEE
T ss_conf             -34568978998999777--------------------51999999986-59996999907989999998884-397688


Q ss_pred             EEEEECCCCCCCCEEEEEEEE
Q ss_conf             999814589698309999999
Q gi|255764482|r  165 EITPLHPREGECASRILVTGR  185 (225)
Q Consensus       165 ~i~~v~~~~~~~~~~vlv~~~  185 (225)
                      +++|+.-++..+-...++-+.
T Consensus       353 ~v~~~DmFPqT~HvE~v~lL~  373 (375)
T PRK03522        353 RVQLFDMFPHTAHYEVLTLLV  373 (375)
T ss_pred             EEEEECCCCCCCCEEEEEEEE
T ss_conf             999953698997189999999


No 33 
>PRK11036 putative metallothionein SmtA; Provisional
Probab=99.65  E-value=2.7e-15  Score=105.53  Aligned_cols=109  Identities=17%  Similarity=0.284  Sum_probs=88.9

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             55789995878438999999867998899998898999988999998066452225302004442353100001235765
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNF   90 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~   90 (225)
                      ..-||||+|||.|.++..+|++  +.+|+++|+|++|++.|++++...+   ...+++++++++......      ..+.
T Consensus        44 ~plrVLDvG~G~G~~a~~lA~~--Gh~Vt~~D~S~~mL~~A~~~a~~~g---v~~~~~~v~~~~q~l~~~------~~~~  112 (256)
T PRK11036         44 RPLRVLDAGGGEGQTAIKMAEL--GHQVTLCDLSAEMIQRAKQAAEAKG---VSDNMQFIHCAAQDIAQH------LETP  112 (256)
T ss_pred             CCCEEEEECCCCCHHHHHHHHC--CCEEEEECCCHHHHHHHHHHHHHCC---CCCEEEEEECCHHHHHHH------CCCC
T ss_conf             9983998379877989999977--9979986699999999999988649---661279885689988542------3688


Q ss_pred             CCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHH
Q ss_conf             2057722654464465478854556520566898999999998624698378702888
Q gi|255764482|r   91 YDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQ  148 (225)
Q Consensus        91 fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~  148 (225)
                      ||+|+|.-.-                  +........+..+.++|||||.+++++...
T Consensus       113 fDlVlcHaVL------------------E~v~dP~~~l~~l~~~lkPGG~lSLmfyN~  152 (256)
T PRK11036        113 VDLILFHAVL------------------EWVADPKSVLQTLWSVLRPGGALSLMFYNA  152 (256)
T ss_pred             CCEEEEEHHH------------------HHCCCHHHHHHHHHHHHCCCCEEEEEECCH
T ss_conf             6678651367------------------723789999999999758993799984285


No 34 
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities . Apart from the ubiquinone/menaquinone biosynthesis methyltransferases (for example, the C-methyltransferase from the ubiE gene of Escherichia coli), the ubiquinone biosynthesis methyltransferases (for example, the C-methyltransferase from the COQ5 gene of Saccharomyces cerevisiae) and the menaquinone biosynthesis methyltransferases (for example, the C-methyltransferase from the MENH gene of Bacillus subtilis), this family also includes methyltransferases involved in biotin and sterol biosynthesis and in phosphatidylethanolamine methylation.; GO: 0008168 methyltransferase activity.
Probab=99.64  E-value=1.5e-15  Score=106.95  Aligned_cols=112  Identities=19%  Similarity=0.302  Sum_probs=87.9

Q ss_pred             CCCCCEEEEECCCHHHHHHHHHHHCC---------CCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCC
Q ss_conf             98557899958784389999998679---------988999988989999889999980664522253020044423531
Q gi|255764482|r    9 ATGSFHLADLGAGAGAAGLAVASRLH---------EAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGE   79 (225)
Q Consensus         9 ~~~~~~VLDlGcG~G~~~l~la~r~~---------~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~   79 (225)
                      .+++.+|||++||||-+++.+++..+         ..+|+|+|+|+.|++.|++..+..+......++.++++|..+.+ 
T Consensus        41 ~k~~~~~LDvA~GTGD~a~~~~k~~~~~~~a~~~~~~~vtg~D~S~~ML~~a~kk~~~~~r~~~~~~~~f~~~dA~~LP-  119 (242)
T TIGR01934        41 GKKGQKVLDVACGTGDLAIELAKKAGKVGKAAETERAKVTGVDFSEEMLEVAKKKAPNEERKALSANVSFIEADAEALP-  119 (242)
T ss_pred             CCCCCCEEEEECCHHHHHHHHHHHCCCCCCCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHHHHCCCHHEECHHHCCC-
T ss_conf             8888977887238399999998635755533577633789870798899999874134200333216421100055087-


Q ss_pred             CCCCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             000012357652057722654464465478854556520566898999999998624698378702
Q gi|255764482|r   80 NRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIA  145 (225)
Q Consensus        80 ~~~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~  145 (225)
                            ..+++||.+-.---.                  ........-++.+.|.|||||++++.-
T Consensus       120 ------F~D~sFD~~TiaFGl------------------RN~~d~~~aL~E~~RVLKpgG~l~iLE  161 (242)
T TIGR01934       120 ------FEDNSFDAVTIAFGL------------------RNVTDIQKALREMYRVLKPGGRLVILE  161 (242)
T ss_pred             ------CCCCCEEEEEEECCC------------------CCCCCHHHHHHHHHHCCCCCCEEEEEC
T ss_conf             ------998624446640255------------------474686789877311018898799840


No 35 
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed
Probab=99.63  E-value=1.3e-14  Score=101.65  Aligned_cols=116  Identities=18%  Similarity=0.233  Sum_probs=85.1

Q ss_pred             CCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCC
Q ss_conf             98557899958784389999998679988999988989999889999980664522253020044423531000012357
Q gi|255764482|r    9 ATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKN   88 (225)
Q Consensus         9 ~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~   88 (225)
                      .++|.+|||+|||||.++++.++ ....+|+|+|+||.+++.|++|++.|+..   +++.+...+..          ...
T Consensus       160 ~~~~~~vLDvG~GSGILaIaA~k-lGa~~v~a~DiD~~Av~~a~eN~~lN~v~---~~~~~~~~~~~----------~~~  225 (298)
T PRK00517        160 VLPGKTVLDVGCGSGILAIAAAK-LGAKPVLAIDIDPQAVEAARENAELNGVD---DRLELYLPEDQ----------PLE  225 (298)
T ss_pred             CCCCCEEEEECCCCHHHHHHHHH-CCCCEEEEEECCHHHHHHHHHHHHHCCCC---CCEEEECCCCC----------CCC
T ss_conf             54688688715770699999997-49984999989899999999999986998---42689616643----------446


Q ss_pred             CCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEE-CCHHHHHHHHHHHHC
Q ss_conf             65205772265446446547885455652056689899999999862469837870-288889999998521
Q gi|255764482|r   89 NFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLI-ARPQSLIQIVNACAR  159 (225)
Q Consensus        89 ~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i-~~~~~l~~~l~~~~~  159 (225)
                      ++||+|++|-=                     ......+.....+.|+|||++.+- .-.++..++...+..
T Consensus       226 ~~~DlvvANIl---------------------a~vl~~l~~~~~~~l~~~G~lilSGIl~~~~~~v~~~~~~  276 (298)
T PRK00517        226 GKADVIVANIL---------------------ANPLIELAPDLAALVKPGGRLILSGILAEQADEVLEAYED  276 (298)
T ss_pred             CCCCEEEEECC---------------------HHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHH
T ss_conf             76468997315---------------------8999999999999738997999927848899999999998


No 36 
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane]
Probab=99.63  E-value=5.5e-15  Score=103.77  Aligned_cols=111  Identities=15%  Similarity=0.274  Sum_probs=91.1

Q ss_pred             CHHHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCC
Q ss_conf             62438998557899958784389999998679988999988989999889999980664522253020044423531000
Q gi|255764482|r    3 LASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRN   82 (225)
Q Consensus         3 La~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~   82 (225)
                      ++..+..++|.+|||+|||.|.+++.+|+++ +++|+|+++|+.+.+.+++.+...+.   +.++++.-.|.....    
T Consensus        64 ~~~kl~L~~G~~lLDiGCGWG~l~~~aA~~y-~v~V~GvTlS~~Q~~~~~~r~~~~gl---~~~v~v~l~d~rd~~----  135 (283)
T COG2230          64 ILEKLGLKPGMTLLDIGCGWGGLAIYAAEEY-GVTVVGVTLSEEQLAYAEKRIAARGL---EDNVEVRLQDYRDFE----  135 (283)
T ss_pred             HHHHCCCCCCCEEEEECCCHHHHHHHHHHHC-CCEEEEEECCHHHHHHHHHHHHHCCC---CCCCEEEECCCCCCC----
T ss_conf             9975699999989874788449999999984-99799966899999999999997599---766079965621032----


Q ss_pred             CCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEE
Q ss_conf             0123576520577226544644654788545565205668989999999986246983787
Q gi|255764482|r   83 LAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSL  143 (225)
Q Consensus        83 ~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~  143 (225)
                            +.||-|++---|-                +.....+.+|++.+.++|+|||.+.+
T Consensus       136 ------e~fDrIvSvgmfE----------------hvg~~~~~~ff~~~~~~L~~~G~~ll  174 (283)
T COG2230         136 ------EPFDRIVSVGMFE----------------HVGKENYDDFFKKVYALLKPGGRMLL  174 (283)
T ss_pred             ------CCCCEEEEHHHHH----------------HHCCCCHHHHHHHHHHHCCCCCEEEE
T ss_conf             ------4342055600688----------------73710289999999964599965999


No 37 
>pfam06325 PrmA Ribosomal protein L11 methyltransferase (PrmA). This family consists of several Ribosomal protein L11 methyltransferase (EC:2.1.1.-) sequences.
Probab=99.63  E-value=9e-15  Score=102.57  Aligned_cols=117  Identities=15%  Similarity=0.205  Sum_probs=84.5

Q ss_pred             CCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCC
Q ss_conf             98557899958784389999998679988999988989999889999980664522253020044423531000012357
Q gi|255764482|r    9 ATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKN   88 (225)
Q Consensus         9 ~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~   88 (225)
                      .++|.+|||+|||||.++++.++. ...+|+|+|+||.+++.|++|++.|+..   .++.+...           .....
T Consensus       158 ~~~~~~vlD~GcGSGILaIaA~kl-Ga~~v~a~DiDp~Av~~a~eN~~~N~v~---~~~~~~~~-----------~~~~~  222 (294)
T pfam06325       158 VKPGETVLDVGCGSGILAIAALKL-GAKKVVGVDIDPVAVRAAKENAELNGVE---AQLEVYLP-----------GDLPE  222 (294)
T ss_pred             CCCCCEEEEECCCHHHHHHHHHHC-CCCCEEEEECCHHHHHHHHHHHHHCCCC---CCEEEECC-----------CCCCC
T ss_conf             036986785056508999999975-9996899988899999999999976998---31799644-----------31556


Q ss_pred             CCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEE-CCHHHHHHHHHHHHCCC
Q ss_conf             65205772265446446547885455652056689899999999862469837870-28888999999852178
Q gi|255764482|r   89 NFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLI-ARPQSLIQIVNACARRI  161 (225)
Q Consensus        89 ~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i-~~~~~l~~~l~~~~~~~  161 (225)
                      ++||+|++|-=                     ...+..+.....+.|+|||++.+. .-.++..++..++..++
T Consensus       223 ~~~DlIvANIl---------------------a~~L~~l~~~~~~~l~~~G~lilSGil~~q~~~v~~a~~~g~  275 (294)
T pfam06325       223 GKADVVVANIL---------------------ADPLIELAPDIYALVKPGGYLILSGILEEQADDVAEAYSQGF  275 (294)
T ss_pred             CCCCEEEEHHC---------------------HHHHHHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHCCC
T ss_conf             64578984108---------------------999999999999973899899991782899999999998699


No 38 
>PRK13168 rumA 23S rRNA 5-methyluridine methyltransferase; Reviewed
Probab=99.63  E-value=4e-14  Score=98.89  Aligned_cols=151  Identities=13%  Similarity=0.119  Sum_probs=113.3

Q ss_pred             HHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC
Q ss_conf             43899855789995878438999999867998899998898999988999998066452225302004442353100001
Q gi|255764482|r    5 SLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA   84 (225)
Q Consensus         5 ~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~   84 (225)
                      .++.++++++|||+-||+|.+++.||++  ..+|+|||.++.+++.|++|+..|+..|    +++..+|+........  
T Consensus       288 ~~l~~~~~~~VlDLYcGvGtfsl~LA~~--~~~V~gvE~~~~av~~A~~Na~~n~i~n----~~f~~~d~~~~l~~~~--  359 (440)
T PRK13168        288 EWLDPQPGDRVLDLFCGLGNFTLPLARQ--AAEVVGVEGVPAMVERARENARRNGLDN----VTFYHANLFEDFTDQP--  359 (440)
T ss_pred             HHHCCCCCCEEEEEECCCCCCCHHHHHC--CCEEEEEECCHHHHHHHHHHHHHCCCCC----CEEEECCHHHHHHHHH--
T ss_conf             9852678988998623856211113530--6768876057999999999999749998----7899746456635578--


Q ss_pred             CCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHH-HCCCCC
Q ss_conf             2357652057722654464465478854556520566898999999998624698378702888899999985-217884
Q gi|255764482|r   85 GLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGS  163 (225)
Q Consensus        85 ~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~~l~~~l~~~-~~~~~~  163 (225)
                       .....||.|+.+||=                 .+    ..+.++...+ ++|.-.+|+-+.|.-++.=+..+ ..++..
T Consensus       360 -~~~~~~D~vi~DPPR-----------------~G----~~~~i~~l~~-~~p~~IvYVSCnPaTlARDl~~L~~~GY~l  416 (440)
T PRK13168        360 -WAKGGFDKVLLDPPR-----------------AG----AFEVMQALAK-LKPKRIVYVSCNPATLARDAGVLVEAGYRL  416 (440)
T ss_pred             -HHCCCCCEEEECCCC-----------------CC----HHHHHHHHHH-CCCCEEEEECCCHHHHHHHHHHHHHCCCEE
T ss_conf             -637999989999885-----------------27----8999999984-798979999389899999999998789489


Q ss_pred             EEEEEECCCCCCCCEEEEEEEEE
Q ss_conf             69998145896983099999997
Q gi|255764482|r  164 LEITPLHPREGECASRILVTGRK  186 (225)
Q Consensus       164 ~~i~~v~~~~~~~~~~vlv~~~k  186 (225)
                      .++++|.-++..+=...+.-+.|
T Consensus       417 ~~i~~vDmFP~T~HvE~vall~R  439 (440)
T PRK13168        417 KRAGVLDMFPHTGHVESMALFER  439 (440)
T ss_pred             EEEEEEECCCCCCEEEEEEEEEE
T ss_conf             59999606999983899999983


No 39 
>TIGR02072 BioC biotin biosynthesis protein BioC; InterPro: IPR011814    This enzyme, which is found in biotin biosynthetic gene clusters in proteobacteria, firmicutes, green-sulphur bacteria, fusobacterium and bacteroides, is believed to carry out an enzymatic step prior to the formation of pimeloyl-CoA (although attribution of this annotation is not traceable). The enzyme appears related to methyltransferases by homology.; GO: 0009102 biotin biosynthetic process.
Probab=99.60  E-value=1.9e-15  Score=106.32  Aligned_cols=122  Identities=17%  Similarity=0.267  Sum_probs=96.3

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHC-CCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             5578999587843899999986799889999889899998899999806-645222530200444235310000123576
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPA-NAQISKRISLIEVDVTLVGENRNLAGLKNN   89 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~-~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~   89 (225)
                      ...+|||+|||||.+|-.+.++++..++++.|+++.|+..|++....-. ..+ ...+.++++|+++...       .+.
T Consensus        36 ~~~~vLd~GcGTG~~t~~l~~~~~~~~~~a~D~~~~ml~~a~~~~~~GWW~~~-~~~~~f~~gD~E~l~~-------~~~  107 (272)
T TIGR02072        36 EPASVLDIGCGTGYLTRALLKRFPQAELIALDISEEMLAQAKEKLSEGWWQKN-LKAVQFICGDIEKLPL-------EDS  107 (272)
T ss_pred             CCCCEEEECCCCHHHHHHHHHHCCCCEEHHHHCCHHHHHHHHHHCCCCCCCCC-CHHHHHHHHHHHHCCC-------CCC
T ss_conf             55435651268548999999868800123333256789999974467886576-0456666637771788-------766


Q ss_pred             C--CCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEE-CCHHHHHHHHHHHH
Q ss_conf             5--205772265446446547885455652056689899999999862469837870-28888999999852
Q gi|255764482|r   90 F--YDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLI-ARPQSLIQIVNACA  158 (225)
Q Consensus        90 ~--fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i-~~~~~l~~~l~~~~  158 (225)
                      +  ||+|+||--.-+.                  ..+..++..+.+.|||||.++|- +-.+.|.|+-.+..
T Consensus       108 ~~~~DLI~Sn~a~QW~------------------~~~~~~l~~l~~~lk~gG~l~FStf~~~~l~El~~~~~  161 (272)
T TIGR02072       108 SFKFDLIVSNLALQWC------------------DDLSQALSELARVLKPGGLLAFSTFGPGTLKELRQSFG  161 (272)
T ss_pred             CCEEEHHHHHHHHHHC------------------CCHHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHH
T ss_conf             3034127563588710------------------47889999999752879689986135413499999999


No 40 
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional
Probab=99.60  E-value=1.3e-13  Score=95.99  Aligned_cols=133  Identities=17%  Similarity=0.164  Sum_probs=96.5

Q ss_pred             HHCCCCCCCEEEEECCCHHHHHHHHHHHC-CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC
Q ss_conf             43899855789995878438999999867-99889999889899998899999806645222530200444235310000
Q gi|255764482|r    5 SLVNATGSFHLADLGAGAGAAGLAVASRL-HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL   83 (225)
Q Consensus         5 ~~~~~~~~~~VLDlGcG~G~~~l~la~r~-~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~   83 (225)
                      +...++++++++|+|||+|.+++.+|... ++.+|++||.++++++.+++|++..+.   .++++++++|.......   
T Consensus        34 ~~L~l~~~~~vwDIGaGsGsvsiEaa~~~~~~~~V~aIE~~~e~~~~~~~N~~kfg~---~~nv~~i~G~ap~~l~~---  107 (198)
T PRK00377         34 SKLRLFKGGKLVDVGCGTGSVSVEAALIVGEGGKVYAIDKDELAVELTKKNAEKFGV---GDNVVLIEGEAPEVLPK---  107 (198)
T ss_pred             HHHCCCCCCEEEEECCCEEHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHHCCC---CCCEEEEECCHHHHHHC---
T ss_conf             970999989999917703299999999669787599996788899999999998099---98859995254887720---


Q ss_pred             CCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEE-ECCHHHHHHHHHHHHCCCC
Q ss_conf             123576520577226544644654788545565205668989999999986246983787-0288889999998521788
Q gi|255764482|r   84 AGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSL-IARPQSLIQIVNACARRIG  162 (225)
Q Consensus        84 ~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~-i~~~~~l~~~l~~~~~~~~  162 (225)
                         .+..+|.|+-      +               .......++++.+.+.|+|||++.+ ...-+.+.+.+..+.....
T Consensus       108 ---l~p~pD~vFI------G---------------G~~g~l~~il~~~~~~L~~gGriVinaVtlet~~~~~~~l~~~~~  163 (198)
T PRK00377        108 ---LNPKSDRYFI------G---------------GGGEELPEIIQAALEKIGKGGRIVADAILLESLNKALSALEELGY  163 (198)
T ss_pred             ---CCCCCCEEEE------E---------------CCCCCHHHHHHHHHHHCCCCCEEEEEEECHHHHHHHHHHHHHCCC
T ss_conf             ---8998898999------7---------------887778999999998579998999983629889999999997699


Q ss_pred             CEEEE
Q ss_conf             46999
Q gi|255764482|r  163 SLEIT  167 (225)
Q Consensus       163 ~~~i~  167 (225)
                      ..++.
T Consensus       164 ~~ev~  168 (198)
T PRK00377        164 KYEVT  168 (198)
T ss_pred             CCEEE
T ss_conf             81499


No 41 
>PRK07402 precorrin-6B methylase; Provisional
Probab=99.60  E-value=2.2e-13  Score=94.73  Aligned_cols=123  Identities=16%  Similarity=0.181  Sum_probs=91.2

Q ss_pred             HHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC
Q ss_conf             43899855789995878438999999867998899998898999988999998066452225302004442353100001
Q gi|255764482|r    5 SLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA   84 (225)
Q Consensus         5 ~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~   84 (225)
                      +...+++++.++|+|||||.+++-+|...|+.+|++||.++++++.+++|.+..+..|    +++++++........   
T Consensus        34 ~kL~l~~~~~vwDIGaGtGsVsiEaa~~~~~g~V~AIE~~~~a~~li~~N~~rfgv~n----v~ii~g~ape~L~~l---  106 (196)
T PRK07402         34 SQLRLEPDSVLWDIGAGTGTIPVEAALLCPKGRVIAIERDEEVANLIRRNCDRFGVKN----VEVIEGSAPECLAQL---  106 (196)
T ss_pred             HHHCCCCCCEEEEECCCCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCC----EEEEECCCHHHHHHC---
T ss_conf             9708999999999478877999999987899889999768889999999899729998----799972636668408---


Q ss_pred             CCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEE-CCHHHHHHHHHHHHC
Q ss_conf             235765205772265446446547885455652056689899999999862469837870-288889999998521
Q gi|255764482|r   85 GLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLI-ARPQSLIQIVNACAR  159 (225)
Q Consensus        85 ~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i-~~~~~l~~~l~~~~~  159 (225)
                         ...+|.|+-                      .......++++.+...|+|||++.+- ..-+.+.++.+.+..
T Consensus       107 ---~p~pD~vFI----------------------GGg~~l~~il~~~~~~L~pgGriVinaitLetl~~~~~~l~~  157 (196)
T PRK07402        107 ---APAPDRICI----------------------EGGRPIKEILQAVWQYLKPGGRLVATASSLEGLYAISEGLAQ  157 (196)
T ss_pred             ---CCCCCEEEE----------------------CCCCCHHHHHHHHHHHCCCCCEEEEEEEEHHHHHHHHHHHHH
T ss_conf             ---999999998----------------------489688999999998679998999985709889999999997


No 42 
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis]
Probab=99.60  E-value=1.1e-14  Score=102.19  Aligned_cols=122  Identities=16%  Similarity=0.200  Sum_probs=83.6

Q ss_pred             CCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCC
Q ss_conf             98557899958784389999998679988999988989999889999980664522253020044423531000012357
Q gi|255764482|r    9 ATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKN   88 (225)
Q Consensus         9 ~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~   88 (225)
                      .++|.+|||+|||||.++++.++ ....+++|+|+||.++..|++|++.|+...   .......+        .......
T Consensus       160 ~~~g~~vlDvGcGSGILaIAa~k-LGA~~v~g~DiDp~AV~aa~eNa~~N~v~~---~~~~~~~~--------~~~~~~~  227 (300)
T COG2264         160 LKKGKTVLDVGCGSGILAIAAAK-LGAKKVVGVDIDPQAVEAARENARLNGVEL---LVQAKGFL--------LLEVPEN  227 (300)
T ss_pred             HCCCCEEEEECCCHHHHHHHHHH-CCCCEEEEECCCHHHHHHHHHHHHHCCCCH---HHHCCCCC--------CHHHCCC
T ss_conf             05898799826781599999998-198668997188899999999999769960---22003456--------3000136


Q ss_pred             CCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEEC-CHHHHHHHHHHHHC-CCCC
Q ss_conf             652057722654464465478854556520566898999999998624698378702-88889999998521-7884
Q gi|255764482|r   89 NFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIA-RPQSLIQIVNACAR-RIGS  163 (225)
Q Consensus        89 ~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~-~~~~l~~~l~~~~~-~~~~  163 (225)
                      +.||+|++|-                     .......+.....+++||||++.+.- -.++...+.++... ++..
T Consensus       228 ~~~DvIVANI---------------------LA~vl~~La~~~~~~lkpgg~lIlSGIl~~q~~~V~~a~~~~gf~v  283 (300)
T COG2264         228 GPFDVIVANI---------------------LAEVLVELAPDIKRLLKPGGRLILSGILEDQAESVAEAYEQAGFEV  283 (300)
T ss_pred             CCCCEEEEHH---------------------HHHHHHHHHHHHHHHCCCCCEEEEEEECHHHHHHHHHHHHHCCCEE
T ss_conf             8656898605---------------------2789999999999870889369998620758999999998589768


No 43 
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only]
Probab=99.59  E-value=1.3e-14  Score=101.59  Aligned_cols=128  Identities=16%  Similarity=0.192  Sum_probs=97.8

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHCCCC-EEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             55789995878438999999867998-89999889899998899999806645222530200444235310000123576
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRLHEA-QILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNN   89 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~~~~-~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~   89 (225)
                      +|.+|||+.|=||++|+.+|..  ++ +|++||+|..+++.|++|+++|+..  ..+..++++|+..+.....   ....
T Consensus       217 ~GkrvLNlFsYTGgfsv~Aa~g--GA~~vt~VD~S~~al~~a~~N~~LNg~~--~~~~~~i~~Dvf~~l~~~~---~~g~  289 (393)
T COG1092         217 AGKRVLNLFSYTGGFSVHAALG--GASEVTSVDLSKRALEWARENAELNGLD--GDRHRFIVGDVFKWLRKAE---RRGE  289 (393)
T ss_pred             CCCEEEEECCCCCHHHHHHHHC--CCCCEEEEECCHHHHHHHHHHHHHCCCC--CCCEEEEHHHHHHHHHHHH---HCCC
T ss_conf             6876788646676999999866--9971489826578999999999862997--1010567223999999998---5599


Q ss_pred             CCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEEC-----CHHHHHHHH
Q ss_conf             52057722654464465478854556520566898999999998624698378702-----888899999
Q gi|255764482|r   90 FYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIA-----RPQSLIQIV  154 (225)
Q Consensus        90 ~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~-----~~~~l~~~l  154 (225)
                      +||+|+.+||=|..+.....+         ....+.+++..+.++|+|||.+.+..     ..+.+.+++
T Consensus       290 ~fDlIilDPPsF~r~k~~~~~---------~~rdy~~l~~~~~~lL~pgG~l~~~s~~~~~~~~~f~~~i  350 (393)
T COG1092         290 KFDLIILDPPSFARSKKQEFS---------AQRDYKDLNDLALRLLAPGGTLVTSSCSRHFSSDLFLEII  350 (393)
T ss_pred             CCCEEEECCCCCCCCCCCCHH---------HHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHH
T ss_conf             556899788100358210053---------8989999999999970799689999367766989999999


No 44 
>COG0286 HsdM Type I restriction-modification system methyltransferase subunit [Defense mechanisms]
Probab=99.59  E-value=1.2e-14  Score=101.81  Aligned_cols=142  Identities=16%  Similarity=0.161  Sum_probs=97.7

Q ss_pred             CCHHHCCCCCCCEEEEECCCHHHHHHHHHHHCC----CCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCC
Q ss_conf             662438998557899958784389999998679----9889999889899998899999806645222530200444235
Q gi|255764482|r    2 ILASLVNATGSFHLADLGAGAGAAGLAVASRLH----EAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLV   77 (225)
Q Consensus         2 lLa~~~~~~~~~~VLDlGcG~G~~~l~la~r~~----~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~   77 (225)
                      ||+..+.+++..+|.|++||+|.+.+..+....    ...++|.|+++.++++|+.|+-.++...   .+....+|....
T Consensus       177 liv~~l~~~~~~~i~DpacGsgg~l~~a~~~~~~~~~~~~~yGqE~~~~t~~l~~mN~~lhgi~~---~~~i~~~dtl~~  253 (489)
T COG0286         177 LIVELLDPEPRNSIYDPACGSGGMLLQAAKYLKRHQDEIFIYGQEINDTTYRLAKMNLILHGIEG---DANIRHGDTLSN  253 (489)
T ss_pred             HHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEEECCHHHHHHHHHHHHHHCCCC---CCCCCCCCCCCC
T ss_conf             99997577656523473354037999999999751555049989566889999996116627874---223433442368


Q ss_pred             CCCCCCCCCCCCCCCEEEECCCCCCCCCCCC--C-CHHH---HHHHCCCCCCH-HHHHHHHHHHCCCCCEEEEECCHH
Q ss_conf             3100001235765205772265446446547--8-8545---56520566898-999999998624698378702888
Q gi|255764482|r   78 GENRNLAGLKNNFYDHVIMNPPFNERIGTMT--P-DKIK---EEAHVMLEDSF-EKWIRTACAIMRSSGQLSLIARPQ  148 (225)
Q Consensus        78 ~~~~~~~~~~~~~fDlii~nPPy~~~~~~~~--~-~~~~---~~a~~~~~~~~-~~~~~~a~~lLkpgG~~~~i~~~~  148 (225)
                      .....  ....+.||.|++||||+..+....  . ....   ........... ..|+.++...|+|+|+.++|.|..
T Consensus       254 ~~~~~--~~~~~~~D~viaNPPf~~~~w~~~~~~~~~~~~~~~~g~~~~~~~~d~afi~h~~~~l~~~g~aaivl~~g  329 (489)
T COG0286         254 PKHDD--KDDKGKFDFVIANPPFSGKGWGGDLLESEQDERFFFYGVFPTKNSADLAFLQHILYKLKPGGRAAIVLPDG  329 (489)
T ss_pred             CCCCC--CCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCEEEEECCC
T ss_conf             73323--46655501686579955444344331002432000257788895278999999999718677058992588


No 45 
>pfam09445 Methyltransf_15 RNA cap guanine-N2 methyltransferase. RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe Tgs1 and Giardia lamblia Tgs2 catalyse methylation of the exocyclic N2 amine of 7-methylguanosine.
Probab=99.58  E-value=2e-13  Score=94.96  Aligned_cols=114  Identities=16%  Similarity=0.168  Sum_probs=84.2

Q ss_pred             CEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             78999587843899999986799889999889899998899999806645222530200444235310000123576520
Q gi|255764482|r   13 FHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFYD   92 (225)
Q Consensus        13 ~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~fD   92 (225)
                      ..|||++||+|+.++.+|.++  .+|+|||+|+.++++|++|++..+   .+++++++++|+........   ....+||
T Consensus         2 ~ivlD~fcG~Ggn~I~fA~~~--~~Vi~vDi~~~~l~~A~~NA~iyG---V~drI~fi~gD~f~~~~~l~---~~~~~~D   73 (165)
T pfam09445         2 RIILDVFCGAGGNTIQFANVF--CSVIGIDINPEHLACAQHNAEVYG---VSDRIWFILGDWFELLAKLK---FGKIPYD   73 (165)
T ss_pred             CEEEECCCCCCHHHHHHHHHC--CEEEEEECCHHHHHHHHHHHHHCC---CCCEEEEEECCHHHHHHHHH---HCCCCCC
T ss_conf             799993778079999999758--989999798999999999899839---87317999775999978876---3588755


Q ss_pred             EEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCC
Q ss_conf             57722654464465478854556520566898999999998624
Q gi|255764482|r   93 HVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMR  136 (225)
Q Consensus        93 lii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLk  136 (225)
                      +|+.+|||+.........  .............++++.+.++-+
T Consensus        74 vVf~sPPWGGp~Y~~~~~--fdl~~~~~p~~~~~l~~~~~~it~  115 (165)
T pfam09445        74 CVFLSPPWGGPSYKRQNV--YDLEKKLKPYGLYQLLKESTEISK  115 (165)
T ss_pred             EEEECCCCCCCCCCCCCC--CCHHHCCCCCCHHHHHHHHHHHCC
T ss_conf             899779999988565676--687772687799999999986362


No 46 
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA; InterPro: IPR001566   This protein family was first proposed to be RNA methyltransferases by homology to the TrmA family. The member from Escherichia coli has now been shown to act as the 23S RNA methyltransferase for the conserved U1939. The gene is now designated rumA and was previously designated ygcA .; GO: 0003723 RNA binding, 0008173 RNA methyltransferase activity, 0006396 RNA processing.
Probab=99.58  E-value=4.5e-14  Score=98.60  Aligned_cols=140  Identities=15%  Similarity=0.198  Sum_probs=111.5

Q ss_pred             HHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC
Q ss_conf             43899855789995878438999999867998899998898999988999998066452225302004442353100001
Q gi|255764482|r    5 SLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA   84 (225)
Q Consensus         5 ~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~   84 (225)
                      .+++.+..++|+|+-||.|.+||.||.+  ..+++|||.-+++++.|++|++.|+..|    ++|..++++.......+ 
T Consensus       288 ~~l~Lqg~e~V~DayCG~GtftLpLA~q--ak~v~G~E~v~e~v~~a~~NAe~Ng~~N----~~F~~g~~E~~~p~~~~-  360 (434)
T TIGR00479       288 EALELQGEEKVVDAYCGVGTFTLPLAKQ--AKSVVGVEVVPESVEDAKRNAELNGIAN----VEFLAGTLETVLPKQPW-  360 (434)
T ss_pred             HHHHCCCCCEEEEEECCCCCCHHHHHHC--CCEEEEEECCHHHHHHHHHHHHHCCCCC----HHHHHHHHHHHCCCCCC-
T ss_conf             9971598655786315755200444401--2188887143767899988888603532----01333123211014422-


Q ss_pred             CCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHH-HCC-CC
Q ss_conf             2357652057722654464465478854556520566898999999998624698378702888899999985-217-88
Q gi|255764482|r   85 GLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNAC-ARR-IG  162 (225)
Q Consensus        85 ~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~~l~~~l~~~-~~~-~~  162 (225)
                        ....||.++..||=                    ......+++...+ +||.=.+|+-+.|.-|+.=+..+ ..+ +.
T Consensus       361 --e~~~~D~~llDPPR--------------------~GCa~~~L~~I~~-~kP~rivYVSCNP~TLARDl~~L~~~GfY~  417 (434)
T TIGR00479       361 --EGISPDVVLLDPPR--------------------KGCAAEVLRTIIK-LKPKRIVYVSCNPATLARDLEVLCKEGFYK  417 (434)
T ss_pred             --CCCCCCEEEECCCC--------------------CCCHHHHHHHHHH-CCCEEEEEEECCCHHHHHHHHHHHHCCCEE
T ss_conf             --26778988888889--------------------8745899998862-077059998448534799999997379626


Q ss_pred             CEEEEEECCCCC
Q ss_conf             469998145896
Q gi|255764482|r  163 SLEITPLHPREG  174 (225)
Q Consensus       163 ~~~i~~v~~~~~  174 (225)
                      ..++++|--++.
T Consensus       418 i~~~q~~DmFPh  429 (434)
T TIGR00479       418 IEKVQPVDMFPH  429 (434)
T ss_pred             EEEEEEEECCCC
T ss_conf             788854305788


No 47 
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis]
Probab=99.57  E-value=1.3e-13  Score=96.09  Aligned_cols=140  Identities=17%  Similarity=0.194  Sum_probs=106.2

Q ss_pred             HHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC
Q ss_conf             43899855789995878438999999867998899998898999988999998066452225302004442353100001
Q gi|255764482|r    5 SLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA   84 (225)
Q Consensus         5 ~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~   84 (225)
                      .+++..++++|+|+-||.|.+++.+|++  ..+|+|+|+++.+++.|++|++.|+..|    +++..+|........+  
T Consensus       287 ~~~~~~~~~~vlDlYCGvG~f~l~lA~~--~~~V~gvEi~~~aV~~A~~NA~~n~i~N----~~f~~~~ae~~~~~~~--  358 (432)
T COG2265         287 EWLELAGGERVLDLYCGVGTFGLPLAKR--VKKVHGVEISPEAVEAAQENAAANGIDN----VEFIAGDAEEFTPAWW--  358 (432)
T ss_pred             HHHHCCCCCEEEECCCCCCHHHHHHCCC--CCEEEEEECCHHHHHHHHHHHHHCCCCC----EEEEECCHHHHHHHHC--
T ss_conf             9974369977999355887013553124--6579999648999999999999739887----7999586888865100--


Q ss_pred             CCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHH-CCCCC
Q ss_conf             23576520577226544644654788545565205668989999999986246983787028888999999852-17884
Q gi|255764482|r   85 GLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACA-RRIGS  163 (225)
Q Consensus        85 ~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~~l~~~l~~~~-~~~~~  163 (225)
                        ....+|.|+.+||=-                    ....++++...+ ++|...+|+-+.|.-+..-+..+. .++..
T Consensus       359 --~~~~~d~VvvDPPR~--------------------G~~~~~lk~l~~-~~p~~IvYVSCNP~TlaRDl~~L~~~gy~i  415 (432)
T COG2265         359 --EGYKPDVVVVDPPRA--------------------GADREVLKQLAK-LKPKRIVYVSCNPATLARDLAILASTGYEI  415 (432)
T ss_pred             --CCCCCCEEEECCCCC--------------------CCCHHHHHHHHH-CCCCCEEEEECCHHHHHHHHHHHHHCCEEE
T ss_conf             --257999899899999--------------------999899999985-589868999768788898999998579048


Q ss_pred             EEEEEECCCCCC
Q ss_conf             699981458969
Q gi|255764482|r  164 LEITPLHPREGE  175 (225)
Q Consensus       164 ~~i~~v~~~~~~  175 (225)
                      .+++++.-++..
T Consensus       416 ~~v~~~DmFP~T  427 (432)
T COG2265         416 ERVQPFDMFPHT  427 (432)
T ss_pred             EEEEEEECCCCC
T ss_conf             787667117996


No 48 
>PRK10901 16S rRNA methyltransferase B; Provisional
Probab=99.55  E-value=2.2e-13  Score=94.73  Aligned_cols=133  Identities=15%  Similarity=0.115  Sum_probs=97.6

Q ss_pred             CCHHHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCC
Q ss_conf             66243899855789995878438999999867998899998898999988999998066452225302004442353100
Q gi|255764482|r    2 ILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENR   81 (225)
Q Consensus         2 lLa~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~   81 (225)
                      +.+.++.+++|++|||+|||.|+-+..+++..++++|+++|+++.-++..++|++..+.+     ..+..+|.....   
T Consensus       236 l~~~ll~p~~g~~VLD~CAaPGGKt~~la~~~~~~~v~A~D~~~~Rl~~l~~n~~Rlg~~-----~~v~~~d~~~~~---  307 (428)
T PRK10901        236 GCVTLLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVLAVDIDEQRLSRVYDNLKRLGMK-----ATVKQGDGRYPS---  307 (428)
T ss_pred             HHHHHCCCCCCCEEEEECCCCCHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHCCCC-----EEEEECCCCCHH---
T ss_conf             899864988898798716887668999999645892899969888999999999975997-----399977655723---


Q ss_pred             CCCCCCCCCCCEEEECCCCCCCCCCC-CCCHHHHHH---HCCCCCCHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             00123576520577226544644654-788545565---2056689899999999862469837870
Q gi|255764482|r   82 NLAGLKNNFYDHVIMNPPFNERIGTM-TPDKIKEEA---HVMLEDSFEKWIRTACAIMRSSGQLSLI  144 (225)
Q Consensus        82 ~~~~~~~~~fDlii~nPPy~~~~~~~-~~~~~~~~a---~~~~~~~~~~~~~~a~~lLkpgG~~~~i  144 (225)
                        .+....+||.|+...|+...+... .|+-.....   -........++++.+.++|||||++.+.
T Consensus       308 --~~~~~~~fD~ILlDaPCSg~G~lrR~Pdikw~~~~~di~~l~~lQ~~iL~~a~~~lk~gG~LvYs  372 (428)
T PRK10901        308 --QWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQLQSEILDAIWPHLKSGGTLVYA  372 (428)
T ss_pred             --HHCCCCCCCEEEECCCCCCCEEECCCCCHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEE
T ss_conf             --31344567879975898887244468542112899999999999999999999866889889999


No 49 
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated
Probab=99.55  E-value=9.4e-13  Score=91.18  Aligned_cols=129  Identities=19%  Similarity=0.218  Sum_probs=92.4

Q ss_pred             HHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC
Q ss_conf             43899855789995878438999999867998899998898999988999998066452225302004442353100001
Q gi|255764482|r    5 SLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA   84 (225)
Q Consensus         5 ~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~   84 (225)
                      +...+++++.|.|+|||+|.+++-+|...|+.+|++||.++++++.+++|++..+..+    +++++++.....      
T Consensus        24 skL~l~~~~vvwDIGaGsGsvsiEaa~~~p~~~V~AvE~~~~~~~~i~~N~~~fg~~n----v~~i~g~Ap~~l------   93 (186)
T PRK08287         24 SKLELHRAKHLIDVGAGTGSVSIEAALQFPSLQVTAIERNPAALRLIKENRQRFGCGN----IDIIPGEAPITL------   93 (186)
T ss_pred             HHCCCCCCCEEEEECCCCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCC----EEEEECCCCHHC------
T ss_conf             9719999999999578877899999997899889999379899999999899729998----799937781103------


Q ss_pred             CCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEE-CCHHHHHHHHHHHHC-CCC
Q ss_conf             235765205772265446446547885455652056689899999999862469837870-288889999998521-788
Q gi|255764482|r   85 GLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLI-ARPQSLIQIVNACAR-RIG  162 (225)
Q Consensus        85 ~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i-~~~~~l~~~l~~~~~-~~~  162 (225)
                         .+.+|-|+-      +               .......++++.+...|+|||++.+- ..-+.+.+.+..+.. ++.
T Consensus        94 ---~~~pD~vFI------G---------------Gsgg~l~~il~~~~~~L~~gGriVinavtlet~~~a~~~~~~~~~~  149 (186)
T PRK08287         94 ---TGKADAIFM------G---------------GSGGHLTAIIDWALGHLHPGGRLVLNFILQENLHSALAHLEKIGAC  149 (186)
T ss_pred             ---CCCCCEEEE------E---------------CCCCCHHHHHHHHHHHCCCCCEEEEEEEEHHHHHHHHHHHHHCCCC
T ss_conf             ---578984999------7---------------4789889999999975799989999826087799999999976997


Q ss_pred             CEEEE
Q ss_conf             46999
Q gi|255764482|r  163 SLEIT  167 (225)
Q Consensus       163 ~~~i~  167 (225)
                      ...+.
T Consensus       150 ~~e~~  154 (186)
T PRK08287        150 ELDCV  154 (186)
T ss_pred             CEEEE
T ss_conf             61599


No 50 
>pfam05958 tRNA_U5-meth_tr tRNA (Uracil-5-)-methyltransferase. This family consists of (Uracil-5-)-methyltransferases EC:2.1.1.35 from bacteria, archaea and eukaryotes. A 5-methyluridine (m(5)U) residue at position 54 is a conserved feature of bacterial and eukaryotic tRNAs. The methylation of U54 is catalysed by the tRNA(m5U54)methyltransferase, which in Saccharomyces cerevisiae is encoded by the nonessential TRM2 gene. It is thought that tRNA modification enzymes might have a role in tRNA maturation not necessarily linked to their known catalytic activity.
Probab=99.55  E-value=5.4e-13  Score=92.53  Aligned_cols=145  Identities=14%  Similarity=0.121  Sum_probs=100.2

Q ss_pred             HCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCC---
Q ss_conf             38998557899958784389999998679988999988989999889999980664522253020044423531000---
Q gi|255764482|r    6 LVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRN---   82 (225)
Q Consensus         6 ~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~---   82 (225)
                      +++.++++ |+|+-||+|.+|+.+|.+  ..+|+|||+++.+++.|+.|++.|+..|    ++++.+|..+......   
T Consensus       193 ~~~~~~~~-vlDlYcG~Gtfsl~lA~~--~~~V~GvE~~~~AV~~A~~Na~~N~i~N----v~f~~~~~~~~~~~~~~~~  265 (353)
T pfam05958       193 VTQGSKGD-LLELYCGNGNFSLALAQN--FRRVLATEIAKPSVNAAQYNIAANNIDN----VQIIRMSAEEFTQAMNGVR  265 (353)
T ss_pred             HHHCCCCC-EEEEECCCCHHHHHHHHH--CCEEEEEECCHHHHHHHHHHHHHCCCCC----EEEEECCHHHHHHHHHCCC
T ss_conf             86268995-899846888888999864--7879999625999999999899869986----4999728999999875242


Q ss_pred             ----C--CCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHH
Q ss_conf             ----0--1235765205772265446446547885455652056689899999999862469837870288889999998
Q gi|255764482|r   83 ----L--AGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNA  156 (225)
Q Consensus        83 ----~--~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~~l~~~l~~  156 (225)
                          .  .......||.|+.+||--                    .....+++..   .++.-.+|+-+.|.-+..-+..
T Consensus       266 ~~~~~~~i~~~~~~~d~vvlDPPR~--------------------G~~~~~~~~i---~~~~rIvYVSCnP~TlaRDl~~  322 (353)
T pfam05958       266 EFRRLKGIDLKSYNCSTIFVDPPRA--------------------GLDPDTCKLV---QAYERILYISCNPETLKANLEQ  322 (353)
T ss_pred             HHHHCCCCCCCCCCCCCEEECCCCC--------------------CCHHHHHHHH---HCCCCEEEEECCHHHHHHHHHH
T ss_conf             2332036663224677258489877--------------------7739999998---4699689994899999999999


Q ss_pred             HHCCCCCEEEEEECCCCCCCCEEE
Q ss_conf             521788469998145896983099
Q gi|255764482|r  157 CARRIGSLEITPLHPREGECASRI  180 (225)
Q Consensus       157 ~~~~~~~~~i~~v~~~~~~~~~~v  180 (225)
                      +...+...+++||--++...=.-.
T Consensus       323 L~~~Y~l~~v~pvDmFPqT~HvE~  346 (353)
T pfam05958       323 LSETHRVERFALFDQFPYTHHMEC  346 (353)
T ss_pred             HHCCCEEEEEEEECCCCCCCEEEE
T ss_conf             840647879998236999971898


No 51 
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated
Probab=99.55  E-value=5.7e-13  Score=92.40  Aligned_cols=145  Identities=17%  Similarity=0.175  Sum_probs=97.1

Q ss_pred             HCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCC---
Q ss_conf             38998557899958784389999998679988999988989999889999980664522253020044423531000---
Q gi|255764482|r    6 LVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRN---   82 (225)
Q Consensus         6 ~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~---   82 (225)
                      +++.+.+ .|||+.||+|.+++.+|.+  ..+|+|||+++.+++.|+.|+..|+..|    ++++.+|..+......   
T Consensus       203 ~~~~~~~-~vlDLYcG~Gtfsl~LA~~--~~~V~gVE~~~~aV~~A~~NA~~N~i~N----~~fi~~~a~~~~~~~~~~~  275 (363)
T PRK05031        203 ATKGSKG-DLLELYCGNGNFTLALARN--FRRVLATEISKPSVAAAQYNIAANGIDN----VQIIRMSAEEFTQAMNGVR  275 (363)
T ss_pred             HHHCCCC-CEEEEECCCCHHHHHHHHH--CCEEEEEECCHHHHHHHHHHHHHCCCCC----EEEEECCHHHHHHHHHCCC
T ss_conf             7613898-2898605866426998862--6879999538999999999999869986----4999658999999873431


Q ss_pred             ----C--CCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHH
Q ss_conf             ----0--1235765205772265446446547885455652056689899999999862469837870288889999998
Q gi|255764482|r   83 ----L--AGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNA  156 (225)
Q Consensus        83 ----~--~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~~l~~~l~~  156 (225)
                          +  .......||.|+.+||=-   +                 ...+.++...+   ..=.+|+-+.|..+..=+..
T Consensus       276 ~~~~l~~~~~~~~~~d~vvvDPPR~---G-----------------l~~~~~~~i~~---~~rIVYVSCnP~TlaRDl~~  332 (363)
T PRK05031        276 EFRRLKGIDLKSYNFSTIFVDPPRA---G-----------------LDEETLKLVQN---YERILYISCNPETLKENLET  332 (363)
T ss_pred             HHHCCCCCCCCCCCCCEEEECCCCC---C-----------------CCHHHHHHHHC---CCEEEEEECCHHHHHHHHHH
T ss_conf             0100124664435586489899988---8-----------------74999999836---89099992898999999999


Q ss_pred             HHCCCCCEEEEEECCCCCCCCEEE
Q ss_conf             521788469998145896983099
Q gi|255764482|r  157 CARRIGSLEITPLHPREGECASRI  180 (225)
Q Consensus       157 ~~~~~~~~~i~~v~~~~~~~~~~v  180 (225)
                      +...+...++++|.-++..+=.-.
T Consensus       333 L~~~y~l~~v~~vDmFPqT~HvE~  356 (363)
T PRK05031        333 LSQTHKVERFALFDQFPYTHHMEC  356 (363)
T ss_pred             HHHCCEEEEEEEECCCCCCCCEEE
T ss_conf             874465889998426999972789


No 52 
>pfam08242 Methyltransf_12 Methyltransferase domain. Members of this family are SAM dependent methyltransferases.
Probab=99.54  E-value=3.1e-14  Score=99.53  Aligned_cols=98  Identities=19%  Similarity=0.205  Sum_probs=72.5

Q ss_pred             EEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCEEE
Q ss_conf             99587843899999986799889999889899998899999806645222530200444235310000123576520577
Q gi|255764482|r   16 ADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVI   95 (225)
Q Consensus        16 LDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~fDlii   95 (225)
                      ||+|||+|.++..+++++++++|+|+|+|+.|++.|++++......+.    .....+...      ......++||+|+
T Consensus         1 LDvGcG~G~~~~~l~~~~~~~~v~giD~s~~~l~~a~~~~~~~~~~~~----~~~~~~~~~------~~~~~~~~fD~I~   70 (98)
T pfam08242         1 LDIGCGTGTLLRALLEALPGLEYTGVDISPAALEAAAERLAALGLLDA----VRVRLDVLD------AIDLDPGSFDVVV   70 (98)
T ss_pred             CCCCCCCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCC----HHHEEECCC------HHHCCCCCCCEEE
T ss_conf             988633799999999878998899985988999999999987134531----110000000------2220358988996


Q ss_pred             ECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEE
Q ss_conf             2265446446547885455652056689899999999862469837
Q gi|255764482|r   96 MNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQL  141 (225)
Q Consensus        96 ~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~  141 (225)
                      ++-.++..                  .....+++.+.++|||||++
T Consensus        71 ~~~vl~~~------------------~~~~~~l~~~~r~LkpgG~l   98 (98)
T pfam08242        71 ASNVLHHL------------------ADPRAVLRNLRRLLKPGGVL   98 (98)
T ss_pred             ECCCHHHC------------------CCHHHHHHHHHHHCCCCCCC
T ss_conf             10417725------------------89999999999974999899


No 53 
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism]
Probab=99.54  E-value=3.9e-14  Score=98.95  Aligned_cols=104  Identities=16%  Similarity=0.162  Sum_probs=80.5

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             55789995878438999999867998899998898999988999998066452225302004442353100001235765
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNF   90 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~   90 (225)
                      +|.+|||+|||.|.+|..+|+.  +++|+|+|+++.+++.|+.....++.+     ++..+..+.+...       ..++
T Consensus        59 ~g~~vLDvGCGgG~Lse~mAr~--Ga~VtgiD~se~~I~~Ak~ha~e~gv~-----i~y~~~~~edl~~-------~~~~  124 (243)
T COG2227          59 PGLRVLDVGCGGGILSEPLARL--GASVTGIDASEKPIEVAKLHALESGVN-----IDYRQATVEDLAS-------AGGQ  124 (243)
T ss_pred             CCCEEEEECCCCCHHHHHHHHC--CCEEEEECCCHHHHHHHHHHHHHCCCC-----CCCHHHHHHHHHH-------CCCC
T ss_conf             7770887458832864999977--994697438767789998754424632-----2522332999972-------4897


Q ss_pred             CCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECC
Q ss_conf             20577226544644654788545565205668989999999986246983787028
Q gi|255764482|r   91 YDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIAR  146 (225)
Q Consensus        91 fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~  146 (225)
                      ||.|+|+=-                  .++....+.|+..+.+++||||.+.+...
T Consensus       125 FDvV~cmEV------------------lEHv~dp~~~~~~c~~lvkP~G~lf~STi  162 (243)
T COG2227         125 FDVVTCMEV------------------LEHVPDPESFLRACAKLVKPGGILFLSTI  162 (243)
T ss_pred             CCEEEEHHH------------------HHCCCCHHHHHHHHHHHCCCCCEEEEECC
T ss_conf             448977358------------------77169999999999986299928999420


No 54 
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated
Probab=99.53  E-value=9.8e-14  Score=96.72  Aligned_cols=108  Identities=19%  Similarity=0.277  Sum_probs=77.9

Q ss_pred             CCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCC
Q ss_conf             98557899958784389999998679988999988989999889999980664522253020044423531000012357
Q gi|255764482|r    9 ATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKN   88 (225)
Q Consensus         9 ~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~   88 (225)
                      .-+|.+|||+|||+|.+++.+|++  +++|+|+|+|+.|++.|++.++..+.   ..++++..+|+...          .
T Consensus        61 dl~G~rVLDaGCGtG~la~~LA~~--Ga~V~avDiS~~mi~~A~~Ra~~~g~---~~~v~F~~gDle~~----------~  125 (230)
T PRK07580         61 DLTGLSILDAGCGTGSLSIPLARR--GAKVVASDISPQMVEEARERAPEAGL---DGNITFEVGDLESL----------L  125 (230)
T ss_pred             CCCCCEEEECCCCCCHHHHHHHHC--CCEEEEEECCHHHHHHHHHHHHHHCC---CCCCEEEECCCCCC----------C
T ss_conf             978998988187867879999977--99899983899999999975586278---76753896676545----------7


Q ss_pred             CCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHHH
Q ss_conf             6520577226544644654788545565205668989999999986246983787028888
Q gi|255764482|r   89 NFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQS  149 (225)
Q Consensus        89 ~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~~  149 (225)
                      +.||.|+|.--..+                .........+.+...  +.+|.+.|-+.|..
T Consensus       126 G~FD~Vv~mdvLiH----------------Yp~~d~~~~l~~la~--~~~~~~ifTfAP~T  168 (230)
T PRK07580        126 GSFDTVVCLDVLIH----------------YPQEDAERMLAHLAS--LTRGSLIFTFAPYT  168 (230)
T ss_pred             CCCCCHHHCCCEEE----------------CCHHHHHHHHHHHHH--CCCCEEEEEECCCC
T ss_conf             98660233371554----------------578899999999972--55885999968986


No 55 
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism]
Probab=99.53  E-value=1.6e-12  Score=89.92  Aligned_cols=125  Identities=18%  Similarity=0.180  Sum_probs=95.8

Q ss_pred             HHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC
Q ss_conf             43899855789995878438999999867998899998898999988999998066452225302004442353100001
Q gi|255764482|r    5 SLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA   84 (225)
Q Consensus         5 ~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~   84 (225)
                      +...++++++++|+|||||.+++-.|...|..+++++|.++++++..++|.+..+..    ++.++++|.......    
T Consensus        28 s~L~~~~g~~l~DIGaGtGsi~iE~a~~~p~~~v~AIe~~~~a~~~~~~N~~~fg~~----n~~vv~g~Ap~~L~~----   99 (187)
T COG2242          28 SKLRPRPGDRLWDIGAGTGSITIEWALAGPSGRVIAIERDEEALELIERNAARFGVD----NLEVVEGDAPEALPD----   99 (187)
T ss_pred             HHHCCCCCCEEEEECCCCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCC----CEEEEECCCHHHHCC----
T ss_conf             860889999899957886689999997398855999925888999999999984999----679995464576369----


Q ss_pred             CCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEE-ECCHHHHHHHHHHHHCCCC
Q ss_conf             23576520577226544644654788545565205668989999999986246983787-0288889999998521788
Q gi|255764482|r   85 GLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSL-IARPQSLIQIVNACARRIG  162 (225)
Q Consensus        85 ~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~-i~~~~~l~~~l~~~~~~~~  162 (225)
                       .  .++|.|+-                      ......+.+++.+...|||||++.. +..-+.+..++..+...-.
T Consensus       100 -~--~~~daiFI----------------------GGg~~i~~ile~~~~~l~~ggrlV~naitlE~~~~a~~~~~~~g~  153 (187)
T COG2242         100 -L--PSPDAIFI----------------------GGGGNIEEILEAAWERLKPGGRLVANAITLETLAKALEALEQLGG  153 (187)
T ss_pred             -C--CCCCEEEE----------------------CCCCCHHHHHHHHHHHCCCCCEEEEEEECHHHHHHHHHHHHHCCC
T ss_conf             -9--99999998----------------------798777899999999718687699986008889999999997298


No 56 
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair]
Probab=99.52  E-value=1.9e-13  Score=95.11  Aligned_cols=125  Identities=21%  Similarity=0.250  Sum_probs=91.0

Q ss_pred             HCCCCCCCEEEEECCCHHHHHHHHHHHCCC--------------------------------C-------EEEEEECCHH
Q ss_conf             389985578999587843899999986799--------------------------------8-------8999988989
Q gi|255764482|r    6 LVNATGSFHLADLGAGAGAAGLAVASRLHE--------------------------------A-------QILLAERSPL   46 (225)
Q Consensus         6 ~~~~~~~~~VLDlGcG~G~~~l~la~r~~~--------------------------------~-------~v~gvD~~~~   46 (225)
                      ++.-++++.++|+.||+|++.+-.|...++                                +       .++|+|+|+.
T Consensus       186 lagw~~~~pl~DPmCGSGTi~IEAAl~~~niAPg~~R~~~f~~w~~~~~~lw~~~~~ea~~~a~~~~~~~~~~G~Did~r  265 (381)
T COG0116         186 LAGWKPDEPLLDPMCGSGTILIEAALIAANIAPGLNRRFGFEFWDWFDKDLWDKLREEAEERARRGKELPIIYGSDIDPR  265 (381)
T ss_pred             HCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCHH
T ss_conf             73999998341688773479999997344568763322004554321388899999999998651476665898748989


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHH
Q ss_conf             99988999998066452225302004442353100001235765205772265446446547885455652056689899
Q gi|255764482|r   47 MAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEK  126 (225)
Q Consensus        47 ~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~  126 (225)
                      +++.|+.|++..+   ..+.+++.++|+.......       +.+|.+||||||+..-+...          .....+..
T Consensus       266 ~i~~Ak~NA~~AG---v~d~I~f~~~d~~~l~~~~-------~~~gvvI~NPPYGeRlg~~~----------~v~~LY~~  325 (381)
T COG0116         266 HIEGAKANARAAG---VGDLIEFKQADATDLKEPL-------EEYGVVISNPPYGERLGSEA----------LVAKLYRE  325 (381)
T ss_pred             HHHHHHHHHHHCC---CCCEEEEEECCHHHCCCCC-------CCCCEEEECCCCHHHCCCHH----------HHHHHHHH
T ss_conf             9999999899769---8832899974432166876-------66998995898301117704----------69999999


Q ss_pred             HHHHHHHHCCCCCEEEEECCHHHH
Q ss_conf             999999862469837870288889
Q gi|255764482|r  127 WIRTACAIMRSSGQLSLIARPQSL  150 (225)
Q Consensus       127 ~~~~a~~lLkpgG~~~~i~~~~~l  150 (225)
                      |...+.+.++--+.+.++-.....
T Consensus       326 fg~~lk~~~~~ws~~v~tt~e~~~  349 (381)
T COG0116         326 FGRTLKRLLAGWSRYVFTTSEDLL  349 (381)
T ss_pred             HHHHHHHHHCCCCEEEEECCHHHH
T ss_conf             999999872577369997667788


No 57 
>pfam01189 Nol1_Nop2_Fmu NOL1/NOP2/sun family.
Probab=99.52  E-value=8.6e-13  Score=91.40  Aligned_cols=188  Identities=15%  Similarity=0.202  Sum_probs=116.8

Q ss_pred             CCHHHCCCCCCCEEEEECCCHHHHHHHHHHHCC-CCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCC
Q ss_conf             662438998557899958784389999998679-9889999889899998899999806645222530200444235310
Q gi|255764482|r    2 ILASLVNATGSFHLADLGAGAGAAGLAVASRLH-EAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGEN   80 (225)
Q Consensus         2 lLa~~~~~~~~~~VLDlGcG~G~~~l~la~r~~-~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~   80 (225)
                      +-+..+.+++|++|||+|+|.|+-+..+|+... .+.++++|+++.-+..+++|+...+..+    +.+...|...... 
T Consensus        75 l~~~~L~p~~g~~VLD~CAaPGgKt~~la~l~~~~g~i~A~D~~~~Rl~~l~~~~~r~g~~~----~~~~~~d~~~~~~-  149 (277)
T pfam01189        75 LDAIALNPQEDEFILDMCAAPGGKTTHIAELMKNEGTVVAVDRNKQRLKRVYANIQRLGVFN----IIVQEGDARQIDQ-  149 (277)
T ss_pred             HHHHHHCCCCCCEEEEECCCCCCHHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHHCCCCC----EEEEECCCCCCCC-
T ss_conf             89997188999989883678881699999875898779983797899999999999759974----7999664445574-


Q ss_pred             CCCCCCCCCCCCEEEECCCCCCCCCC-CCCCHHHHHH---HCCCCCCHHHHHHHHHHHCCCCCEEEEEC---CHHHHHHH
Q ss_conf             00012357652057722654464465-4788545565---20566898999999998624698378702---88889999
Q gi|255764482|r   81 RNLAGLKNNFYDHVIMNPPFNERIGT-MTPDKIKEEA---HVMLEDSFEKWIRTACAIMRSSGQLSLIA---RPQSLIQI  153 (225)
Q Consensus        81 ~~~~~~~~~~fDlii~nPPy~~~~~~-~~~~~~~~~a---~~~~~~~~~~~~~~a~~lLkpgG~~~~i~---~~~~l~~~  153 (225)
                          ....+.||.|+..+|....+.. ..|+......   -.........+++.+.++|||||++.+..   .++.=.+.
T Consensus       150 ----~~~~~~fD~vLvDaPCSg~G~~rr~p~~~~~~~~~~~~~l~~~Q~~iL~~a~~~lk~gG~lvYsTCSi~~eENe~v  225 (277)
T pfam01189       150 ----KLLGGEFDRILLDAPCSGTGVIRRDPDIKWLRREADIAQLAELQKELLKAAWDLVKPGGVLVYSTCSVLPEENEAV  225 (277)
T ss_pred             ----CCCCCCCCEEEECCCCCCCCEECCCCCHHHCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHH
T ss_conf             ----3466666579972898898634558531211999999999999999999999971769989999499998998999


Q ss_pred             HHHHHCCCCCEEEEEECCCCCCCCEEEEEEEEECCCCCCEEECCEEEECCCC
Q ss_conf             9985217884699981458969830999999977888747707568983887
Q gi|255764482|r  154 VNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNG  205 (225)
Q Consensus       154 l~~~~~~~~~~~i~~v~~~~~~~~~~vlv~~~k~~~~~~~~~~~l~l~~~~g  205 (225)
                      +..+......+++.++......+.     ...+.....++++|..  |..||
T Consensus       226 V~~fL~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~r~~P~~--~~~dG  270 (277)
T pfam01189       226 IKYFLQKRPDVELVPTGLSEGKIA-----LAKRIVKGGLQSLPHE--LNRDG  270 (277)
T ss_pred             HHHHHHHCCCCEEECCCCCCCCCC-----CCCCCCCCEEEECCCC--CCCCC
T ss_conf             999998699989904666545433-----3455779907989899--99772


No 58 
>TIGR00406 prmA ribosomal protein L11 methyltransferase; InterPro: IPR004498 Ribosomal protein L11 methyltransferase (2.1.1 from EC) is required for the methylation of ribosomal protein L11. It forms a bifunctional operon in Escherichia coli with panF (pantothenate transport).; GO: 0008276 protein methyltransferase activity, 0006479 protein amino acid methylation.
Probab=99.52  E-value=5.5e-14  Score=98.13  Aligned_cols=124  Identities=19%  Similarity=0.237  Sum_probs=85.3

Q ss_pred             HHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC
Q ss_conf             43899855789995878438999999867998899998898999988999998066452225302004442353100001
Q gi|255764482|r    5 SLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA   84 (225)
Q Consensus         5 ~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~   84 (225)
                      .++...+.+.|+|+|||+|+++++++.. ....++|+|+||.+++.||.|.+.|+..   ++..+.+..    . .....
T Consensus       190 ~~d~k~kh~~viD~GCGSGIL~IAa~~L-Ga~~~~g~D~DP~Ave~~r~N~~lN~v~---~~~~~~~~~----~-vPe~~  260 (330)
T TIGR00406       190 DLDLKDKHKKVIDVGCGSGILSIAALKL-GAAKVVGIDIDPLAVESARKNAELNQVS---DRLQVKLEN----S-VPELE  260 (330)
T ss_pred             CCCCCCCCCEEEEECCCHHHHHHHHHHH-HHHHEEEECCCHHHHHHHHHHHHHCCCC---HHHHHHHCC----C-CCCCC
T ss_conf             0147776654787126717899999975-1231122137728999999768745886---457643205----7-87534


Q ss_pred             CCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEE--ECCHHHHHHHHHHHHC
Q ss_conf             23576520577226544644654788545565205668989999999986246983787--0288889999998521
Q gi|255764482|r   85 GLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSL--IARPQSLIQIVNACAR  159 (225)
Q Consensus        85 ~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~--i~~~~~l~~~l~~~~~  159 (225)
                      ....+++|.|++|-                     .......+.-...+|+|++|.+.+  |. ..+.+-+..+...
T Consensus       261 ~~~e~~~DViVANi---------------------LA~vi~~L~p~~~~L~~~~G~lilSGIl-~~~~~sV~~ay~q  315 (330)
T TIGR00406       261 QPIEGKADVIVANI---------------------LAEVIKELYPQFSRLVKPGGHLILSGIL-ETQAQSVCEAYEQ  315 (330)
T ss_pred             CCCCCCCCEEEECC---------------------HHHHHHHHHHHHHHHCCCCCCEEEHHHH-HHHHHHHHHHHHC
T ss_conf             53225667578800---------------------2457876413551310689965741347-6479999999855


No 59 
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase; InterPro: IPR010251   Chlorophyll and bacteriochlorophyll are essential photosynthetic pigments involved in oxygenic and non-oxygenic photosythesis respectively. They are both synthesised from protoporphyrin IX in complex pathways which share many common steps. The second committed step in both pathways is the methylation of magnesium protoporphyrin IX, catalysed by magnesium protoporphyrin O-methyltransferase with S-adenosyl methionine (SAM) as the methyl donor , , .Sequence alignments suggest that the protein contains the characteristic seven-stranded beta-sheet fold found in other SAM-dependent methyltransferases.   This entry represents magnesium protoporphyrin O-methyltransferase from cyanobacteria and plants, where it is known as ChlM, and from other photosynthetic bacteria, where it is known as BchM.; GO: 0046406 magnesium protoporphyrin IX methyltransferase activity, 0015979 photosynthesis, 0015995 chlorophyll biosynthetic process.
Probab=99.52  E-value=4.5e-14  Score=98.65  Aligned_cols=141  Identities=14%  Similarity=0.142  Sum_probs=91.1

Q ss_pred             CCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCC-CEEECCCCCCCCCCCCCCCCC
Q ss_conf             9855789995878438999999867998899998898999988999998066452225-302004442353100001235
Q gi|255764482|r    9 ATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKR-ISLIEVDVTLVGENRNLAGLK   87 (225)
Q Consensus         9 ~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~-~~~~~~D~~~~~~~~~~~~~~   87 (225)
                      .-+|.||||-|||+|.+|+.||++  |++|.|+|||+.|++.|++..+...   ...+ ++|..+|+....         
T Consensus        52 ~l~G~~vlDAGCGtGllsi~LAk~--GA~V~A~DIS~~mv~~A~~r~~~~~---~~~nl~~FeV~Dl~s~~---------  117 (224)
T TIGR02021        52 SLKGKKVLDAGCGTGLLSIELAKR--GAIVKAVDISEQMVELARERAEKED---EAGNLVEFEVNDLESLE---------  117 (224)
T ss_pred             CCCCCEEEECCCCCCHHHHHHHHC--CCEEEEEHHHHHHHHHHHHHCCCCC---CCCCCCEEEECCHHHHC---------
T ss_conf             987677775588931544988847--9868662376899999986210021---01670035453044413---------


Q ss_pred             CCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEEC-CHHHHHHHHHHHHCCC-CCEE
Q ss_conf             7652057722654464465478854556520566898999999998624698378702-8888999999852178-8469
Q gi|255764482|r   88 NNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIA-RPQSLIQIVNACARRI-GSLE  165 (225)
Q Consensus        88 ~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~-~~~~l~~~l~~~~~~~-~~~~  165 (225)
                      .+.||.|+|-=--                =|.........+.+...+-  .++++|-+ |......++..+...+ .+-+
T Consensus       118 ~G~fD~VV~mDvl----------------IHYp~~d~~~~l~~Laslt--~~~~~ftfAP~T~~l~~~~~IG~lFP~s~R  179 (224)
T TIGR02021       118 LGKFDAVVAMDVL----------------IHYPAEDIAKALEHLASLT--KERVIFTFAPKTAYLAFLKAIGELFPRSDR  179 (224)
T ss_pred             CCCCCEEEEEHHH----------------HHCCHHHHHHHHHHHHHHH--CCCEEEEECCCCHHHHHHHHHHHCCCCCCC
T ss_conf             8985556752122----------------3202222799999988743--586489867876789999985102788988


Q ss_pred             EEEECCCCCCCCEEEE
Q ss_conf             9981458969830999
Q gi|255764482|r  166 ITPLHPREGECASRIL  181 (225)
Q Consensus       166 i~~v~~~~~~~~~~vl  181 (225)
                      -+-+++.+.++-.|++
T Consensus       180 ~t~~~~h~~~~~~R~l  195 (224)
T TIGR02021       180 ATAIYLHPEKDLERAL  195 (224)
T ss_pred             CCEEEECCCCHHHHHH
T ss_conf             8515207860388997


No 60 
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional
Probab=99.51  E-value=1.8e-13  Score=95.18  Aligned_cols=107  Identities=14%  Similarity=0.206  Sum_probs=83.1

Q ss_pred             CHHHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCC
Q ss_conf             62438998557899958784389999998679988999988989999889999980664522253020044423531000
Q gi|255764482|r    3 LASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRN   82 (225)
Q Consensus         3 La~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~   82 (225)
                      +...+.+++|++|||+|||.|.+++.+|+++ +++|+|+-+|++..+.|++.++  +.     .+++...|.++.     
T Consensus       159 i~~kl~l~~G~~VLeIGcGWGgla~~aA~~~-g~~VtgiTlS~eQ~~~a~~r~~--gl-----~v~v~l~DYRd~-----  225 (383)
T PRK11705        159 ICRKLQLKPGMRVLDIGCGWGGLARYAAEHY-GVSVVGVTISAEQQKLAQERCA--GL-----PVEIRLQDYRDL-----  225 (383)
T ss_pred             HHHHCCCCCCCEEEEECCCHHHHHHHHHHHC-CCEEEEEECCHHHHHHHHHHHC--CC-----CCEEEECCHHHC-----
T ss_conf             9986489999979885787499999999974-9759998588999999999973--89-----878997152443-----


Q ss_pred             CCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEE
Q ss_conf             0123576520577226544644654788545565205668989999999986246983787
Q gi|255764482|r   83 LAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSL  143 (225)
Q Consensus        83 ~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~  143 (225)
                           .++||-|++---+              .  +.....+..+++.+.++|||||.+.+
T Consensus       226 -----~g~fD~IvSIeM~--------------E--hVG~~~~~~yF~~i~~lLkp~G~~~l  265 (383)
T PRK11705        226 -----NGQFDRIVSVGMF--------------E--HVGPKNYRTYFEVVDRCLKPDGLFLL  265 (383)
T ss_pred             -----CCCCCEEEEEEHH--------------H--HCCHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             -----6773559997148--------------6--52877799999999985699973999


No 61 
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed
Probab=99.51  E-value=1.1e-12  Score=90.76  Aligned_cols=129  Identities=12%  Similarity=0.222  Sum_probs=94.4

Q ss_pred             HCCCCCCCEEEEECCCHHHHHHHHHHHCC-CCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC
Q ss_conf             38998557899958784389999998679-98899998898999988999998066452225302004442353100001
Q gi|255764482|r    6 LVNATGSFHLADLGAGAGAAGLAVASRLH-EAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA   84 (225)
Q Consensus         6 ~~~~~~~~~VLDlGcG~G~~~l~la~r~~-~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~   84 (225)
                      .+.+++|++|||+|+..|+-|..+|.... .+.+++.|+++.-+...++|++..+..+    +.+.+.|-....      
T Consensus       108 ~~~p~pge~VLDlCAAPGGKtt~la~~m~~~G~lvAnd~~~~R~~~L~~n~~r~G~~n----~~vt~~d~~~~~------  177 (471)
T PRK11933        108 FADDNAPQRVLDMAAAPGSKTTQIAALMNNQGALVANEYSASRVKVLHANISRCGVSN----VALTHFDGRVFG------  177 (471)
T ss_pred             CCCCCCCCEEEEECCCCCHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHHCCCCC----EEEEECCHHHHH------
T ss_conf             2488999989995778548999999975899669998388999999999999719984----799935866740------


Q ss_pred             CCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHH----CCCCCCHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             235765205772265446446547885455652----056689899999999862469837870
Q gi|255764482|r   85 GLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAH----VMLEDSFEKWIRTACAIMRSSGQLSLI  144 (225)
Q Consensus        85 ~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~----~~~~~~~~~~~~~a~~lLkpgG~~~~i  144 (225)
                      ....+.||.|+...|+...+.............    .........++..|.++|||||++.+.
T Consensus       178 ~~~~~~FD~ILvDaPCSG~G~~rk~p~~~~~w~~~~~~~~~~~Q~~iL~~A~~~LkpGG~LVYS  241 (471)
T PRK11933        178 AALPEMFDAILLDAPCSGEGTVRKDPDALKNWSPESNLEIAATQRELIESAFHALKPGGTLVYS  241 (471)
T ss_pred             HHCCCCCCEEEECCCCCCCEEECCCHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEE
T ss_conf             3230106679987888887335559757641898799999999999999999873889689998


No 62 
>pfam05971 Methyltransf_10 Protein of unknown function (DUF890). This family consists of several conserved hypothetical proteins from both eukaryotes and prokaryotes. The function of this family is unknown.
Probab=99.51  E-value=1.2e-14  Score=101.85  Aligned_cols=90  Identities=20%  Similarity=0.151  Sum_probs=66.5

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             85578999587843899999986799889999889899998899999806645222530200444235310000123576
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNN   89 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~   89 (225)
                      ..+-++||+|||.-++--.|+.+..+++++|.|+|+.+++.|++|++.|.  ++..++++....-  ....+.......+
T Consensus        64 ~~~v~gLDIGtGAscIYPLLg~~~y~W~fvgtDId~~sl~~A~~nv~~N~--~L~~~I~l~~q~~--~~~if~gii~~~e  139 (254)
T pfam05971        64 PTLRRALDIGTGANCIYPLLGVTEYGWRFVGSEVDPQSLNSAKAIVEANP--NLSDAIELRRQPQ--STLIFNGLIGENE  139 (254)
T ss_pred             CCCCEEEEECCCHHHHHHHHCCCCCCCEEEEEECCHHHHHHHHHHHHHCC--CCHHCEEEEECCC--CCCCCCCCCCCCC
T ss_conf             77746777336641577754040048637976279899999999998583--3231169996378--1102234468766


Q ss_pred             CCCEEEECCCCCCC
Q ss_conf             52057722654464
Q gi|255764482|r   90 FYDHVIMNPPFNER  103 (225)
Q Consensus        90 ~fDlii~nPPy~~~  103 (225)
                      .||+.+||||||..
T Consensus       140 ~fdftmCNPPF~~S  153 (254)
T pfam05971       140 RYDFTLCNPPFHAS  153 (254)
T ss_pred             CEEEEECCCCCCCC
T ss_conf             06663037986678


No 63 
>KOG3191 consensus
Probab=99.50  E-value=1.7e-12  Score=89.75  Aligned_cols=138  Identities=18%  Similarity=0.210  Sum_probs=103.5

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC-CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             55789995878438999999867-99889999889899998899999806645222530200444235310000123576
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL-HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNN   89 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~-~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~   89 (225)
                      ..+-++|+|||+|+++-.|++.. +++...++|+||.+.+..++.++.|+..     +..++.|+....        ..+
T Consensus        43 ~~~i~lEIG~GSGvvstfL~~~i~~~~~~latDiNp~A~~~Tl~TA~~n~~~-----~~~V~tdl~~~l--------~~~  109 (209)
T KOG3191          43 NPEICLEIGCGSGVVSTFLASVIGPQALYLATDINPEALEATLETARCNRVH-----IDVVRTDLLSGL--------RNE  109 (209)
T ss_pred             CCEEEEEECCCCCHHHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHHCCCC-----CCEEEHHHHHHH--------CCC
T ss_conf             8605899348846599999974177716999549989998879999855775-----205652577663--------327


Q ss_pred             CCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCC---CHHHHHHHHHHHCCCCCEEEEEC-CHHHHHHHHHHHHCCC
Q ss_conf             520577226544644654788545565205668---98999999998624698378702-8888999999852178
Q gi|255764482|r   90 FYDHVIMNPPFNERIGTMTPDKIKEEAHVMLED---SFEKWIRTACAIMRSSGQLSLIA-RPQSLIQIVNACARRI  161 (225)
Q Consensus        90 ~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~---~~~~~~~~a~~lLkpgG~~~~i~-~~~~l~~~l~~~~~~~  161 (225)
                      +.|+++.||||-........+.....+..++.+   ..+.++...-.+|.|.|.+|++. +.....+++..+..+-
T Consensus       110 ~VDvLvfNPPYVpt~~~~i~~~~i~~a~aGG~~Gr~v~d~ll~~v~~iLSp~Gv~Ylv~~~~N~p~ei~k~l~~~g  185 (209)
T KOG3191         110 SVDVLVFNPPYVPTSDEEIGDEGIASAWAGGKDGREVTDRLLPQVPDILSPRGVFYLVALRANKPKEILKILEKKG  185 (209)
T ss_pred             CCCEEEECCCCCCCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCEEEEEEHHHCCHHHHHHHHHHCC
T ss_conf             7308997899676985442067788887457541789998876404442867437763013059799999874336


No 64 
>pfam10672 Methyltrans_SAM S-adenosylmethionine-dependent methyltransferase. Members of this family are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species. The diversity in the roles of methylation is matched by the almost bewildering number of methyltransferase enzymes that catalyse the methylation reaction. Although several classes of methyltransferase enzymes are known, the great majority of methylation reactions are catalysed by the S-adenosylmethionine-dependent methyltransferases.
Probab=99.49  E-value=1.3e-12  Score=90.48  Aligned_cols=116  Identities=17%  Similarity=0.155  Sum_probs=89.8

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             85578999587843899999986799889999889899998899999806645222530200444235310000123576
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNN   89 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~   89 (225)
                      -+|.+|||+.|=||++++..+. ....+|+.||.|+.+++.|++|+++|+..  ..+++++.+|+.......    ...+
T Consensus       122 ~~g~rvLn~Fsytg~fsv~A~~-~GA~~v~~vD~S~~al~~a~~N~~lN~~~--~~~~~~~~~D~f~~l~~~----~~~~  194 (286)
T pfam10672       122 AKGKNVLNLFAYTCGFSVAAIA-GGASQVVNVDMARGSLSKGRDNHRLNGHD--LGRVSFLGHDIFKSWGKI----KKLG  194 (286)
T ss_pred             CCCCCEEEECCCCCHHHHHHHH-CCCCEEEEEECCHHHHHHHHHHHHHCCCC--CCCEEEEEEHHHHHHHHH----HCCC
T ss_conf             2898325311478699999876-79877999919889999999999976999--543699983099999998----6179


Q ss_pred             CCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             5205772265446446547885455652056689899999999862469837870
Q gi|255764482|r   90 FYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLI  144 (225)
Q Consensus        90 ~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i  144 (225)
                      .||+|+..||=|..+..        .    ....+.++...+.++|+|||.+...
T Consensus       195 ~fD~VilDPPsf~k~~~--------~----~~~~Y~~l~~~a~~ll~~gG~L~~~  237 (286)
T pfam10672       195 PYDLVIIDPPSFQKGSF--------A----LTKDYKKILRRLPELLVEGGTVLAC  237 (286)
T ss_pred             CCCEEEECCCCCCCCHH--------H----HHHHHHHHHHHHHHHCCCCCEEEEE
T ss_conf             99879987999888724--------7----8878999999999860899689998


No 65 
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis]
Probab=99.48  E-value=1.6e-13  Score=95.47  Aligned_cols=80  Identities=26%  Similarity=0.414  Sum_probs=65.7

Q ss_pred             CCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCC
Q ss_conf             99855789995878438999999867998899998898999988999998066452225302004442353100001235
Q gi|255764482|r    8 NATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLK   87 (225)
Q Consensus         8 ~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~   87 (225)
                      ..-.|..|+|+|||||.+++.++.. ....|+|||+||++++.++.|...     ....+++..+|+.+.          
T Consensus        42 g~l~g~~V~DlG~GTG~La~ga~~l-Ga~~V~~vdiD~~a~ei~r~N~~~-----l~g~v~f~~~dv~~~----------  105 (198)
T COG2263          42 GDLEGKTVLDLGAGTGILAIGAALL-GASRVLAVDIDPEALEIARANAEE-----LLGDVEFVVADVSDF----------  105 (198)
T ss_pred             CCCCCCEEEECCCCCCHHHHHHHHC-CCCEEEEEECCHHHHHHHHHHHHH-----HCCCEEEEECCHHHC----------
T ss_conf             8847888888278847889999862-971799993698999999988886-----088469998210114----------


Q ss_pred             CCCCCEEEECCCCCCC
Q ss_conf             7652057722654464
Q gi|255764482|r   88 NNFYDHVIMNPPFNER  103 (225)
Q Consensus        88 ~~~fDlii~nPPy~~~  103 (225)
                      .+.+|.++.||||+..
T Consensus       106 ~~~~dtvimNPPFG~~  121 (198)
T COG2263         106 RGKFDTVIMNPPFGSQ  121 (198)
T ss_pred             CCCCCEEEECCCCCCC
T ss_conf             7766669978997322


No 66 
>pfam08241 Methyltransf_11 Methyltransferase domain. Members of this family are SAM dependent methyltransferases.
Probab=99.48  E-value=1.8e-13  Score=95.21  Aligned_cols=95  Identities=22%  Similarity=0.303  Sum_probs=73.9

Q ss_pred             EEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCEEE
Q ss_conf             99587843899999986799889999889899998899999806645222530200444235310000123576520577
Q gi|255764482|r   16 ADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVI   95 (225)
Q Consensus        16 LDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~fDlii   95 (225)
                      ||+|||+|..+..++++ ++.+++|+|+|+.|++.|+++...       ..+.+.++|+....       .++++||+|+
T Consensus         1 LDiGcG~G~~~~~l~~~-~~~~v~giD~s~~~i~~a~~~~~~-------~~~~~~~~d~~~~~-------~~~~~fD~I~   65 (95)
T pfam08241         1 LDVGCGTGLLTEALARL-PGAQVTGVDLSPEMLALARKRAQE-------DGLTFVVGDAEDLP-------FPDESFDVVV   65 (95)
T ss_pred             CCCCCCCCHHHHHHHHC-CCCEEEEEECCHHHHHHHHHHCCC-------CCCEEEEECCCCCC-------CCCCCCCEEE
T ss_conf             96462499999999845-799999994978998776631026-------69479980332467-------5545685999


Q ss_pred             ECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEE
Q ss_conf             226544644654788545565205668989999999986246983787
Q gi|255764482|r   96 MNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSL  143 (225)
Q Consensus        96 ~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~  143 (225)
                      +.--++.                  ......+++.+.++|||||++.+
T Consensus        66 ~~~~l~~------------------~~~~~~~l~~~~r~LkpgG~l~i   95 (95)
T pfam08241        66 SSLVLHH------------------LPDPERALREIARVLKPGGKLVI   95 (95)
T ss_pred             ECCCHHH------------------CCCHHHHHHHHHHHCCCCEEEEC
T ss_conf             8330664------------------68999999999987786949979


No 67 
>PRK11207 tellurite resistance protein TehB; Provisional
Probab=99.47  E-value=7.7e-13  Score=91.66  Aligned_cols=109  Identities=16%  Similarity=0.161  Sum_probs=81.2

Q ss_pred             CCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCC
Q ss_conf             89985578999587843899999986799889999889899998899999806645222530200444235310000123
Q gi|255764482|r    7 VNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGL   86 (225)
Q Consensus         7 ~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~   86 (225)
                      ++.-++.++||+|||.|..++.||.+  +.+|+++|+|+.+++.+++-+...+..    +++....|+....        
T Consensus        26 ~~~~~~g~~LDlgcG~Grna~~La~~--G~~VtavD~s~~al~~~~~~a~~~~l~----~v~~~~~Dl~~~~--------   91 (198)
T PRK11207         26 VKVVKPGRTLDLGCGNGRNSLYLAAN--GYDVTAWDKNPMSIANLERIKAAENLD----NLHTRVVDLNNLT--------   91 (198)
T ss_pred             HCCCCCCCEEEECCCCCHHHHHHHHC--CCEEEEEECCHHHHHHHHHHHHHCCCC----EEEEEEECCCCCC--------
T ss_conf             33589974777247887869999868--985999979999999999999875998----2465620312388--------


Q ss_pred             CCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             57652057722654464465478854556520566898999999998624698378702
Q gi|255764482|r   87 KNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIA  145 (225)
Q Consensus        87 ~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~  145 (225)
                      ..+.||+|++.--++..                .......++..+.+.++|||...+|.
T Consensus        92 ~~~~yDlIlstvv~~fl----------------~p~~~p~iia~mq~~t~PGG~~LIV~  134 (198)
T PRK11207         92 FDGEYDFILSTVVLMFL----------------EAKTIPGLIANMQRCTKPGGYNLIVA  134 (198)
T ss_pred             CCCCCCEEEEEEEEEEC----------------CHHHHHHHHHHHHHHCCCCCEEEEEE
T ss_conf             77770589786452104----------------86678999999999608994899999


No 68 
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis]
Probab=99.46  E-value=3.9e-12  Score=87.69  Aligned_cols=123  Identities=18%  Similarity=0.188  Sum_probs=97.5

Q ss_pred             HHHCCCCCCCEEEEECCCHHHHHHHHHHH-CCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCC
Q ss_conf             24389985578999587843899999986-79988999988989999889999980664522253020044423531000
Q gi|255764482|r    4 ASLVNATGSFHLADLGAGAGAAGLAVASR-LHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRN   82 (225)
Q Consensus         4 a~~~~~~~~~~VLDlGcG~G~~~l~la~r-~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~   82 (225)
                      +......+|.||+|.|+|+|.++..||.. .+.++|+.+|+.++.++.|++|++..+   ..+++.+..+|+......  
T Consensus        87 ~~~~gi~pg~rVlEAGtGSG~lt~~La~~vg~~G~v~tyE~r~d~~k~A~~Nl~~~~---l~d~v~~~~~Dv~~~~~~--  161 (256)
T COG2519          87 VARLGISPGSRVLEAGTGSGALTAYLARAVGPEGHVTTYEIREDFAKTARENLSEFG---LGDRVTLKLGDVREGIDE--  161 (256)
T ss_pred             HHHCCCCCCCEEEECCCCCHHHHHHHHHHHCCCCEEEEEEECHHHHHHHHHHHHHHC---CCCCEEEEECCCCCCCCC--
T ss_conf             987099988789981568059999999964888459999952789999999999842---456137870540002465--


Q ss_pred             CCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCH-HHHHHHHHHHHCC
Q ss_conf             01235765205772265446446547885455652056689899999999862469837870288-8899999985217
Q gi|255764482|r   83 LAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARP-QSLIQIVNACARR  160 (225)
Q Consensus        83 ~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~-~~l~~~l~~~~~~  160 (225)
                            ..||.|+..-|                       .....++++...|+|||.+++-.|. ++.......+...
T Consensus       162 ------~~vDav~LDmp-----------------------~PW~~le~~~~~Lkpgg~~~~y~P~veQv~kt~~~l~~~  211 (256)
T COG2519         162 ------EDVDAVFLDLP-----------------------DPWNVLEHVSDALKPGGVVVVYSPTVEQVEKTVEALRER  211 (256)
T ss_pred             ------CCCCEEEECCC-----------------------CHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHC
T ss_conf             ------54677997589-----------------------848999999987179967999839789999999999866


No 69 
>PRK11727 putative SAM-dependent methyltransferase; Provisional
Probab=99.44  E-value=9.6e-14  Score=96.78  Aligned_cols=91  Identities=18%  Similarity=0.194  Sum_probs=66.9

Q ss_pred             CCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEEC-CCCCCCCCCCCCCCC
Q ss_conf             9985578999587843899999986799889999889899998899999806645222530200-444235310000123
Q gi|255764482|r    8 NATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIE-VDVTLVGENRNLAGL   86 (225)
Q Consensus         8 ~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~-~D~~~~~~~~~~~~~   86 (225)
                      +..+.-++||+|||.-++--.|+.+..+|+++|.|+|+.+++.|+.|+..|.  ++..++++.. .+-..+.   ...-.
T Consensus       114 p~g~~v~gLDIGtGAncIYPLLG~~~ygW~fvgtDId~~sl~~A~~~v~~N~--~L~~~I~lr~q~~~~~If---~gii~  188 (326)
T PRK11727        114 PKGANVRVLDIGVGANCIYPIIGVQEYGWRFVGSDIDPQALASAQAIISANP--GLNGAIRLRLQKDSKAIF---KGIIH  188 (326)
T ss_pred             CCCCCCEEEECCCCCCEEEEECCCEECCCEEEEECCCHHHHHHHHHHHHHCC--CCCCCEEEEECCCHHHHH---CCCCC
T ss_conf             8888723675056743112101430017637996179899999999998482--010527999627867653---24588


Q ss_pred             CCCCCCEEEECCCCCCC
Q ss_conf             57652057722654464
Q gi|255764482|r   87 KNNFYDHVIMNPPFNER  103 (225)
Q Consensus        87 ~~~~fDlii~nPPy~~~  103 (225)
                      +.+.||+.+||||||..
T Consensus       189 ~~e~fdftmCNPPF~~S  205 (326)
T PRK11727        189 KNERFDLTLCNPPFHAS  205 (326)
T ss_pred             CCCEEEEEECCCCCCCC
T ss_conf             76657778518987678


No 70 
>KOG1270 consensus
Probab=99.42  E-value=3.8e-13  Score=93.38  Aligned_cols=104  Identities=18%  Similarity=0.265  Sum_probs=77.3

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCC--CCCCCEEECCCCCCCCCCCCCCCCCC
Q ss_conf             5578999587843899999986799889999889899998899999806645--22253020044423531000012357
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQ--ISKRISLIEVDVTLVGENRNLAGLKN   88 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~--~~~~~~~~~~D~~~~~~~~~~~~~~~   88 (225)
                      .|.+|||+|||.|.+|..||+.  ++.|+|||.+++|++.|++........+  ...++++...|+...          .
T Consensus        89 ~g~~ilDvGCGgGLLSepLArl--ga~V~GID~s~~~V~vA~~h~~~dP~~~~~~~y~l~~~~~~~E~~----------~  156 (282)
T KOG1270          89 LGMKILDVGCGGGLLSEPLARL--GAQVTGIDASDDMVEVANEHKKMDPVLEGAIAYRLEYEDTDVEGL----------T  156 (282)
T ss_pred             CCCEEEEECCCCCCCCHHHHHH--CCEEEEECCHHHHHHHHHHHHHCCCHHCCCCCEEEEHHHCCHHHC----------C
T ss_conf             7864787236755023235750--885685265599999998751049033056414630201533214----------5


Q ss_pred             CCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             65205772265446446547885455652056689899999999862469837870
Q gi|255764482|r   89 NFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLI  144 (225)
Q Consensus        89 ~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i  144 (225)
                      ++||.|+|.--+                  ++-....+|++.+.++|||+|++.+.
T Consensus       157 ~~fDaVvcsevl------------------eHV~dp~~~l~~l~~~lkP~G~lfit  194 (282)
T KOG1270         157 GKFDAVVCSEVL------------------EHVKDPQEFLNCLSALLKPNGRLFIT  194 (282)
T ss_pred             CCCCEEEEHHHH------------------HHHHCHHHHHHHHHHHHCCCCCEEEE
T ss_conf             656454419899------------------98747899999999984889825864


No 71 
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis]
Probab=99.42  E-value=2.6e-12  Score=88.69  Aligned_cols=135  Identities=16%  Similarity=0.197  Sum_probs=97.9

Q ss_pred             CCHHHCCCCCCCEEEEECCCHHHHHHHHHHHCCC--CEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCC
Q ss_conf             6624389985578999587843899999986799--88999988989999889999980664522253020044423531
Q gi|255764482|r    2 ILASLVNATGSFHLADLGAGAGAAGLAVASRLHE--AQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGE   79 (225)
Q Consensus         2 lLa~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~--~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~   79 (225)
                      |-|..+.+++|++|||+|++.|+-|..+|+...+  ..|+++|.++.-+...+.|+...+..+    +.+.+.|......
T Consensus       147 l~a~~L~p~pge~VlD~cAAPGGKTthla~~~~~~~~iV~A~D~~~~Rl~~l~~nl~RlG~~n----v~~~~~d~~~~~~  222 (355)
T COG0144         147 LPALVLDPKPGERVLDLCAAPGGKTTHLAELMENEGAIVVAVDVSPKRLKRLRENLKRLGVRN----VIVVNKDARRLAE  222 (355)
T ss_pred             HHHHHCCCCCCCEEEECCCCCCHHHHHHHHHCCCCCCEEEEECCCHHHHHHHHHHHHHHCCCC----EEEEECCCCCCCC
T ss_conf             679971999979688807999769999999668998769974498789999999999719983----4899513301431


Q ss_pred             CCCCCCCCCCCCCEEEECCCCCCCCCC-CCCCHHHH---HHHCCCCCCHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             000012357652057722654464465-47885455---652056689899999999862469837870
Q gi|255764482|r   80 NRNLAGLKNNFYDHVIMNPPFNERIGT-MTPDKIKE---EAHVMLEDSFEKWIRTACAIMRSSGQLSLI  144 (225)
Q Consensus        80 ~~~~~~~~~~~fDlii~nPPy~~~~~~-~~~~~~~~---~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i  144 (225)
                      ..    ...++||.|+..+|+...+.. ..|+....   ..-......+..++..+.++|||||.+.+.
T Consensus       223 ~~----~~~~~fD~iLlDaPCSg~G~irr~Pd~~~~~~~~~i~~l~~lQ~~iL~~a~~~lk~GG~LVYS  287 (355)
T COG0144         223 LL----PGGEKFDRILLDAPCSGTGVIRRDPDVKWRRTPEDIAELAKLQKEILAAALKLLKPGGVLVYS  287 (355)
T ss_pred             CC----CCCCCCCEEEECCCCCCCEEECCCCCHHCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEE
T ss_conf             13----455777859987999877113358123203899999999999999999999844879889999


No 72 
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit; InterPro: IPR014008   Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt. Cobalamin is usually found in one of two biologically active forms: methylcobalamin and adocobalamin. Most prokaryotes, as well as animals, have cobalamin-dependent enzymes, whereas plants and fungi do not appear to use it. In bacteria and archaea, these include methionine synthase, ribonucleotide reductase, glutamate and methylmalonyl-CoA mutases, ethanolamine ammonia lyase, and diol dehydratase . In mammals, cobalamin is obtained through the diet, and is required for methionine synthase and methylmalonyl-CoA mutase .    There are at least two distinct cobalamin biosynthetic pathways in bacteria :  Aerobic pathway that requires oxygen and in which cobalt is inserted late in the pathway ; found in Pseudomonas denitrificans and Rhodobacter capsulatus. Anaerobic pathway in which cobalt insertion is the first committed step towards cobalamin synthesis ; found in Salmonella typhimurium, Bacillus megaterium, and Propionibacterium freudenreichii shermanii.     Either pathway can be divided into two parts: (1) corrin ring synthesis (differs in aerobic and anaerobic pathways) and (2) adenosylation of corrin ring, attachment of aminopropanol arm, and assembly of the nucleotide loop (common to both pathways) . There are about 30 enzymes involved in either pathway, where those involved in the aerobic pathway are prefixed Cob and those of the anaerobic pathway Cbi. Several of these enzymes are pathway-specific: CbiD, CbiG, and CbiK are specific to the anaerobic route of S. typhimurium, whereas CobE, CobF, CobG, CobN, CobS, CobT, and CobW are unique to the aerobic pathway of P. denitrificans.   This entry represents CbiT subunit of precorrin-6Y C5,15-methyltransferase (2.1.1.132 from EC) from the anaerobic pathway, a bifunctional enzyme that catalyses two methylations (at C-5 and C-15) in precorrin-6Y, as well as the decarboxylation of the acetate side chain located in ring C, in order to generate precorrin-8X. In the anaerobic pathway, two enzymes are required to produce precorrin-8X: CbiE and CbiT, which can be fused as CbiET (sometimes called CobL) . In the aerobic pathway, the bifunctional enzyme is CobL .; GO: 0008276 protein methyltransferase activity, 0009236 cobalamin biosynthetic process.
Probab=99.42  E-value=3.1e-12  Score=88.27  Aligned_cols=115  Identities=19%  Similarity=0.192  Sum_probs=84.8

Q ss_pred             HHHCCCCCCC-EEEEECCCHHHHHHHHHHHCCC-CEEEEEECCHHHHHHHHHHHHHH-CCCCCCCCCEEECCCCCCCCCC
Q ss_conf             2438998557-8999587843899999986799-88999988989999889999980-6645222530200444235310
Q gi|255764482|r    4 ASLVNATGSF-HLADLGAGAGAAGLAVASRLHE-AQILLAERSPLMAHYARKTLALP-ANAQISKRISLIEVDVTLVGEN   80 (225)
Q Consensus         4 a~~~~~~~~~-~VLDlGcG~G~~~l~la~r~~~-~~v~gvD~~~~~~~~A~~n~~~~-~~~~~~~~~~~~~~D~~~~~~~   80 (225)
                      -+...+++++ +++|+|||||.+++-++...|. .+|++||.++.++...++|.+.. ...+    +.++.+|+.....+
T Consensus        12 L~~L~l~~~~~v~wDIGaGtGS~~iE~~~~~p~~g~v~aiEr~~~~~~~~~~N~~~~c~~~~----~~i~~g~ap~~~~~   87 (135)
T TIGR02469        12 LAKLRLRPGDSVLWDIGAGTGSVTIEAARLVPNSGRVYAIERNPEALRLIERNLRRFCGVSN----IVIVEGDAPEELLN   87 (135)
T ss_pred             HHHHCCCCCCCEEEEECCCCCHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHHHCCCCC----CEEEECCCCCCCCC
T ss_conf             98717899994688960574838999997359860799985376898799999998289996----32563556843336


Q ss_pred             CCC--CCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEE
Q ss_conf             000--123576520577226544644654788545565205668989999999986246983787
Q gi|255764482|r   81 RNL--AGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSL  143 (225)
Q Consensus        81 ~~~--~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~  143 (225)
                      ..-  .......+|-|+-                     -......+++++.+.+.|+|||++.+
T Consensus        88 ~~~~~~~~~~~~~Da~fv---------------------GGs~~~~~~il~~~~~~l~~GGr~v~  131 (135)
T TIGR02469        88 SDAPEDSAKLPEPDAVFV---------------------GGSGGKLEEILEAVERRLRPGGRIVL  131 (135)
T ss_pred             CCCCHHHCCCCCCCEEEE---------------------CCCCHHHHHHHHHHHHCCCCCCEEEE
T ss_conf             777710058874688888---------------------38971789999999850596888888


No 73 
>pfam08704 GCD14 tRNA methyltransferase complex GCD14 subunit. GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA.
Probab=99.40  E-value=3e-11  Score=82.69  Aligned_cols=136  Identities=17%  Similarity=0.175  Sum_probs=100.7

Q ss_pred             HHHCCCCCCCEEEEECCCHHHHHHHHHHHC-CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCC
Q ss_conf             243899855789995878438999999867-9988999988989999889999980664522253020044423531000
Q gi|255764482|r    4 ASLVNATGSFHLADLGAGAGAAGLAVASRL-HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRN   82 (225)
Q Consensus         4 a~~~~~~~~~~VLDlGcG~G~~~l~la~r~-~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~   82 (225)
                      ...+.++||.+|+|-|+|+|+++.++|+.. |..+|+.+|+.++.++.|++|++.++.   .+.+.+.+.|+......  
T Consensus        95 ~~~ldi~PG~~VlEaGtGSGsLT~~Laravgp~G~v~t~E~~e~r~~~A~~n~~~~g~---~~~v~~~~rDv~~~gf~--  169 (309)
T pfam08704        95 IMMLELKPGSVVCESGTGSGSLSHAIARTVAPTGHLYTFEFHEQRADKAREEFREHGL---DSLVTVTHRDVCKSGFD--  169 (309)
T ss_pred             HHHHCCCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHCCC---CCCEEEEECCHHCCCCC--
T ss_conf             9980989999999836784299999999748886599984478999999999987498---75058898520013666--


Q ss_pred             CCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCC-CCCEEEEECC-HHHHHHHHHHHHC-
Q ss_conf             012357652057722654464465478854556520566898999999998624-6983787028-8889999998521-
Q gi|255764482|r   83 LAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMR-SSGQLSLIAR-PQSLIQIVNACAR-  159 (225)
Q Consensus        83 ~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLk-pgG~~~~i~~-~~~l~~~l~~~~~-  159 (225)
                        ....+.+|.|+-.-|                       .....+.++.+.|| |||+++...| .++.+..++++.. 
T Consensus       170 --~~~~~~~D~VfLDlp-----------------------~PW~ai~~~~~~Lk~~Gg~l~~f~P~ieQv~r~~~aL~~~  224 (309)
T pfam08704       170 --TEVSNKADAVFLDLP-----------------------APWEAIPHAAKALKVEGGRLCSFSPCIEQVQRTCLALAAL  224 (309)
T ss_pred             --CCCCCCCCEEEECCC-----------------------CHHHHHHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHHC
T ss_conf             --445664358997589-----------------------9799889999860689968999919899999999999977


Q ss_pred             CCCCEEEEEE
Q ss_conf             7884699981
Q gi|255764482|r  160 RIGSLEITPL  169 (225)
Q Consensus       160 ~~~~~~i~~v  169 (225)
                      ++...+..-+
T Consensus       225 gF~~i~t~E~  234 (309)
T pfam08704       225 GFTEIETIEV  234 (309)
T ss_pred             CCCCEEEEEE
T ss_conf             9974079999


No 74 
>pfam01596 Methyltransf_3 O-methyltransferase. Members of this family are O-methyltransferases. The family includes catechol o-methyltransferase, caffeoyl-CoA O-methyltransferase, and a family of bacterial O-methyltransferases that may be involved in antibiotic production.
Probab=99.40  E-value=1.5e-12  Score=89.96  Aligned_cols=117  Identities=15%  Similarity=0.180  Sum_probs=91.9

Q ss_pred             CCHHHCCCCCCCEEEEECCCHHHHHHHHHHHCC-CCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCC
Q ss_conf             662438998557899958784389999998679-9889999889899998899999806645222530200444235310
Q gi|255764482|r    2 ILASLVNATGSFHLADLGAGAGAAGLAVASRLH-EAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGEN   80 (225)
Q Consensus         2 lLa~~~~~~~~~~VLDlGcG~G~~~l~la~r~~-~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~   80 (225)
                      ||+-++......+|||+||++|..++++|...+ +++++.+|.++++++.|++|++..+   .++++++..+|.......
T Consensus        35 ~L~~l~~~~~ak~iLEiGT~~GySal~lA~~l~~~g~i~tiE~~~~~~~~A~~~~~~ag---~~~~I~~~~gdA~~~l~~  111 (204)
T pfam01596        35 FLSMLVKLVGAKRTLEIGVFTGYSLLATALALPEDGKITACDIDREAYEIGLPFIQKAG---VADKIEFRVGDALKTLEQ  111 (204)
T ss_pred             HHHHHHHHHCCCEEEEEECCCCHHHHHHHHHCCCCCEEEEEEECHHHHHHHHHHHHHCC---CCCEEEEEEECHHHHHHH
T ss_conf             99999997598789998343259999999848999689999804899999999999779---874479998749999999


Q ss_pred             CCCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEE
Q ss_conf             000123576520577226544644654788545565205668989999999986246983787
Q gi|255764482|r   81 RNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSL  143 (225)
Q Consensus        81 ~~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~  143 (225)
                      .. .....++||+|+-.-                     ....+..+++.+.++|+|||.+.+
T Consensus       112 l~-~~~~~~~fD~vFiDa---------------------dK~~Y~~y~e~~~~lL~~gGiii~  152 (204)
T pfam01596       112 LV-EDKPLGEFDFAFVDA---------------------DKSSYPNYYERLLELVKVGGLIAI  152 (204)
T ss_pred             HH-HCCCCCCCCEEEEEC---------------------CHHHHHHHHHHHHHHHCCCEEEEE
T ss_conf             98-447777643899818---------------------887779999999986369809999


No 75 
>pfam01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT).
Probab=99.37  E-value=1e-11  Score=85.35  Aligned_cols=107  Identities=15%  Similarity=0.191  Sum_probs=80.2

Q ss_pred             HHHCCCCCCCEEEEECCCHHHHHHHHHHHCC-CCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCC
Q ss_conf             2438998557899958784389999998679-988999988989999889999980664522253020044423531000
Q gi|255764482|r    4 ASLVNATGSFHLADLGAGAGAAGLAVASRLH-EAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRN   82 (225)
Q Consensus         4 a~~~~~~~~~~VLDlGcG~G~~~l~la~r~~-~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~   82 (225)
                      ...+.++++++|||+|||+|..+.++|+... ...|+++|+++.+++.|++|+...+..|    +.+..+|.....    
T Consensus        66 l~~L~l~~g~~VLeIGtGsGY~tAlLa~l~~~~g~V~~iE~~~~l~~~A~~~l~~~~~~n----V~~~~gdg~~g~----  137 (205)
T pfam01135        66 LELLELKPGMRVLEIGSGSGYLTACFARMVGEVGRVVSIEHIPELVEIARRNLEKLGLEN----VIVVVGDGRQGW----  137 (205)
T ss_pred             HHHCCCCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCC----EEEEECCCCCCC----
T ss_conf             997078999989996699659999999983878769998358999999999999848886----589845645588----


Q ss_pred             CCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             012357652057722654464465478854556520566898999999998624698378702
Q gi|255764482|r   83 LAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIA  145 (225)
Q Consensus        83 ~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~  145 (225)
                         .....||.|+..-..                    ......|    ...|++||++.+..
T Consensus       138 ---~~~apfD~Iiv~aa~--------------------~~iP~~l----~~qL~~gGrLv~pv  173 (205)
T pfam01135       138 ---PEFAPYDAIHVGAAA--------------------PEIPEAL----IDQLKEGGRLVIPV  173 (205)
T ss_pred             ---CCCCCCCEEEEEEEC--------------------CCCCHHH----HHHCCCCCEEEEEE
T ss_conf             ---333980589997506--------------------7688999----99628797899998


No 76 
>COG4122 Predicted O-methyltransferase [General function prediction only]
Probab=99.35  E-value=7.5e-12  Score=86.10  Aligned_cols=112  Identities=23%  Similarity=0.350  Sum_probs=88.4

Q ss_pred             CHHHCCCCCCCEEEEECCCHHHHHHHHHHHCC-CCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEEC-CCCCCCCCC
Q ss_conf             62438998557899958784389999998679-9889999889899998899999806645222530200-444235310
Q gi|255764482|r    3 LASLVNATGSFHLADLGAGAGAAGLAVASRLH-EAQILLAERSPLMAHYARKTLALPANAQISKRISLIE-VDVTLVGEN   80 (225)
Q Consensus         3 La~~~~~~~~~~VLDlGcG~G~~~l~la~r~~-~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~-~D~~~~~~~   80 (225)
                      |.-++..+...+|||+|++.|..++.+|...| +++++.+|+++++++.|++|++..+   .+++++++. +|..+....
T Consensus        51 L~~L~~~~~~k~iLEiGT~~GySal~mA~~l~~~g~l~tiE~~~e~~~~A~~n~~~ag---~~~~i~~~~~gdal~~l~~  127 (219)
T COG4122          51 LRLLARLSGPKRILEIGTAIGYSALWMALALPDDGRLTTIERDEERAEIARENLAEAG---VDDRIELLLGGDALDVLSR  127 (219)
T ss_pred             HHHHHHHCCCCEEEEEECCCCHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHHCC---CCCEEEEEECCCHHHHHHH
T ss_conf             9999973498649996352379999999638889769997079899999999999759---7652898835747999973


Q ss_pred             CCCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEE
Q ss_conf             000123576520577226544644654788545565205668989999999986246983787
Q gi|255764482|r   81 RNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSL  143 (225)
Q Consensus        81 ~~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~  143 (225)
                           ...++||+|+-.                     ..+..+..+++.+.++|+|||.+.+
T Consensus       128 -----~~~~~fDliFID---------------------adK~~yp~~le~~~~lLr~GGliv~  164 (219)
T COG4122         128 -----LLDGSFDLVFID---------------------ADKADYPEYLERALPLLRPGGLIVA  164 (219)
T ss_pred             -----CCCCCCCEEEEE---------------------CCHHHCHHHHHHHHHHHCCCCEEEE
T ss_conf             -----347885689983---------------------7843599999999997378968998


No 77 
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed
Probab=99.33  E-value=2.1e-11  Score=83.61  Aligned_cols=132  Identities=14%  Similarity=0.136  Sum_probs=101.8

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             85578999587843899999986799889999889899998899999806645222530200444235310000123576
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNN   89 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~   89 (225)
                      .....+||+|||.|..++.+|...|+..++|+|+...-+..+-..+...+..|    +.++.+|+......    ..+++
T Consensus        53 ~~~p~~lEIGfG~G~~l~~~A~~~P~~~fIGiE~~~~gv~~~~~~~~~~~l~N----i~i~~~da~~~l~~----~~~~~  124 (229)
T PRK00121         53 NDAPIHLEIGFGRGEFLVEMAKANPDINFIGIEIHEPGVAKALKKIEEAGLKN----LRLLCGDAVEVLEH----FLPDG  124 (229)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHCCCCCEEEEEEEHHHHHHHHHHHHHCCCCC----EEEEECCHHHHHHH----HCCCC
T ss_conf             99943999615896999999986888868999961699999999999829983----89883478999997----14645


Q ss_pred             CCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHHHHHH-HHHHHHC
Q ss_conf             520577226544644654788545565205668989999999986246983787028888999-9998521
Q gi|255764482|r   90 FYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQ-IVNACAR  159 (225)
Q Consensus        90 ~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~~l~~-~l~~~~~  159 (225)
                      ++|-|.-+.|          |+.....|+-.......|+....+.|++||.+.+....+.+.+ +++.+..
T Consensus       125 s~~~i~i~FP----------DPWpKkrH~KRRli~~~fl~~~~~~Lk~~G~i~~~TD~~~Y~~~~~e~~~~  185 (229)
T PRK00121        125 SLDRIYLNFP----------DPWPKKRHHKRRLVQPEFLELYARVLKPGGEFHFATDWEEYAEYMLEVFGA  185 (229)
T ss_pred             CCCEEEECCC----------CCCCCCCCCCCCCCCHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHH
T ss_conf             4140467179----------999763202401289999999998579998899981879999999999986


No 78 
>TIGR00091 TIGR00091 tRNA (guanine-N(7)-)-methyltransferase; InterPro: IPR004395   This predicted S-adenosylmethionine-dependent methyltransferase is found in a single copy in most Bacteria . It is also found, with a short amino-terminal extension in eukaryotes. Its function is unknown. In Escherichia coli, this protein flanks the DNA repair protein MutY, also called micA.; GO: 0008168 methyltransferase activity.
Probab=99.32  E-value=3.8e-11  Score=82.10  Aligned_cols=136  Identities=13%  Similarity=0.154  Sum_probs=102.6

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEEC--------CHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCC
Q ss_conf             8557899958784389999998679988999988--------98999988999998066452225302004442353100
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRLHEAQILLAER--------SPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENR   81 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~--------~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~   81 (225)
                      ....-+||||||.|.+.+-+|+.+|+..+.|||+        .+..|..|-..+...+...  .++++.++|.......+
T Consensus        18 ~~~p~~~EIGcG~G~fl~~~A~~nP~~~flGIE~RvqvtnYv~~p~v~~a~~~~~~~g~~~--~Nl~~L~~DA~~l~~~~   95 (216)
T TIGR00091        18 NQKPLVLEIGCGKGRFLIKMAKQNPDKNFLGIEIRVQVTNYVETPIVLKAINKANKLGLKL--RNLHVLCGDANELLEKF   95 (216)
T ss_pred             CCCCEEEEECCCCCCCHHHHHHHCCCCCEEEEEEEEEEEEEECCCHHHHHHHHHHHHCCCH--HHHHHHHCCHHHHHHHH
T ss_conf             1454489841687602689977279972777899988741022728998875576617844--21352213602320454


Q ss_pred             CCCCCCCC--CCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHHHHHH-HHHHHH
Q ss_conf             00123576--520577226544644654788545565205668989999999986246983787028888999-999852
Q gi|255764482|r   82 NLAGLKNN--FYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQ-IVNACA  158 (225)
Q Consensus        82 ~~~~~~~~--~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~~l~~-~l~~~~  158 (225)
                      .    +.+  +..-|.-|.|          |+.....|.-.......|+....++|++||.+.+....+.+.| ++..+.
T Consensus        96 ~----~~~PP~l~k~f~~FP----------DPW~KkRH~KRR~~~~~Fl~~~~~~L~~~G~i~~~TD~~~lfE~mL~~l~  161 (216)
T TIGR00091        96 F----PDGPPSLSKVFLNFP----------DPWPKKRHNKRRITQPHFLKEVANVLKKGGVIELKTDNEPLFEDMLKVLS  161 (216)
T ss_pred             H----CCCCCCEEEEEEECC----------CCCHHHHHCCCCCCCHHHHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHH
T ss_conf             0----078980456888778----------89510210223425678999999970459689997078467899999996


Q ss_pred             CCC
Q ss_conf             178
Q gi|255764482|r  159 RRI  161 (225)
Q Consensus       159 ~~~  161 (225)
                      ...
T Consensus       162 ~~~  164 (216)
T TIGR00091       162 END  164 (216)
T ss_pred             HCC
T ss_conf             536


No 79 
>COG2520 Predicted methyltransferase [General function prediction only]
Probab=99.32  E-value=1.2e-11  Score=85.02  Aligned_cols=102  Identities=18%  Similarity=0.285  Sum_probs=84.2

Q ss_pred             CCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCC
Q ss_conf             98557899958784389999998679988999988989999889999980664522253020044423531000012357
Q gi|255764482|r    9 ATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKN   88 (225)
Q Consensus         9 ~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~   88 (225)
                      .++|++|+|+.||.|.+|+.+|... ...|+++|+||.+++.+++|+++|+..   .++..+++|........       
T Consensus       186 v~~GE~V~DmFAGVGpfsi~~Ak~g-~~~V~A~diNP~A~~~L~eNi~LN~v~---~~v~~i~gD~rev~~~~-------  254 (341)
T COG2520         186 VKEGETVLDMFAGVGPFSIPIAKKG-RPKVYAIDINPDAVEYLKENIRLNKVE---GRVEPILGDAREVAPEL-------  254 (341)
T ss_pred             HCCCCEEEECCCCCCCCHHHHHHCC-CCEEEEEECCHHHHHHHHHHHHHCCCC---CEEEEEECCHHHHHHCC-------
T ss_conf             0699889983578654012466547-863999945989999999999855765---51567966488850204-------


Q ss_pred             CCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEE
Q ss_conf             6520577226544644654788545565205668989999999986246983787
Q gi|255764482|r   89 NFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSL  143 (225)
Q Consensus        89 ~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~  143 (225)
                      +.+|.|+.|-|..                      ...|+..|.+.+++||.+.+
T Consensus       255 ~~aDrIim~~p~~----------------------a~~fl~~A~~~~k~~g~iHy  287 (341)
T COG2520         255 GVADRIIMGLPKS----------------------AHEFLPLALELLKDGGIIHY  287 (341)
T ss_pred             CCCCEEEECCCCC----------------------CHHHHHHHHHHHHCCCEEEE
T ss_conf             6678898389872----------------------02338999998514867999


No 80 
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only]
Probab=99.31  E-value=3.6e-11  Score=82.22  Aligned_cols=123  Identities=15%  Similarity=0.143  Sum_probs=96.8

Q ss_pred             CEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             78999587843899999986799889999889899998899999806645222530200444235310000123576520
Q gi|255764482|r   13 FHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFYD   92 (225)
Q Consensus        13 ~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~fD   92 (225)
                      -.+||||||.|.+.+.+|++.|+..++|||+....+..|.+-+...+..    ++.+++.|........    ..+++.|
T Consensus        50 pi~lEIGfG~G~~l~~~A~~nP~~nfiGiEi~~~~v~~~l~k~~~~~l~----Nlri~~~DA~~~l~~~----~~~~sl~  121 (227)
T COG0220          50 PIVLEIGFGMGEFLVEMAKKNPEKNFLGIEIRVPGVAKALKKIKELGLK----NLRLLCGDAVEVLDYL----IPDGSLD  121 (227)
T ss_pred             CEEEEECCCCCHHHHHHHHHCCCCCEEEEEEEHHHHHHHHHHHHHCCCC----CEEEEECCHHHHHHHC----CCCCCEE
T ss_conf             6699968889878999998789877899997348999999999982998----4699807799999735----8988565


Q ss_pred             EEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHHHHHHH
Q ss_conf             5772265446446547885455652056689899999999862469837870288889999
Q gi|255764482|r   93 HVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQI  153 (225)
Q Consensus        93 lii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~~l~~~  153 (225)
                      -|.-|.|          |+..+..|+-.......|++...+.|+|||.+.+....+.+.+-
T Consensus       122 ~I~i~FP----------DPWpKkRH~KRRl~~~~fl~~~a~~Lk~gG~l~~aTD~~~y~e~  172 (227)
T COG0220         122 KIYINFP----------DPWPKKRHHKRRLTQPEFLKLYARKLKPGGVLHFATDNEEYFEW  172 (227)
T ss_pred             EEEEECC----------CCCCCCCCCCCCCCCHHHHHHHHHHCCCCCEEEEEECCHHHHHH
T ss_conf             7999799----------99987664332147889999999972689789997267999999


No 81 
>KOG1540 consensus
Probab=99.31  E-value=5.4e-11  Score=81.26  Aligned_cols=115  Identities=14%  Similarity=0.264  Sum_probs=85.8

Q ss_pred             HHHCCCCCCCEEEEECCCHHHHHHHHHHHCCC------CEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCC
Q ss_conf             24389985578999587843899999986799------889999889899998899999806645222530200444235
Q gi|255764482|r    4 ASLVNATGSFHLADLGAGAGAAGLAVASRLHE------AQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLV   77 (225)
Q Consensus         4 a~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~------~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~   77 (225)
                      .....+.++.++||++||||-+++-+....+.      .+|+..|+||+|++.+++..+..+. ....++.++++|.+..
T Consensus        93 v~~L~p~~~m~~lDvaGGTGDiaFril~~v~s~~~~~~~~V~v~Dinp~mL~vgkqRa~~~~l-~~~~~~~w~~~dAE~L  171 (296)
T KOG1540          93 VSKLGPGKGMKVLDVAGGTGDIAFRILRHVKSQFGDRESKVTVLDINPHMLAVGKQRAKKRPL-KASSRVEWVEGDAEDL  171 (296)
T ss_pred             HHCCCCCCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCCEEEEEECCHHHHHHHHHHHHHCCC-CCCCCEEEEECCCCCC
T ss_conf             621587778758983477525677798761134577776179993898999999877751597-7687169994770108


Q ss_pred             CCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             3100001235765205772265446446547885455652056689899999999862469837870
Q gi|255764482|r   78 GENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLI  144 (225)
Q Consensus        78 ~~~~~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i  144 (225)
                      .       +++.+||......-      +            +.-.....-++.|-|.|||||++++.
T Consensus       172 p-------Fdd~s~D~yTiafG------I------------RN~th~~k~l~EAYRVLKpGGrf~cL  213 (296)
T KOG1540         172 P-------FDDDSFDAYTIAFG------I------------RNVTHIQKALREAYRVLKPGGRFSCL  213 (296)
T ss_pred             C-------CCCCCCEEEEEECC------E------------ECCCCHHHHHHHHHHHCCCCCEEEEE
T ss_conf             9-------99775115888421------1------------14787789999998752778679999


No 82 
>COG2521 Predicted archaeal methyltransferase [General function prediction only]
Probab=99.31  E-value=1.6e-12  Score=89.86  Aligned_cols=115  Identities=22%  Similarity=0.284  Sum_probs=89.1

Q ss_pred             HHHCCCCCCCEEEEECCCHHHHHHHHHHHCCCC-EEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCC
Q ss_conf             243899855789995878438999999867998-8999988989999889999980664522253020044423531000
Q gi|255764482|r    4 ASLVNATGSFHLADLGAGAGAAGLAVASRLHEA-QILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRN   82 (225)
Q Consensus         4 a~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~-~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~   82 (225)
                      ++.++++.|++|||-|.|-|..++..++|  ++ +|+-||.||..+++|.-|=.-.+.  .+..++++.+|......   
T Consensus       127 v~~V~~~~G~rVLDtC~GLGYtAi~a~~r--GA~~VitvEkdp~VLeLa~lNPwSr~l--~~~~i~iilGD~~e~V~---  199 (287)
T COG2521         127 VELVKVKRGERVLDTCTGLGYTAIEALER--GAIHVITVEKDPNVLELAKLNPWSREL--FEIAIKIILGDAYEVVK---  199 (287)
T ss_pred             HHEECCCCCCEEEEECCCCCHHHHHHHHC--CCCEEEEEEECCCEEEEECCCCCCCCC--CCCCCEEECCCHHHHHH---
T ss_conf             62444366878443246713899999875--874899996087727741358898420--20031786165999974---


Q ss_pred             CCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEE
Q ss_conf             012357652057722654464465478854556520566898999999998624698378
Q gi|255764482|r   83 LAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLS  142 (225)
Q Consensus        83 ~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~  142 (225)
                        ...+.+||.|+-.||-+...+               ..-..+|-+...|.|||||++.
T Consensus       200 --~~~D~sfDaIiHDPPRfS~Ag---------------eLYseefY~El~RiLkrgGrlF  242 (287)
T COG2521         200 --DFDDESFDAIIHDPPRFSLAG---------------ELYSEEFYRELYRILKRGGRLF  242 (287)
T ss_pred             --CCCCCCCCEEEECCCCCCHHH---------------HHHHHHHHHHHHHHCCCCCCEE
T ss_conf             --188653016860797331023---------------5768999999999707698079


No 83 
>pfam03848 TehB Tellurite resistance protein TehB.
Probab=99.30  E-value=2.5e-11  Score=83.14  Aligned_cols=108  Identities=12%  Similarity=0.076  Sum_probs=82.0

Q ss_pred             CCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCC
Q ss_conf             99855789995878438999999867998899998898999988999998066452225302004442353100001235
Q gi|255764482|r    8 NATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLK   87 (225)
Q Consensus         8 ~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~   87 (225)
                      +.-++.++||+|||.|.-++.||++  |..|+++|+|+.+++.++.-++..+.     .++....|+....        .
T Consensus        27 ~~i~pgk~LDlgcG~GRNslyLa~~--G~~VtavD~n~~aL~~l~~ia~~e~l-----~i~~~~~Din~~~--------~   91 (192)
T pfam03848        27 KTVKPGKALDLGCGQGRNSLFLSLL--GYDVTAVDHNENSIANLQDIKEKENL-----DIPTALYDINSAS--------I   91 (192)
T ss_pred             HHCCCCCEEEECCCCCHHHHHHHHC--CCEEEEEECCHHHHHHHHHHHHHCCC-----CCEEEEECCCCCC--------C
T ss_conf             6379974666047897318999868--99179997999999999999997099-----7526873155568--------7


Q ss_pred             CCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECC
Q ss_conf             76520577226544644654788545565205668989999999986246983787028
Q gi|255764482|r   88 NNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIAR  146 (225)
Q Consensus        88 ~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~  146 (225)
                      .+.||+|++---++..                .......++..+.+..+|||...++..
T Consensus        92 ~e~YD~IisTVvfmFL----------------~~~~ip~iI~~mq~~T~pGGynlIv~a  134 (192)
T pfam03848        92 DENYDFILSTVVLMFL----------------QAERIPAIIANMQEHTNVGGYNLIVAA  134 (192)
T ss_pred             CCCCCEEEEEEEEEEC----------------CHHHHHHHHHHHHHHCCCCCEEEEEEE
T ss_conf             6776879888877731----------------867877999999985289988999976


No 84 
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional
Probab=99.30  E-value=2.8e-11  Score=82.87  Aligned_cols=107  Identities=20%  Similarity=0.234  Sum_probs=79.0

Q ss_pred             HHHCCCCCCCEEEEECCCHHHHHHHHHHHCC-CCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCC
Q ss_conf             2438998557899958784389999998679-988999988989999889999980664522253020044423531000
Q gi|255764482|r    4 ASLVNATGSFHLADLGAGAGAAGLAVASRLH-EAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRN   82 (225)
Q Consensus         4 a~~~~~~~~~~VLDlGcG~G~~~l~la~r~~-~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~   82 (225)
                      ...+.++++++|||+|||+|..+.++|+... ..+|+++|+++..++.|++|+...+..|    +.++.+|.....    
T Consensus        69 l~~L~l~~~~~VLeIGtGsGY~tAlla~lvg~~g~V~siE~~~~l~~~A~~~l~~~~~~n----v~~~~gdg~~G~----  140 (214)
T PRK13942         69 CELLDLDEGQKVLEIGTGSGYHAAVVAEIVGKSGKVTTIERIPELAEKAKKNLKKLGYEN----VEVILGDGTKGY----  140 (214)
T ss_pred             HHHHCCCCCCEEEEECCCCCHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCC----EEEEECCCCCCC----
T ss_conf             997279999979996799529999999974767857999717999999999998637687----589856756678----


Q ss_pred             CCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             012357652057722654464465478854556520566898999999998624698378702
Q gi|255764482|r   83 LAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIA  145 (225)
Q Consensus        83 ~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~  145 (225)
                         .....||.|+...-.                    ......|    ...|++||++.+..
T Consensus       141 ---~~~apfD~Iiv~aa~--------------------~~iP~~l----~~qL~~gGrLV~Pv  176 (214)
T PRK13942        141 ---EENAPYDRIYVTAAG--------------------PDIPKPL----LEQLKDGGIMVIPV  176 (214)
T ss_pred             ---CCCCCCCEEEEEECC--------------------CCCCHHH----HHHCCCCCEEEEEE
T ss_conf             ---445981279998517--------------------6578999----99628895899998


No 85 
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed
Probab=99.29  E-value=6.2e-11  Score=80.91  Aligned_cols=104  Identities=14%  Similarity=0.144  Sum_probs=78.4

Q ss_pred             HHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC
Q ss_conf             43899855789995878438999999867998899998898999988999998066452225302004442353100001
Q gi|255764482|r    5 SLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA   84 (225)
Q Consensus         5 ~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~   84 (225)
                      ..+.++++++|||+|||+|..+..+|+..  .+|+++|+++..++.|++|+...+..|    +.+..+|.....      
T Consensus        72 ~~L~l~~~~~VLeIGtGsGY~tAlLa~l~--~~V~siE~~~~l~~~a~~~l~~~~~~n----v~~~~gdg~~g~------  139 (213)
T PRK00312         72 ELLELKPGDRVLEIGTGSGYQAAVLAHLV--ERVFSVERIKTLQWQAKRRLKQLGLHN----VSVRHGDGWKGW------  139 (213)
T ss_pred             HHHCCCCCCEEEEECCCCCHHHHHHHHHC--CCEEEEECCHHHHHHHHHHHHHCCCCC----EEEEECCCCCCC------
T ss_conf             98436899759996598609999999862--928999428999999999999849987----699968876678------


Q ss_pred             CCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             2357652057722654464465478854556520566898999999998624698378702
Q gi|255764482|r   85 GLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIA  145 (225)
Q Consensus        85 ~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~  145 (225)
                       .....||.|+.+-..                        ..+=......|++||++.+..
T Consensus       140 -~~~~pfD~Iii~~a~------------------------~~~P~~l~~qL~~gGrLV~Pi  175 (213)
T PRK00312        140 -PAYAPFDRILVTAAA------------------------PEIPRALLDQLAEGGILVAPI  175 (213)
T ss_pred             -CCCCCCCEEEEEECC------------------------HHHHHHHHHHCCCCCEEEEEE
T ss_conf             -766972489998434------------------------122599998453297999998


No 86 
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional
Probab=99.28  E-value=4e-11  Score=81.99  Aligned_cols=109  Identities=14%  Similarity=0.201  Sum_probs=79.1

Q ss_pred             CHHHCCCCCCCEEEEECCCHHHHHHHHHHHCC-CCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCC
Q ss_conf             62438998557899958784389999998679-98899998898999988999998066452225302004442353100
Q gi|255764482|r    3 LASLVNATGSFHLADLGAGAGAAGLAVASRLH-EAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENR   81 (225)
Q Consensus         3 La~~~~~~~~~~VLDlGcG~G~~~l~la~r~~-~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~   81 (225)
                      |...+.++++++|||+|||+|..+..+|+... .++|+++|++++.++.|++|+...+..   +.+.+.++|.....   
T Consensus        64 ml~~L~~~~~~~VLeIGtGsGY~tAlla~l~~~~g~V~siE~~~~L~~~A~~~l~~l~~~---n~v~v~~gdg~~G~---  137 (205)
T PRK13944         64 MCELIEPRPGMKILEVGTGSGYQAAVCAEAIERRGKVYTVEIVKELAIYAAQNIERLGYW---GVVEVYHGDGKRGL---  137 (205)
T ss_pred             HHHHHCCCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHCCCC---CCCEEEECCCCCCC---
T ss_conf             999706899998999789851999999998374771799953699999999999985986---33067976556577---


Q ss_pred             CCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             0012357652057722654464465478854556520566898999999998624698378702
Q gi|255764482|r   82 NLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIA  145 (225)
Q Consensus        82 ~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~  145 (225)
                          .....||.|+.....                    ......|+    ..|++||++.+..
T Consensus       138 ----~~~apfD~Iiv~aa~--------------------~~iP~~l~----~QL~~gGrLV~Pv  173 (205)
T PRK13944        138 ----EKHAPFDAIIVTAAA--------------------STIPSALV----RQLKDGGVLVIPV  173 (205)
T ss_pred             ----CCCCCCCEEEEEEEC--------------------CCCCHHHH----HHCCCCCEEEEEE
T ss_conf             ----434980489998507--------------------76899999----8548797999998


No 87 
>pfam10294 Methyltransf_16 Putative methyltransferase.
Probab=99.28  E-value=1.2e-10  Score=79.37  Aligned_cols=124  Identities=15%  Similarity=0.186  Sum_probs=85.9

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             85578999587843899999986799889999889899998899999806645222530200444235310000123576
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNN   89 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~   89 (225)
                      -++.+|||+|||+|..++++|......+|+..|. ++.+..+++|+..|..  ...++.+...|.....   .......+
T Consensus        43 ~~~k~VLELGaG~GL~Gi~~a~~~~~~~V~lTD~-~~~l~~l~~Nv~~N~~--~~~~v~~~~LdWg~~~---~~~~~~~~  116 (171)
T pfam10294        43 LSGKNVLELGSGCGLVGIAVALLLPGASVTITDL-EEAIELMKKNIELNKA--LSSKVTAKVLDWGEEL---PDDVFDPH  116 (171)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHCCCCEEEECCC-HHHHHHHHHHHHHCCC--CCCCEEEEEEECCCCC---CHHHCCCC
T ss_conf             0687678705665758999998579858996383-7899999999997057--8996699981108988---43331467


Q ss_pred             CCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHH--HHHHHHHHH
Q ss_conf             52057722654464465478854556520566898999999998624698378702888--899999985
Q gi|255764482|r   90 FYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQ--SLIQIVNAC  157 (225)
Q Consensus        90 ~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~--~l~~~l~~~  157 (225)
                      .||+|++.=..+.                  ......+++....+|+|+|.+++.+...  .-.+.++.+
T Consensus       117 ~fD~Il~sD~iY~------------------~~~~~~L~~ti~~ll~~~g~~lla~~~R~~~~~~F~~~~  168 (171)
T pfam10294       117 PVDLILAADCVYN------------------EDAFPLLVKTLKDLLGKETVILVAYKKRREAEKRFFKLL  168 (171)
T ss_pred             CCCEEEEECEEEC------------------HHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHH
T ss_conf             7678997121335------------------777999999999995899899999782067799999998


No 88 
>pfam07021 MetW Methionine biosynthesis protein MetW. This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins. Biosynthesis of methionine from homoserine in Pseudomonas putida takes place in three steps. The first step is the acylation of homoserine to yield an acyl-L-homoserine. This reaction is catalysed by the products of the metXW genes and is equivalent to the first step in enterobacteria, gram-positive bacteria and fungi, except that in these microorganisms the reaction is catalysed by a single polypeptide (the product of the metA gene in Escherichia coli and the met5 gene product in Neurospora crassa). In Pseudomonas putida, as in gram-positive bacteria and certain fungi, the second and third steps are a direct sulfhydrylation that converts the O-acyl-L-homoserine into homocysteine and further methylation to yield methionine. The latter reaction can be mediated by either of the two methionine synthetases present in the cells.
Probab=99.27  E-value=2e-11  Score=83.70  Aligned_cols=107  Identities=15%  Similarity=0.137  Sum_probs=74.8

Q ss_pred             CHHHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCC
Q ss_conf             62438998557899958784389999998679988999988989999889999980664522253020044423531000
Q gi|255764482|r    3 LASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRN   82 (225)
Q Consensus         3 La~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~   82 (225)
                      .++++  ++|.||||+|||.|.++-.|.. .++++++|+|+|+..++.|..+           .+.++++|+...     
T Consensus         7 I~~~I--~~~srVLDlGCG~G~ll~~L~~-~k~v~~~GvEid~~~v~~a~~k-----------g~~Vi~~D~d~~-----   67 (193)
T pfam07021         7 IARLI--PPGSRVLDLGCGDGSLLYLLQE-EKQVDGRGIELDAAGVAECVAK-----------GLSVIQGDADKG-----   67 (193)
T ss_pred             HHHHC--CCCCEEEEECCCCCHHHHHHHH-CCCCCEEEECCCHHHHHHHHHC-----------CCCEECCCHHHC-----
T ss_conf             99865--8969899836889899999987-6698769833899999999864-----------795450774459-----


Q ss_pred             CCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHHH
Q ss_conf             0123576520577226544644654788545565205668989999999986246983787028888
Q gi|255764482|r   83 LAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQS  149 (225)
Q Consensus        83 ~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~~  149 (225)
                      +...++++||.|+++--                  .+........++   .+++.|+++.+.+|.-.
T Consensus        68 l~~f~d~sFD~VIls~v------------------Lqhl~~P~~vL~---EmlRVgk~~IVSfPNf~  113 (193)
T pfam07021        68 LEHFPDKSFDYVILSQT------------------LQATRNPREVLD---ELLRIGRRAIVSFPNFG  113 (193)
T ss_pred             HHHCCCCCCCEEEHHHH------------------HHHHCCCHHHHH---HHHHHCCEEEEEECCHH
T ss_conf             74577678037869879------------------987528199999---98512686999943614


No 89 
>pfam02390 Methyltransf_4 Putative methyltransferase. This is a family of putative methyltransferases. The aligned region contains the GXGXG S-AdoMet binding site suggesting a putative methyltransferase activity.
Probab=99.25  E-value=1.1e-10  Score=79.55  Aligned_cols=132  Identities=13%  Similarity=0.161  Sum_probs=96.9

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHH-HCCCCCCCCCEEECCCCCCCCCCCCCCCCCC
Q ss_conf             855789995878438999999867998899998898999988999998-0664522253020044423531000012357
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLAL-PANAQISKRISLIEVDVTLVGENRNLAGLKN   88 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~-~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~   88 (225)
                      .++-.+||+|||.|...+.+|.+.|+..++|+|+...-+..|.+.+.. .+.    .++.++++|.......    ...+
T Consensus        19 ~~~pi~lEIG~G~G~~l~~~A~~~p~~n~iGiEi~~~~v~~~~~k~~~~~~l----~Ni~~~~~da~~~l~~----~~~~   90 (199)
T pfam02390        19 NEQPLFLEIGCGMGDFLVAMAKKNPDKLFIGIEIRVPGVDKALKKIIALRGL----QNLRILCGDAMKLLPN----LFPD   90 (199)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHCCCCCEEEEEECHHHHHHHHHHHHHHCCC----CCEEEECCCHHHHHHH----HCCC
T ss_conf             9994499973688899999999789987899995059999999999984577----7378760479999997----5798


Q ss_pred             CCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHHHHHH-HHHHHHC
Q ss_conf             6520577226544644654788545565205668989999999986246983787028888999-9998521
Q gi|255764482|r   89 NFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQ-IVNACAR  159 (225)
Q Consensus        89 ~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~~l~~-~l~~~~~  159 (225)
                      +++|.|..|.|          |+.....++-......+|+....+.|++||.+.+......+.+ +++.+..
T Consensus        91 ~~l~~i~i~FP----------DPWpKkrH~KRRli~~~fl~~~~~~Lk~gG~l~~~TD~~~y~~~~~e~~~~  152 (199)
T pfam02390        91 GSLQKIFINFP----------DPWPKKRHHKRRLLQPEFLKEYARVLKPGGVLHLATDVEEYFEWMLEHLSE  152 (199)
T ss_pred             CCEEEEEEECC----------CCCCCCCCCCCCCCCHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHH
T ss_conf             86427999679----------998764424400079999999999638898999982899999999999996


No 90 
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional
Probab=99.24  E-value=4.4e-11  Score=81.76  Aligned_cols=86  Identities=23%  Similarity=0.257  Sum_probs=60.0

Q ss_pred             CCCCEEEEECCCHHHHHHHHHH----------H--------------------------------CCCCEEEEEECCHHH
Q ss_conf             8557899958784389999998----------6--------------------------------799889999889899
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVAS----------R--------------------------------LHEAQILLAERSPLM   47 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~----------r--------------------------------~~~~~v~gvD~~~~~   47 (225)
                      +.+.-.+|+.||+|++.+-.|-          |                                .+..+++|.|+|+.+
T Consensus       193 ~~~~pLvDPMCGSGTllIEAAliA~~iAPGl~R~~fgF~~W~~~d~~lW~~l~~eA~~r~~~~~~~~~~~i~G~D~D~~a  272 (716)
T PRK11783        193 QGGTPLLDPMCGSGTLLIEAAMMAADIAPGLHRERWGFSAWLGHDEALWQELLEEAQERARAGLAECSPKFYGSDIDPRV  272 (716)
T ss_pred             CCCCEEECCCCCCCHHHHHHHHHHHCCCCCCCCCCCCHHHCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCEEEEECCHHH
T ss_conf             79981344666843789999999847798865454564115688999999999999986542234688718999599899


Q ss_pred             HHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCC
Q ss_conf             99889999980664522253020044423531000012357652057722654464
Q gi|255764482|r   48 AHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNER  103 (225)
Q Consensus        48 ~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~fDlii~nPPy~~~  103 (225)
                      +..|+.|++..+.   .+.+++.+.|+.......     .....-+|++||||+.+
T Consensus       273 i~~Ar~Na~~AGv---~~~I~f~~~d~~~l~~p~-----~~~~~Gliv~NPPYGER  320 (716)
T PRK11783        273 IQAARRNARRAGV---EELITFEVKDVADLKNPL-----PKGPTGLVISNPPYGER  320 (716)
T ss_pred             HHHHHHHHHHCCC---CCCCEEEECCHHHCCCCC-----CCCCCCEEEECCCHHCC
T ss_conf             9999999998199---886299956789857987-----77898289967852201


No 91 
>TIGR00755 ksgA dimethyladenosine transferase; InterPro: IPR011530   This family of proteins represent the rRNA adenine dimethylases (e.g. KsgA).    The bacterial enzyme KsgA catalyzes the transfer of a total of four methyl groups from S-adenosyl-l-methionine (S-AdoMet) to two adjacent adenosine bases in 16S rRNA. This enzyme and the resulting modified adenosine bases appear to be conserved in all species of eubacteria, eukaryotes, and archaea, and in eukaryotic organelles. Bacterial resistance to the aminoglycoside antibiotic kasugamycin involves inactivation of KsgA and resulting loss of the dimethylations, with modest consequences to the overall fitness of the organism. In contrast, the yeast ortholog, Dim1, is essential. In yeast, and presumably in other eukaryotes, the enzyme performs a vital role in pre-rRNA processing in addition to its methylating activity. The best conserved region in these enzymes is located in the N-terminal section and corresponds to a region that is probably involved in S-adenosyl methionine (SAM) binding.   The crystal structure of KsgA from Escherichia coli has been solved to a resolution of 2.1A. It bears a strong similarity to the crystal structure of ErmC' from Bacillus stearothermophilus and a lesser similarity to the yeast mitochondrial transcription factor, sc-mtTFB .; GO: 0016433 rRNA (adenine) methyltransferase activity, 0006364 rRNA processing.
Probab=99.23  E-value=4.3e-11  Score=81.80  Aligned_cols=88  Identities=24%  Similarity=0.309  Sum_probs=70.5

Q ss_pred             HHHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCE-EEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCC
Q ss_conf             2438998557899958784389999998679988-999988989999889999980664522253020044423531000
Q gi|255764482|r    4 ASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQ-ILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRN   82 (225)
Q Consensus         4 a~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~-v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~   82 (225)
                      ++.+++.++++|||+|+|.|.+|..|+++  ..+ |++||+|+.+++..++....    ....+++++++|+....... 
T Consensus        22 v~~~~~~~~~~vlEIGPG~G~LT~~Ll~~--~~~~v~aiEiD~~l~~~L~~~~~~----~~~~~~~~i~~Dalk~~~~~-   94 (277)
T TIGR00755        22 VEAANVLENDVVLEIGPGLGALTEPLLKR--AKKLVTAIEIDPRLAEILRKLLSE----KLYENLEVIEGDALKVDLNS-   94 (277)
T ss_pred             HHHHCCCCCCEEEEECCCCHHHHHHHHHH--CCCEEEEEEECHHHHHHHHHHCCC----CCCCCEEEEECCEEEECCCH-
T ss_conf             99743789977999738820789999982--598489997267899998752154----33242578714445412320-


Q ss_pred             CCCCCCCCCC-----EEEECCCCCCC
Q ss_conf             0123576520-----57722654464
Q gi|255764482|r   83 LAGLKNNFYD-----HVIMNPPFNER  103 (225)
Q Consensus        83 ~~~~~~~~fD-----lii~nPPy~~~  103 (225)
                           ...|+     .|++|-||+-.
T Consensus        95 -----~~~~~~~~~~~vv~NLPY~Is  115 (277)
T TIGR00755        95 -----LEDFPKEDKLKVVSNLPYNIS  115 (277)
T ss_pred             -----HHHCCCCCCCEEEEECCCCHH
T ss_conf             -----433167898579850774324


No 92 
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis]
Probab=99.21  E-value=7.7e-11  Score=80.37  Aligned_cols=86  Identities=19%  Similarity=0.197  Sum_probs=70.3

Q ss_pred             HHHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC
Q ss_conf             24389985578999587843899999986799889999889899998899999806645222530200444235310000
Q gi|255764482|r    4 ASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL   83 (225)
Q Consensus         4 a~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~   83 (225)
                      +..+++++++.|+|+|+|.|+++..|+++  ..+|++||+|+.+++..++...      ...+++++++|+.........
T Consensus        23 v~~a~~~~~d~VlEIGpG~GaLT~~Ll~~--~~~v~aiEiD~~l~~~L~~~~~------~~~n~~vi~~DaLk~d~~~l~   94 (259)
T COG0030          23 VEAANISPGDNVLEIGPGLGALTEPLLER--AARVTAIEIDRRLAEVLKERFA------PYDNLTVINGDALKFDFPSLA   94 (259)
T ss_pred             HHHCCCCCCCEEEEECCCCCHHHHHHHHH--CCEEEEEEECHHHHHHHHHHHC------CCCCEEEEECCHHCCCCHHHC
T ss_conf             98557899986999789877889999960--6957999968899999997506------566559994724247513515


Q ss_pred             CCCCCCCCCEEEECCCCCCC
Q ss_conf             12357652057722654464
Q gi|255764482|r   84 AGLKNNFYDHVIMNPPFNER  103 (225)
Q Consensus        84 ~~~~~~~fDlii~nPPy~~~  103 (225)
                            .++.|++|.||+-.
T Consensus        95 ------~~~~vVaNlPY~Is  108 (259)
T COG0030          95 ------QPYKVVANLPYNIS  108 (259)
T ss_pred             ------CCCEEEECCCCCCC
T ss_conf             ------78889980897656


No 93 
>KOG2899 consensus
Probab=99.21  E-value=1.5e-10  Score=78.67  Aligned_cols=184  Identities=16%  Similarity=0.191  Sum_probs=98.8

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECC-----------------
Q ss_conf             855789995878438999999867998899998898999988999998066452225302004-----------------
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEV-----------------   72 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~-----------------   72 (225)
                      -.+..+||+||.+|.+++.+|+.+....+.|+|||+..+..|++|++.-..-...-.-.++..                 
T Consensus        57 f~~~~~LDIGCNsG~lt~~iak~F~~r~iLGvDID~~LI~~Ark~~r~~~~~~~~~~~~~~~~~~~~~~~is~~~~a~~a  136 (288)
T KOG2899          57 FEPKQALDIGCNSGFLTLSIAKDFGPRRILGVDIDPVLIQRARKEIRFPCDHETEVSGKFPASFGVQFGPISQRNEADRA  136 (288)
T ss_pred             CCCCEEEECCCCCCHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             47620575067754658999986064334676156899999997356601010334578754335444541012446651


Q ss_pred             ---CCCCC----C-----CCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCE
Q ss_conf             ---44235----3-----10000123576520577226544644654788545565205668989999999986246983
Q gi|255764482|r   73 ---DVTLV----G-----ENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQ  140 (225)
Q Consensus        73 ---D~~~~----~-----~~~~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~  140 (225)
                         |+.+.    .     ....+.+.....||.|+|---   .         +...--.++..+..|+..+.++|.|||.
T Consensus       137 ~t~~~p~n~~f~~~n~vle~~dfl~~~~~~fDiIlcLSi---T---------kWIHLNwgD~GL~~ff~kis~ll~pgGi  204 (288)
T KOG2899         137 FTTDFPDNVWFQKENYVLESDDFLDMIQPEFDIILCLSI---T---------KWIHLNWGDDGLRRFFRKISSLLHPGGI  204 (288)
T ss_pred             CCCCCCCCHHCCCCCEEEECCHHHHHCCCCCCEEEEEEE---E---------EEEECCCCCHHHHHHHHHHHHHHCCCCE
T ss_conf             003677201013233798600455505654227999773---3---------4676456457899999999986086857


Q ss_pred             EEEECCHHHHH----HHHHHHHCCCCCEEEEEE----------CCCCCCCCEEEEEEEEECCCCCCEEECCEEEECCCCC
Q ss_conf             78702888899----999985217884699981----------4589698309999999778887477075689838874
Q gi|255764482|r  141 LSLIARPQSLI----QIVNACARRIGSLEITPL----------HPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQ  206 (225)
Q Consensus       141 ~~~i~~~~~l~----~~l~~~~~~~~~~~i~~v----------~~~~~~~~~~vlv~~~k~~~~~~~~~~~l~l~~~~g~  206 (225)
                      +.+-=.++-.+    ...+.+........+.|=          .......-..++     .+....-+..++++|...++
T Consensus       205 LvvEPQpWksY~kaar~~e~~~~ny~~i~lkp~~f~~~l~q~~vgle~~e~~~~~-----~~~~skgf~R~i~~y~Kk~~  279 (288)
T KOG2899         205 LVVEPQPWKSYKKAARRSEKLAANYFKIFLKPEDFEDWLNQIVVGLESVEDLGLI-----VSAASKGFDRPILLYRKKLH  279 (288)
T ss_pred             EEECCCCHHHHHHHHHHHHHHHCCCCCEECCHHHHHHHHHHHHHHEEEECCCCCC-----CCCCCCCCCCEEEEEECCCC
T ss_conf             9975886177999999999860584010328889876542023323210010000-----24667555640355323688


Q ss_pred             HHHH
Q ss_conf             0018
Q gi|255764482|r  207 PYSR  210 (225)
Q Consensus       207 ~yt~  210 (225)
                      .-|+
T Consensus       280 ~~~~  283 (288)
T KOG2899         280 PKTD  283 (288)
T ss_pred             CCCC
T ss_conf             7557


No 94 
>KOG1271 consensus
Probab=99.20  E-value=1.3e-10  Score=79.00  Aligned_cols=129  Identities=14%  Similarity=0.202  Sum_probs=87.7

Q ss_pred             CCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             57899958784389999998679988999988989999889999980664522253020044423531000012357652
Q gi|255764482|r   12 SFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFY   91 (225)
Q Consensus        12 ~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~f   91 (225)
                      ..+|||+|||+|.+..-|++.--...++|+|.++.++++|+.-++..+   .++.+++.+.|+....       ...+.|
T Consensus        68 A~~VlDLGtGNG~~L~~L~~egf~~~L~GvDYs~~AV~LA~niAe~~~---~~n~I~f~q~DI~~~~-------~~~~qf  137 (227)
T KOG1271          68 ADRVLDLGTGNGHLLFQLAKEGFQSKLTGVDYSEKAVELAQNIAERDG---FSNEIRFQQLDITDPD-------FLSGQF  137 (227)
T ss_pred             CCCEEECCCCCHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHCC---CCCCEEEEEEECCCCC-------CCCCCE
T ss_conf             321166157961889998871388886453157889999987887527---8853168873225775-------555432


Q ss_pred             CEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHCC
Q ss_conf             057722654464465478854556520566898999999998624698378702888899999985217
Q gi|255764482|r   92 DHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARR  160 (225)
Q Consensus        92 Dlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~~l~~~l~~~~~~  160 (225)
                      |+|+----|-..  ..+++..        .......+....++|+|+|.+.+.-=.+-.+|+.+.+...
T Consensus       138 dlvlDKGT~DAi--sLs~d~~--------~~r~~~Y~d~v~~ll~~~gifvItSCN~T~dELv~~f~~~  196 (227)
T KOG1271         138 DLVLDKGTLDAI--SLSPDGP--------VGRLVVYLDSVEKLLSPGGIFVITSCNFTKDELVEEFENF  196 (227)
T ss_pred             EEEEECCCEEEE--ECCCCCC--------CCCEEEEHHHHHHCCCCCCEEEEEECCCCHHHHHHHHHCC
T ss_conf             389605741225--5077776--------6543443556863038896799985576589999997259


No 95 
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones]
Probab=99.19  E-value=1.5e-10  Score=78.67  Aligned_cols=106  Identities=16%  Similarity=0.234  Sum_probs=79.5

Q ss_pred             CHHHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCC
Q ss_conf             62438998557899958784389999998679988999988989999889999980664522253020044423531000
Q gi|255764482|r    3 LASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRN   82 (225)
Q Consensus         3 La~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~   82 (225)
                      |...+.++++++|||+|||+|..+-.+|+..  .+|+.+|+++...+.|++|++..+..|    +.+.++|-....    
T Consensus        64 m~~~L~~~~g~~VLEIGtGsGY~aAvla~l~--~~V~siEr~~~L~~~A~~~L~~lg~~n----V~v~~gDG~~G~----  133 (209)
T COG2518          64 MLQLLELKPGDRVLEIGTGSGYQAAVLARLV--GRVVSIERIEELAEQARRNLETLGYEN----VTVRHGDGSKGW----  133 (209)
T ss_pred             HHHHHCCCCCCEEEEECCCCHHHHHHHHHHH--CEEEEEEECHHHHHHHHHHHHHCCCCC----EEEEECCCCCCC----
T ss_conf             9997489999868887778309999999974--849999971999999999999769873----499978855688----


Q ss_pred             CCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             012357652057722654464465478854556520566898999999998624698378702
Q gi|255764482|r   83 LAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIA  145 (225)
Q Consensus        83 ~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~  145 (225)
                         .....||.|+.+--.                    ..    .=+.....||+||++.+..
T Consensus       134 ---~~~aPyD~I~Vtaaa--------------------~~----vP~~Ll~QL~~gGrlv~Pv  169 (209)
T COG2518         134 ---PEEAPYDRIIVTAAA--------------------PE----VPEALLDQLKPGGRLVIPV  169 (209)
T ss_pred             ---CCCCCCCEEEEEECC--------------------CC----CCHHHHHHCCCCCEEEEEE
T ss_conf             ---777984789995035--------------------77----9989998506598899998


No 96 
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional
Probab=99.19  E-value=1.6e-10  Score=78.57  Aligned_cols=106  Identities=12%  Similarity=0.234  Sum_probs=77.5

Q ss_pred             CHHHCCCCCCCEEEEECCCHHHHHHHHHHHCC-CCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCC
Q ss_conf             62438998557899958784389999998679-98899998898999988999998066452225302004442353100
Q gi|255764482|r    3 LASLVNATGSFHLADLGAGAGAAGLAVASRLH-EAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENR   81 (225)
Q Consensus         3 La~~~~~~~~~~VLDlGcG~G~~~l~la~r~~-~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~   81 (225)
                      |...+.+++|++|||+|||+|..+..+|+... ...|+.||+++..++.|+++++..+..+    +.++.+|-....   
T Consensus        67 MlElL~l~pg~rVLEIGTGSGYqAAlLA~Lvg~~G~V~TIE~~~~L~~~Ar~~L~~lG~~N----V~vv~GDG~~G~---  139 (317)
T PRK13943         67 FMEWVGLDKGMRVLEIGGGTGYNAAVMSRVVGEKGLVVSVEYSRKICEIAKRNVERLGIEN----VIFVCGDGYYGV---  139 (317)
T ss_pred             HHHHHCCCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEEEECHHHHHHHHHHHHHCCCCC----EEEEECCCCCCC---
T ss_conf             9997178999868996577438999999984878759999867999999999999779986----499979988888---


Q ss_pred             CCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEE
Q ss_conf             00123576520577226544644654788545565205668989999999986246983787
Q gi|255764482|r   82 NLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSL  143 (225)
Q Consensus        82 ~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~  143 (225)
                          .....||.|+..--                    .......|    ...|||||++.+
T Consensus       140 ----pe~APYD~IIVTAa--------------------a~~IP~aL----ldQLk~GGRLVi  173 (317)
T PRK13943        140 ----PEFSPYDVIFVTVG--------------------VDEVPETW----FTQLKEGGRVIV  173 (317)
T ss_pred             ----CCCCCCCEEEEEEC--------------------CCCCCHHH----HHHCCCCCEEEE
T ss_conf             ----66799778999852--------------------76489999----996185969999


No 97 
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional
Probab=99.19  E-value=2.1e-10  Score=77.88  Aligned_cols=146  Identities=12%  Similarity=0.133  Sum_probs=96.4

Q ss_pred             CCCCCEEEEECCCHHHHHHHHHHHC-CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC-CCC
Q ss_conf             9855789995878438999999867-99889999889899998899999806645222530200444235310000-123
Q gi|255764482|r    9 ATGSFHLADLGAGAGAAGLAVASRL-HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL-AGL   86 (225)
Q Consensus         9 ~~~~~~VLDlGcG~G~~~l~la~r~-~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~-~~~   86 (225)
                      .+++.+|||+||.+|..+..++++. +.+.|+|||+.|-.-               -..++++++|+.+....... ...
T Consensus        49 ~~~~~~VlDLGaAPG~WsQva~~~~~~~g~VigVDl~~~~p---------------i~gv~~i~gDi~~~~~~~~i~~~~  113 (209)
T PRK11188         49 FKPGMTVVDLGAAPGGWSQYAVTQIGDKGRVIACDILPMDP---------------IVGVDFLQGDFRDELVLKALLERV  113 (209)
T ss_pred             CCCCCEEEEECCCCCHHHHHHHHHCCCCCEEEEEECCCCCC---------------CCCCEEECCCCCCHHHHHHHHHHH
T ss_conf             57899899806899757899999739997399986530453---------------789676403445889999999985


Q ss_pred             CCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEE-ECCHHHHHHHHHHHHCCCCCEE
Q ss_conf             576520577226544644654788545565205668989999999986246983787-0288889999998521788469
Q gi|255764482|r   87 KNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSL-IARPQSLIQIVNACARRIGSLE  165 (225)
Q Consensus        87 ~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~-i~~~~~l~~~l~~~~~~~~~~~  165 (225)
                      ....||+|++..-=.. .+....|..      ......+..+..|.+.|+|||.+.+ ++.-+...+++..+...+..+ 
T Consensus       114 ~~~~~DvVlSDmAPn~-tG~~~~D~~------~s~~L~~~al~~a~~~Lk~gG~fv~K~F~G~~~~~~~~~~k~~F~~V-  185 (209)
T PRK11188        114 GDSKVDVVMSDMAPNM-SGTPAVDIP------RAMYLVELALDMCRQVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKV-  185 (209)
T ss_pred             CCCCCCEEECCCCCCC-CCCHHHHHH------HHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCHHHHHHHHHCCCCEE-
T ss_conf             8987308966666566-787033599------99999999999999862679889999964879999999997025978-


Q ss_pred             EEEECCCCCCCCE
Q ss_conf             9981458969830
Q gi|255764482|r  166 ITPLHPREGECAS  178 (225)
Q Consensus       166 i~~v~~~~~~~~~  178 (225)
                       ..+.|.+.++.+
T Consensus       186 -~~~KP~ASR~~S  197 (209)
T PRK11188        186 -KVRKPDSSRARS  197 (209)
T ss_pred             -EEECCCCCCCCC
T ss_conf             -899986746678


No 98 
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional
Probab=99.18  E-value=3.6e-10  Score=76.63  Aligned_cols=122  Identities=16%  Similarity=0.207  Sum_probs=95.4

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             85578999587843899999986799889999889899998899999806645222530200444235310000123576
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNN   89 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~   89 (225)
                      -+|.++|-+.|=||..|+..|.- ...+.+.||.|...++-|++|+.+|++..  .+-.++++|...+...      ..+
T Consensus       551 a~gk~fLNLF~YTgt~sv~Aa~g-GA~~t~sVD~S~tyl~Wa~~N~~lN~~~~--~~h~~v~aD~~~wl~~------~~~  621 (716)
T PRK11783        551 AKGKRFLNLFAYTGTASVHAALG-GAKSTTTVDMSNTYLEWAERNFALNGLSG--RQHRFIQADCLAWLKE------ARE  621 (716)
T ss_pred             HCCCCEEEEEECCCCEEHHHHHC-CCCEEEEECCCHHHHHHHHHHHHHCCCCC--CCCEEEECCHHHHHHH------CCC
T ss_conf             07884643122256102133527-96122786270879999999998549996--3473896408999985------777


Q ss_pred             CCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCH
Q ss_conf             5205772265446446547885455652056689899999999862469837870288
Q gi|255764482|r   90 FYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARP  147 (225)
Q Consensus        90 ~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~  147 (225)
                      .||+|++.||=|..+....       ..+....+...++..+.++|.|||.++|....
T Consensus       622 ~fDli~~DPPtFSnSk~m~-------~~~dvqrDh~~li~~~~~~L~~~G~l~FS~N~  672 (716)
T PRK11783        622 QFDLIFIDPPTFSNSKRME-------DSFDVQRDHVALIKLAMRLLRPGGTLYFSNNK  672 (716)
T ss_pred             CCCEEEECCCCCCCCCCCC-------CCCCCCCCHHHHHHHHHHHCCCCCEEEEECCC
T ss_conf             6678998899998766678-------86322030999999999860899689996288


No 99 
>TIGR00438 rrmJ ribosomal RNA large subunit methyltransferase J; InterPro: IPR004512 The ribosomal RNA large subunit methyltransferase J 2.1.1 from EC methylates the 23S rRNA. It specifically methylates the uridine in position 2552 of 23s rRNA in the 50S particle using S-adenosyl-L-methionine as a substrate. It was previously known as cell division protein ftsJ.; GO: 0016436 rRNA (uridine) methyltransferase activity, 0006364 rRNA processing.
Probab=99.17  E-value=1.3e-10  Score=79.15  Aligned_cols=138  Identities=15%  Similarity=0.197  Sum_probs=101.7

Q ss_pred             CCCCCEEEEECCCHHHHHHHHHHHCCC-CEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCC
Q ss_conf             985578999587843899999986799-8899998898999988999998066452225302004442353100001235
Q gi|255764482|r    9 ATGSFHLADLGAGAGAAGLAVASRLHE-AQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLK   87 (225)
Q Consensus         9 ~~~~~~VLDlGcG~G~~~l~la~r~~~-~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~   87 (225)
                      .|+|..||||||-+|+.|..++....+ +.|+|+|++|-=           ++  --.++.+++||++...........-
T Consensus        30 ik~G~~VlDLGAAPGGWsQva~~~~G~kG~ViA~Dl~~~k-----------~F--P~~nv~fi~GDftdee~l~ki~~~~   96 (192)
T TIGR00438        30 IKPGDTVLDLGAAPGGWSQVAVEQVGGKGRVIAVDLQPMK-----------GF--PIENVDFIRGDFTDEEVLNKILERV   96 (192)
T ss_pred             EECCCEEEECCCCCCCHHHHHHHHHCCCCEEEEEECCCCC-----------CC--CCCCEEEEECCCCCHHHHHHHHHHC
T ss_conf             1078867865789873877887760685338998545578-----------85--6466147544767878999999857


Q ss_pred             CC---CCCEEEECC-CCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEE-ECCHHHHHHHHHHHHCCCC
Q ss_conf             76---520577226-544644654788545565205668989999999986246983787-0288889999998521788
Q gi|255764482|r   88 NN---FYDHVIMNP-PFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSL-IARPQSLIQIVNACARRIG  162 (225)
Q Consensus        88 ~~---~fDlii~nP-Py~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~-i~~~~~l~~~l~~~~~~~~  162 (225)
                      .+   +.|+|+|.. |-.  ++...-|      |.......+..++.|.++|+++|-+.+ ++--+.+++.+..++..+.
T Consensus        97 g~dekk~DVV~SDaaP~~--SG~~~iD------h~Rs~dLv~~aL~ia~~vL~~~GnfvvKvFqGe~~d~y~~e~r~~F~  168 (192)
T TIGR00438        97 GDDEKKVDVVMSDAAPNI--SGIWDID------HLRSIDLVELALDIAKEVLKPKGNFVVKVFQGEEIDEYLNELRKLFE  168 (192)
T ss_pred             CCCCCEEEEEEECCCCCC--CCCCCCC------HHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHCCC
T ss_conf             898743778985268887--8987543------44379999999999999861589899998537428899997652054


Q ss_pred             CEEEE
Q ss_conf             46999
Q gi|255764482|r  163 SLEIT  167 (225)
Q Consensus       163 ~~~i~  167 (225)
                      .++++
T Consensus       169 ~~k~~  173 (192)
T TIGR00438       169 KVKVT  173 (192)
T ss_pred             EEEEE
T ss_conf             76744


No 100
>KOG2671 consensus
Probab=99.17  E-value=3.7e-12  Score=87.83  Aligned_cols=137  Identities=14%  Similarity=0.152  Sum_probs=89.3

Q ss_pred             CCCHHHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHH---HHHHHHH----CCCCCCCCCEEECCC
Q ss_conf             966243899855789995878438999999867998899998898999988---9999980----664522253020044
Q gi|255764482|r    1 MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYA---RKTLALP----ANAQISKRISLIEVD   73 (225)
Q Consensus         1 vlLa~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A---~~n~~~~----~~~~~~~~~~~~~~D   73 (225)
                      .++|+++.+++|+-|.|+..|||.+.+..|+-  |+.|+|.|||-.|+..-   ..|++.|    +.  .+.-+.+.-+|
T Consensus       198 li~AN~Amv~pGdivyDPFVGTGslLvsaa~F--Ga~viGtDIDyr~vragrg~~~si~aNFkQYg~--~~~fldvl~~D  273 (421)
T KOG2671         198 LIMANQAMVKPGDIVYDPFVGTGSLLVSAAHF--GAYVIGTDIDYRTVRAGRGEDESIKANFKQYGS--SSQFLDVLTAD  273 (421)
T ss_pred             HHHHHHHCCCCCCEEECCCCCCCCEEEEHHHH--CCEEECCCCCHHEEECCCCCCCCHHHHHHHHCC--CCHHHHEEEEC
T ss_conf             88755530679988744765667426662230--635641245312011345777426676877477--53203204510


Q ss_pred             CCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCC---------CHHHHHHHCC------CCCCHHHHHHHHHHHCCCC
Q ss_conf             423531000012357652057722654464465478---------8545565205------6689899999999862469
Q gi|255764482|r   74 VTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTP---------DKIKEEAHVM------LEDSFEKWIRTACAIMRSS  138 (225)
Q Consensus        74 ~~~~~~~~~~~~~~~~~fDlii~nPPy~~~~~~~~~---------~~~~~~a~~~------~~~~~~~~~~~a~~lLkpg  138 (225)
                      +....      +.....||-|+|.|||+.+.+....         .......+.-      ......+.+..+.+.|..|
T Consensus       274 ~sn~~------~rsn~~fDaIvcDPPYGVRe~~rk~~~k~~~r~~~~~~~~~h~p~~~~ysl~~~v~dll~fss~~L~~g  347 (421)
T KOG2671         274 FSNPP------LRSNLKFDAIVCDPPYGVREGARKTGKKKSVRTTEESSRGDHYPSTEQYSLSSLVYDLLCFSSRRLVDG  347 (421)
T ss_pred             CCCCC------HHHCCEEEEEEECCCCCHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             56763------010323337872798114566665414576557521243355776446679999750887637663028


Q ss_pred             CEEEEECCH
Q ss_conf             837870288
Q gi|255764482|r  139 GQLSLIARP  147 (225)
Q Consensus       139 G~~~~i~~~  147 (225)
                      |++.+-.|+
T Consensus       348 grlv~w~p~  356 (421)
T KOG2671         348 GRLVFWLPT  356 (421)
T ss_pred             CEEEEECCC
T ss_conf             558983474


No 101
>KOG3420 consensus
Probab=99.16  E-value=3.9e-11  Score=82.03  Aligned_cols=82  Identities=22%  Similarity=0.357  Sum_probs=65.7

Q ss_pred             CCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCC
Q ss_conf             98557899958784389999998679988999988989999889999980664522253020044423531000012357
Q gi|255764482|r    9 ATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKN   88 (225)
Q Consensus         9 ~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~   88 (225)
                      --+|.+++|+|||+|.+++. ........|.|+|++|++++++++|.+...     -++++.++|+......       .
T Consensus        46 diEgkkl~DLgcgcGmLs~a-~sm~~~e~vlGfDIdpeALEIf~rNaeEfE-----vqidlLqcdildle~~-------~  112 (185)
T KOG3420          46 DIEGKKLKDLGCGCGMLSIA-FSMPKNESVLGFDIDPEALEIFTRNAEEFE-----VQIDLLQCDILDLELK-------G  112 (185)
T ss_pred             CCCCCCHHHHCCCHHHHHHH-HHCCCCCEEEEEECCHHHHHHHHHCHHHHH-----HHHHEEEEECCCHHCC-------C
T ss_conf             20474622524761156777-505787337864058899999861668752-----3342122221551105-------8


Q ss_pred             CCCCEEEECCCCCCC
Q ss_conf             652057722654464
Q gi|255764482|r   89 NFYDHVIMNPPFNER  103 (225)
Q Consensus        89 ~~fDlii~nPPy~~~  103 (225)
                      +.||..+-||||+..
T Consensus       113 g~fDtaviNppFGTk  127 (185)
T KOG3420         113 GIFDTAVINPPFGTK  127 (185)
T ss_pred             CEEEEEEECCCCCCC
T ss_conf             767667866898764


No 102
>KOG2187 consensus
Probab=99.16  E-value=5.1e-10  Score=75.74  Aligned_cols=115  Identities=18%  Similarity=0.149  Sum_probs=79.2

Q ss_pred             HHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC
Q ss_conf             43899855789995878438999999867998899998898999988999998066452225302004442353100001
Q gi|255764482|r    5 SLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA   84 (225)
Q Consensus         5 ~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~   84 (225)
                      .++....+..++|++||||.+++++|++  -.+|+|||++|++++.|++|+..|+.+|    .+|+.+..++......  
T Consensus       377 e~~~l~~~k~llDv~CGTG~iglala~~--~~~ViGvEi~~~aV~dA~~nA~~NgisN----a~Fi~gqaE~~~~sl~--  448 (534)
T KOG2187         377 EWAGLPADKTLLDVCCGTGTIGLALARG--VKRVIGVEISPDAVEDAEKNAQINGISN----ATFIVGQAEDLFPSLL--  448 (534)
T ss_pred             HHHCCCCCCEEEEEEECCCCEEHHHHCC--CCCEEEEECCHHHCCHHHHCCHHCCCCC----CEEEECCHHHCCCHHC--
T ss_conf             9708998847998630688400001026--6612102338454443554001158654----0243064200150120--


Q ss_pred             CCCCCCCC-EEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCH
Q ss_conf             23576520-5772265446446547885455652056689899999999862469837870288
Q gi|255764482|r   85 GLKNNFYD-HVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARP  147 (225)
Q Consensus        85 ~~~~~~fD-lii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~  147 (225)
                      .....+-+ .++.+||-                    ......++....++-.+.-..|..+-+
T Consensus       449 ~~~~~~~~~v~iiDPpR--------------------~Glh~~~ik~l~~~~~~~rlvyvSCn~  492 (534)
T KOG2187         449 TPCCDSETLVAIIDPPR--------------------KGLHMKVIKALRAYKNPRRLVYVSCNP  492 (534)
T ss_pred             CCCCCCCCEEEEECCCC--------------------CCCCHHHHHHHHHCCCCCCEEEEECCH
T ss_conf             56788875689978886--------------------761099999998534755058997166


No 103
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional
Probab=99.15  E-value=4.5e-10  Score=76.03  Aligned_cols=107  Identities=20%  Similarity=0.173  Sum_probs=79.3

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             85578999587843899999986799889999889899998899999806645222530200444235310000123576
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNN   89 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~   89 (225)
                      -++.+|||+.||+|.+++-...| ...+|+.||.+..++...++|+...+.    .++.+++.|+..+..      ....
T Consensus        51 i~~~~vLDLFAGSGalGlEALSR-GA~~v~fVE~~~~~~~~i~~N~~~l~~----~~~~ii~~da~~~L~------~~~~  119 (198)
T PRK10909         51 IVDARCLDCFAGSGALGLEALSR-YAAGATLLEMDRAVSQQLIKNLATLKA----GNARVVNTNALSFLA------QPGT  119 (198)
T ss_pred             CCCCEEEECCCCCCHHHHHHHHC-CCCEEEEEECCHHHHHHHHHHHHHHCC----CCEEEEEHHHHHHHH------CCCC
T ss_conf             29987998277746889999987-997899997899999999999998488----867999556999862------5599


Q ss_pred             CCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHH--HHHCCCCCEEEEECC
Q ss_conf             520577226544644654788545565205668989999999--986246983787028
Q gi|255764482|r   90 FYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTA--CAIMRSSGQLSLIAR  146 (225)
Q Consensus        90 ~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a--~~lLkpgG~~~~i~~  146 (225)
                      .||+|+..|||...                   .+..+++..  ..+|+++|.+++-++
T Consensus       120 ~fDlIF~DPPY~~~-------------------~~~~~l~~l~~~~~L~~~gliiiE~~  159 (198)
T PRK10909        120 PHNVVFVDPPFRKG-------------------LLEETINLLEQNGWLADDALIYVESE  159 (198)
T ss_pred             CEEEEEECCCCCCC-------------------HHHHHHHHHHHCCCCCCCCEEEEEEC
T ss_conf             52189989997655-------------------59999999998889189969999954


No 104
>TIGR02081 metW methionine biosynthesis protein MetW; InterPro: IPR010743   This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins. Biosynthesis of methionine from homoserine in Pseudomonas putida takes place in three steps. The first step is the acylation of homoserine to yield an acyl-L-homoserine. This reaction is catalysed by the products of the metXW genes and is equivalent to the first step in enterobacteria, Gram-positive bacteria and fungi, except that in these microorganisms the reaction is catalysed by a single polypeptide (the product of the metA gene in Escherichia coli and the met5 gene product in Neurospora crassa). In Pseudomonas putida, as in Gram-positive bacteria and certain fungi, the second and third steps are a direct sulphydrylation that converts the O-acyl-L-homoserine into homocysteine and further methylation to yield methionine. The latter reaction can be mediated by either of the two methionine synthetases present in the cells . .
Probab=99.15  E-value=6.7e-11  Score=80.71  Aligned_cols=102  Identities=14%  Similarity=0.103  Sum_probs=69.7

Q ss_pred             CCCCCEEEEECCCHHHHHHHHHHHCC--C-----CEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCC
Q ss_conf             98557899958784389999998679--9-----8899998898999988999998066452225302004442353100
Q gi|255764482|r    9 ATGSFHLADLGAGAGAAGLAVASRLH--E-----AQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENR   81 (225)
Q Consensus         9 ~~~~~~VLDlGcG~G~~~l~la~r~~--~-----~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~   81 (225)
                      +.+|.||||+|||.|.+.-+|..+..  +     -++.|+|+|.+-+..+-.           --++++++|+...... 
T Consensus        11 Ip~GSRVLDLGCGdG~LL~~L~d~k~v~GPPttehRL~G~Eid~~~v~Ac~~-----------RGv~VIq~Dld~GL~~-   78 (205)
T TIGR02081        11 IPPGSRVLDLGCGDGELLALLRDEKQVRGPPTTEHRLYGIEIDQDGVLACVA-----------RGVSVIQGDLDEGLEA-   78 (205)
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHCCCCCCCCCCCEEEEEEECHHHHHHHHH-----------CCCCEECCCCCCCCCC-
T ss_conf             6888736410168878999999743789888712000102345445999986-----------2520130060034011-


Q ss_pred             CCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCH
Q ss_conf             001235765205772265446446547885455652056689899999999862469837870288
Q gi|255764482|r   82 NLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARP  147 (225)
Q Consensus        82 ~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~  147 (225)
                          +.+.+||.||-|---                  -.......+++.+.|.   |=+..+.+|.
T Consensus        79 ----F~D~~FD~ViLsQTL------------------Qa~~Np~~iL~EmLRv---g~~aIVSFPN  119 (205)
T TIGR02081        79 ----FPDKSFDYVILSQTL------------------QATRNPEEILDEMLRV---GRRAIVSFPN  119 (205)
T ss_pred             ----CCCCCCCEEEECHHH------------------HHHHCHHHHHHHHHHH---CCEEEEECCC
T ss_conf             ----678876625421356------------------6422568999887767---3851560588


No 105
>pfam05401 NodS Nodulation protein S (NodS). This family consists of nodulation S (NodS) proteins. The products of the rhizobial nodulation genes are involved in the biosynthesis of lipochitin oligosaccharides (LCOs), which are host-specific signal molecules required for nodule formation. NodS is an S-adenosyl-L-methionine (SAM)-dependent methyltransferase involved in N methylation of LCOs. NodS uses N-deacetylated chitooligosaccharides, the products of the NodBC proteins, as its methyl acceptors.
Probab=99.13  E-value=1.4e-10  Score=78.85  Aligned_cols=107  Identities=18%  Similarity=0.208  Sum_probs=81.0

Q ss_pred             CCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCC
Q ss_conf             99855789995878438999999867998899998898999988999998066452225302004442353100001235
Q gi|255764482|r    8 NATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLK   87 (225)
Q Consensus         8 ~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~   87 (225)
                      +-..=.++||+||+.|.++..||.|+.  +++++|+++.+++.|++.+..      ...+++.+.|+...        .+
T Consensus        40 p~~ry~~alE~GCa~G~lT~~LA~RCd--rLla~Dvs~~Av~~Ar~Rla~------~~hV~v~~~~vp~~--------wP  103 (201)
T pfam05401        40 AQGTIANALEVGCAAGAFTERLAPYCQ--RLTVIDVMPEAIARARLRMKK------WSHISWIVSDVQQF--------ST  103 (201)
T ss_pred             CCHHHHHHCCCCCCCCHHHHHHHHHHH--HHHHHCCCHHHHHHHHHHHCC------CCCCEEEECCCCCC--------CC
T ss_conf             834330020435662487899999874--673213629999999998557------99828982566665--------99


Q ss_pred             CCCCCEEEECCC-CCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECC
Q ss_conf             765205772265-44644654788545565205668989999999986246983787028
Q gi|255764482|r   88 NNFYDHVIMNPP-FNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIAR  146 (225)
Q Consensus        88 ~~~fDlii~nPP-y~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~  146 (225)
                      .++||+|+..=- |+                ..........+....++|.|||++.|.+.
T Consensus       104 ~~~FDLIV~SEVlYY----------------L~d~a~lr~~~~~~v~~LaP~G~Lvfgsa  147 (201)
T pfam05401       104 NELFDLIVVAEVLYY----------------LGDVAEMRGAVRNLVSMLAPDGQLVFGSA  147 (201)
T ss_pred             CCCEEEEEEEHHHHH----------------HCCHHHHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             888627975147786----------------18799999999999997189965997304


No 106
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional
Probab=99.11  E-value=1.4e-09  Score=73.21  Aligned_cols=108  Identities=15%  Similarity=0.187  Sum_probs=75.9

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHCC---CCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCC
Q ss_conf             557899958784389999998679---98899998898999988999998066452225302004442353100001235
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRLH---EAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLK   87 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~~---~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~   87 (225)
                      ...+|||+|||.|.-+-.++...+   +..++|+|+|+.++..|-+.-         ..+.+..+|..+.       +..
T Consensus        85 ~~~~ilD~GCGEGyYl~~l~~~l~~~~~~~~~G~DiSK~ai~~Aak~~---------~~~~~~Va~~~~l-------P~~  148 (272)
T PRK11088         85 KATAILDIGCGEGYYTHALADALPEVTTCQLFGLDISKVAIKYAAKRY---------PQVTFCVASSHRL-------PFA  148 (272)
T ss_pred             CCCEEEEECCCCCHHHHHHHHHHHCCCCCCEEEEECCHHHHHHHHCCC---------CCCEEEEEECCCC-------CCC
T ss_conf             786488815877789999999741157873799811799999996268---------8854999610018-------887


Q ss_pred             CCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHHH-HHHHHHHHHC
Q ss_conf             76520577226544644654788545565205668989999999986246983787028888-9999998521
Q gi|255764482|r   88 NNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQS-LIQIVNACAR  159 (225)
Q Consensus        88 ~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~~-l~~~l~~~~~  159 (225)
                      ++++|+|++-.-  +                   .    -.+...|+|||||.+..|.|..+ |.|+-+.+..
T Consensus       149 d~s~D~vl~vFs--P-------------------~----~~~Ef~RvLkp~G~li~V~P~~~HL~eLre~lY~  196 (272)
T PRK11088        149 DQSLDAIIRIYA--P-------------------C----KAEELARVVKPGGIVITVTPGPRHLFELKGLIYD  196 (272)
T ss_pred             CCCCEEEEEEEC--C-------------------C----CHHHHHHEECCCCEEEEEECCHHHHHHHHHHHHH
T ss_conf             665408999843--7-------------------8----8588612463797899997888899999999751


No 107
>PTZ00338 dimethyladenosine transferase; Provisional
Probab=99.11  E-value=3.7e-10  Score=76.54  Aligned_cols=86  Identities=15%  Similarity=0.267  Sum_probs=70.3

Q ss_pred             HHHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC
Q ss_conf             24389985578999587843899999986799889999889899998899999806645222530200444235310000
Q gi|255764482|r    4 ASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL   83 (225)
Q Consensus         4 a~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~   83 (225)
                      +..+.+.+++.|||+|.|.|+++..++.+  ..+|++||+|+.++...++.....+   ..++++++++|+.....    
T Consensus        31 v~~a~~~~~d~VlEIGPG~G~LT~~Ll~~--~~~v~aiEiD~~l~~~L~~~~~~~~---~~~n~~ii~~D~Lk~d~----  101 (296)
T PTZ00338         31 VEKAAIKPTDTVLEIGPGTGNLTEKLLQL--AKKVIAIEIDPRMVAELKKRFQNSP---LASKLQVIEGDALKTEF----  101 (296)
T ss_pred             HHHCCCCCCCEEEEECCCCHHHHHHHHHC--CCCEEEEEECHHHHHHHHHHHHCCC---CCCCCEEECCHHHHCCC----
T ss_conf             99607898995799668542999999835--8917999948899999999985144---56673577050531856----


Q ss_pred             CCCCCCCCCEEEECCCCCCC
Q ss_conf             12357652057722654464
Q gi|255764482|r   84 AGLKNNFYDHVIMNPPFNER  103 (225)
Q Consensus        84 ~~~~~~~fDlii~nPPy~~~  103 (225)
                           ..||.+++|-||+-.
T Consensus       102 -----~~~~~vVaNLPY~IS  116 (296)
T PTZ00338        102 -----PYFDVCVANVPYQIS  116 (296)
T ss_pred             -----CCCCEEEECCCCHHH
T ss_conf             -----411446635870447


No 108
>smart00650 rADc Ribosomal RNA adenine dimethylases.
Probab=99.09  E-value=4.5e-10  Score=76.05  Aligned_cols=86  Identities=21%  Similarity=0.232  Sum_probs=69.2

Q ss_pred             HHHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC
Q ss_conf             24389985578999587843899999986799889999889899998899999806645222530200444235310000
Q gi|255764482|r    4 ASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL   83 (225)
Q Consensus         4 a~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~   83 (225)
                      ++.+...+++.|||+|+|.|.+|..|+++  ..+|+++|+|+.++...++....      ..+++++++|+......   
T Consensus         6 v~~a~~~~~d~VlEIGPG~G~LT~~Ll~~--~~~v~aiE~D~~l~~~L~~~~~~------~~n~~ii~~D~L~~~~~---   74 (169)
T smart00650        6 VRAANLRPGDTVLEIGPGKGALTEELLER--AARVTAIEIDPRLAPRLREKFAA------ADNLTVIHGDALKFDLP---   74 (169)
T ss_pred             HHHHCCCCCCEEEEECCCHHHHHHHHHHH--CCCCCEEECCHHHHHHHHHHHCC------CCCEEEEECCHHCCCCC---
T ss_conf             88638999497999689702999999973--16353163788999999986410------79779995711125531---


Q ss_pred             CCCCCCCCCEEEECCCCCCCC
Q ss_conf             123576520577226544644
Q gi|255764482|r   84 AGLKNNFYDHVIMNPPFNERI  104 (225)
Q Consensus        84 ~~~~~~~fDlii~nPPy~~~~  104 (225)
                          ......+++|.||+-..
T Consensus        75 ----~~~~~~iv~NLPY~Iss   91 (169)
T smart00650       75 ----KLQPYKVVGNLPYNIST   91 (169)
T ss_pred             ----CCCCCEEEECCCCCCHH
T ss_conf             ----15873699347630118


No 109
>KOG1122 consensus
Probab=99.07  E-value=5e-09  Score=70.14  Aligned_cols=163  Identities=12%  Similarity=0.141  Sum_probs=113.4

Q ss_pred             HHHCCCCCCCEEEEECCCHHHHHHHHHHHCCC-CEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCC
Q ss_conf             24389985578999587843899999986799-88999988989999889999980664522253020044423531000
Q gi|255764482|r    4 ASLVNATGSFHLADLGAGAGAAGLAVASRLHE-AQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRN   82 (225)
Q Consensus         4 a~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~-~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~   82 (225)
                      +.-+.+++|+||||+|+-.|+-+..+|.-..+ ..|++.|.+..-+...+.|+...+..+    ..+.+.|-..+.... 
T Consensus       234 v~aL~Pq~gERIlDmcAAPGGKTt~IAalMkn~G~I~AnD~n~~r~~~l~~n~~rlGv~n----tiv~n~D~~ef~~~~-  308 (460)
T KOG1122         234 VMALDPQPGERILDMCAAPGGKTTHIAALMKNTGVIFANDSNENRLKSLKANLHRLGVTN----TIVSNYDGREFPEKE-  308 (460)
T ss_pred             EEECCCCCCCEECCHHCCCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHCCCC----EEEECCCCCCCCCCC-
T ss_conf             452079988711212107995077899987277469961354377999998899748774----489736763255333-


Q ss_pred             CCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHH-----CCCCCCHHHHHHHHHHHCCCCCEEEE----ECCHHHHHHH
Q ss_conf             01235765205772265446446547885455652-----05668989999999986246983787----0288889999
Q gi|255764482|r   83 LAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAH-----VMLEDSFEKWIRTACAIMRSSGQLSL----IARPQSLIQI  153 (225)
Q Consensus        83 ~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~-----~~~~~~~~~~~~~a~~lLkpgG~~~~----i~~~~~l~~~  153 (225)
                          ..++||-|+-..|+...+-... ++.....+     ......+.+++.+|..++++||.+.+    |.+.++=. .
T Consensus       309 ----~~~~fDRVLLDAPCSGtgvi~K-~~~vkt~k~~~di~~~~~LQr~LllsAi~lv~~GGvLVYSTCSI~~~ENE~-v  382 (460)
T KOG1122         309 ----FPGSFDRVLLDAPCSGTGVISK-DQSVKTNKTVKDILRYAHLQRELLLSAIDLVKAGGVLVYSTCSITVEENEA-V  382 (460)
T ss_pred             ----CCCCCCEEEECCCCCCCCCCCC-CCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEECCHHHHHH-H
T ss_conf             ----6764231453487777755545-510133012999987279999999998731157708999853226012289-9


Q ss_pred             HHHHHCCCCCEEEEEECCCCCCCC
Q ss_conf             998521788469998145896983
Q gi|255764482|r  154 VNACARRIGSLEITPLHPREGECA  177 (225)
Q Consensus       154 l~~~~~~~~~~~i~~v~~~~~~~~  177 (225)
                      +...-.+.-..++.|..+..+.+.
T Consensus       383 V~yaL~K~p~~kL~p~~~~iG~~G  406 (460)
T KOG1122         383 VDYALKKRPEVKLVPTGLDIGGEG  406 (460)
T ss_pred             HHHHHHHCCCEEECCCCCCCCCCC
T ss_conf             999997098627525656678887


No 110
>PRK05785 hypothetical protein; Provisional
Probab=99.06  E-value=2.7e-09  Score=71.69  Aligned_cols=105  Identities=11%  Similarity=0.149  Sum_probs=73.8

Q ss_pred             CCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCC
Q ss_conf             99855789995878438999999867998899998898999988999998066452225302004442353100001235
Q gi|255764482|r    8 NATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLK   87 (225)
Q Consensus         8 ~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~   87 (225)
                      +.+++.+|||+|||||-++..+++   ..+++|+|.++.|++.|+...            ..+++|...       .+..
T Consensus        48 ~~~~~~~vLDva~GTGd~a~~l~~---~~~v~~~D~s~~ML~~a~~~~------------~~v~~~ae~-------LPf~  105 (225)
T PRK05785         48 DGKSPLKVLDAGAGPGNMAYHLRK---IRYVVALDYTEEMLRLNLVAD------------DKVVGSFEA-------MPFR  105 (225)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHC---CCEEEEEECCHHHHHHHHHCC------------CCEEEHHHH-------CCCC
T ss_conf             678888289956884399999634---786999988999999876432------------113731853-------9999


Q ss_pred             CCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHHHHHH
Q ss_conf             76520577226544644654788545565205668989999999986246983787028888999
Q gi|255764482|r   88 NNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQ  152 (225)
Q Consensus        88 ~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~~l~~  152 (225)
                      +++||.|.+.--..                  .-.+.+..+..+.|.+++.+.+-+-.|...+..
T Consensus       106 d~sFD~vt~~FglR------------------N~~d~~~al~E~~RVlk~~~iLe~s~P~~~~~r  152 (225)
T PRK05785        106 DKSFDLVMSGYALH------------------ASDDIEKAVAEFSRVSRYQVVVAIGKPDNVVAR  152 (225)
T ss_pred             CCCEEEEEEEEEEE------------------CCCCHHHHHHHHHHHCCCEEEEEECCCCCHHHH
T ss_conf             88252776344300------------------488899999999973097799996899847899


No 111
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase B; InterPro: IPR004573   This family consists of bacterial sequences related to Escherichia coli rsmB, an rRNA SAM-dependent methyltransferase. All, are likely to be functionally equivalent and based on comparison of core motifs would appear to belong to a larger superfamily of S-adenosyl-methionine (AdoMet)-dependent RNA m5C methyltransferases .    In E. coli, originally, the reading frame, encoding this protein, was interpreted as two reading frames, fmu and fmv. It has since been renamed, rsmB (Alternate Gene Symbols: rrmB, sun, fmu, fmv, yhdB). The recombinant protein, commonly referred to as Fmu, has been demonstrated to methylate only C967 of the 16S ribosomal RNA and to produce only m5C at that position. . The structure of the E. coli protein (Fmu) has been determined . Fmu contains three subdomains which share structural homology to DNA m5C methyltransferases and two RNA binding protein families. The N-terminal sequence of Fmu shares homology to another (noncatalytic) RNA binding protein, e.g. the ribosomal RNA antiterminator protein NusB (IPR011605 from INTERPRO). The catalytic lobe of Fmu, N1 domain, comprises the conserved core identified in all of the putative RNA m5C MTase sequences. Although the N1 domain is structurally homologous to known RNA binding proteins, there is no clear sequence motif that defines its role in RNA binding and recognition. At the functional centre of the catalytic lobe is the MTase domain of Fmu (residues 232-429), which adopts a fold typical of known AdoMet-dependent methyltransferases. In spite of the lack of a conserved RNA binding motif in the N1 domain, the close association of the N1 and MTase domains suggest that any RNA bound in the active site of the MTase domain is likely to interact with the N1 domain. ; GO: 0008649 rRNA methyltransferase activity, 0006364 rRNA processing.
Probab=99.06  E-value=3.1e-09  Score=71.32  Aligned_cols=146  Identities=15%  Similarity=0.179  Sum_probs=109.4

Q ss_pred             CHHHCCCCCCCEEEEECCCHHHHHHHHHHHCC-CCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCC
Q ss_conf             62438998557899958784389999998679-98899998898999988999998066452225302004442353100
Q gi|255764482|r    3 LASLVNATGSFHLADLGAGAGAAGLAVASRLH-EAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENR   81 (225)
Q Consensus         3 La~~~~~~~~~~VLDlGcG~G~~~l~la~r~~-~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~   81 (225)
                      -|.+.++++++.|||+|+-.|+-|.-++.-.+ .++|+++|++..-+..-..|....+...    +.+...|........
T Consensus       263 va~~L~P~~~E~iLD~CAAPGGKttHI~EL~~~~g~v~a~D~~~~rl~~~~~~~~RLGl~~----i~~~~~~~~~~~~~~  338 (487)
T TIGR00563       263 VATLLDPKNEETILDACAAPGGKTTHIAELMPDQGQVVALDLHKHRLKRVKENLDRLGLTI----IKVEEVDGDKAGPKE  338 (487)
T ss_pred             HHHHHCCCCCCEEEEEECCCCCHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHHHCCEE----EEEEEECCCCCCCCC
T ss_conf             9997388988747731148457047677424797208988621257889999998618837----887720256776654


Q ss_pred             CCCCCC--CCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCC----CCCHHHHHHHHHHHCCCCCEEEE----ECCHHHHH
Q ss_conf             001235--765205772265446446547885455652056----68989999999986246983787----02888899
Q gi|255764482|r   82 NLAGLK--NNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML----EDSFEKWIRTACAIMRSSGQLSL----IARPQSLI  151 (225)
Q Consensus        82 ~~~~~~--~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~----~~~~~~~~~~a~~lLkpgG~~~~----i~~~~~l~  151 (225)
                      +.....  ...||=|+-.-|+...|.+....+.+...+..+    ......++....-+||+||++.+    +.|.|+-.
T Consensus       339 W~~e~~ksaa~fDRiLlDaPCSg~GvirR~PD~kw~~~~~diA~L~~LQ~~iL~aiaP~vK~GGtLvYsTCt~~p~EN~~  418 (487)
T TIGR00563       339 WLAEVEKSAAQFDRILLDAPCSGTGVIRRHPDIKWLRKPADIARLAELQKEILKAIAPLVKKGGTLVYSTCTVLPEENEE  418 (487)
T ss_pred             CCCCCHHHHHHHCEEEECCCCCCCCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHH
T ss_conf             44520102333142156078774433001787555668565178999999999988565357975888614588443289


Q ss_pred             H
Q ss_conf             9
Q gi|255764482|r  152 Q  152 (225)
Q Consensus       152 ~  152 (225)
                      .
T Consensus       419 q  419 (487)
T TIGR00563       419 Q  419 (487)
T ss_pred             H
T ss_conf             9


No 112
>pfam03602 Cons_hypoth95 Conserved hypothetical protein 95.
Probab=99.04  E-value=2.9e-09  Score=71.50  Aligned_cols=108  Identities=19%  Similarity=0.219  Sum_probs=74.6

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             55789995878438999999867998899998898999988999998066452225302004442353100001235765
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNF   90 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~   90 (225)
                      ++.+|||+.||||.+++-...|- ..+|+.||.|+.++...++|++..+..+   + .+...+.....    ........
T Consensus        43 ~~~~~LDLFaGSGslglEAlSRG-A~~v~fvE~~~~a~~~i~~N~~~l~~~~---~-~~~~~~~~~~~----~~~~~~~~  113 (181)
T pfam03602        43 GGARVLDLFAGSGALGLEALSRG-ASSVVFVEKDKKAVATLKENLEALGLEG---A-VLRMDAARALL----RLAGKGPP  113 (181)
T ss_pred             CCCEEEECCCCCCHHHHHHHHCC-CCEEEEEECCHHHHHHHHHHHHHHCCCC---E-EEECCHHHHHH----HHCCCCCC
T ss_conf             89879982787269899999769-9889999699999999999999858997---7-99810899998----75335788


Q ss_pred             CCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHH--HHHCCCCCEEEEECC
Q ss_conf             20577226544644654788545565205668989999999--986246983787028
Q gi|255764482|r   91 YDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTA--CAIMRSSGQLSLIAR  146 (225)
Q Consensus        91 fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a--~~lLkpgG~~~~i~~  146 (225)
                      ||+|...|||...                   .....+...  ..+|+++|.+++-++
T Consensus       114 fdiIF~DPPY~~~-------------------~~~~~l~~l~~~~~l~~~~iiiiE~~  152 (181)
T pfam03602       114 FDLVFLDPPYAKG-------------------LIEEALELLAEKGWLNPNALIVVETE  152 (181)
T ss_pred             CCEEECCCCCCCH-------------------HHHHHHHHHHHCCCCCCCEEEEEEEC
T ss_conf             8766359975420-------------------69999999996666579809999966


No 113
>PRK00107 gidB glucose-inhibited division protein B; Reviewed
Probab=99.04  E-value=3.4e-08  Score=65.48  Aligned_cols=150  Identities=15%  Similarity=0.205  Sum_probs=100.4

Q ss_pred             CHHHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCC
Q ss_conf             62438998557899958784389999998679988999988989999889999980664522253020044423531000
Q gi|255764482|r    3 LASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRN   82 (225)
Q Consensus         3 La~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~   82 (225)
                      ++.+++..++.+|+|+|+|.|.=++.+|-.+|+.+++.+|....=+...+.-+...+..|    +++++..+.+..    
T Consensus        61 ~~~~~~~~~~~~vlDiGSGaGfPGiplAI~~p~~~~~Lves~~KK~~FL~~~~~~L~L~n----v~v~~~R~E~~~----  132 (216)
T PRK00107         61 LLPYLQGEKPIRVLDVGSGAGFPGIPLAIARPDLQVTLVDSLGKKIAFLRQVAAELGLKN----VTVVHGRAEEFG----  132 (216)
T ss_pred             HHHHCCCCCCCEEEECCCCCCCHHHHHHHHCCCCCEEEECHHHHHHHHHHHHHHHCCCCC----EEEEEHHHHCCC----
T ss_conf             987337665877997079999426789997787729997387699999999999769998----799863544046----


Q ss_pred             CCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHH---HHC
Q ss_conf             01235765205772265446446547885455652056689899999999862469837870288889999998---521
Q gi|255764482|r   83 LAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNA---CAR  159 (225)
Q Consensus        83 ~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~~l~~~l~~---~~~  159 (225)
                          ...+||+|++-                      --.....+++.+..++++||++.+.--+.-..|+-++   +..
T Consensus       133 ----~~~~fD~itsR----------------------Ava~l~~l~~~~~~~l~~~g~~i~~KG~~~~~Ei~~a~~~~~~  186 (216)
T PRK00107        133 ----QEEKFDVVTSR----------------------AVASLSDLVELCLPLLKPGGRFLALKGQDPEEEIAELPKAIKK  186 (216)
T ss_pred             ----CCCCCCEEEEE----------------------HHHCHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHHHH
T ss_conf             ----56786689860----------------------5406999999999754889799998799959999998989998


Q ss_pred             -CCCCEEEEEECCCCCCCCEEEEEEEEEC
Q ss_conf             -7884699981458969830999999977
Q gi|255764482|r  160 -RIGSLEITPLHPREGECASRILVTGRKG  187 (225)
Q Consensus       160 -~~~~~~i~~v~~~~~~~~~~vlv~~~k~  187 (225)
                       +.....+.. +..+.....|.+|..+|.
T Consensus       187 ~~~~~~~~~~-~~lp~~~~~R~iv~i~k~  214 (216)
T PRK00107        187 LGGKVESVIE-LKVPGLDGERHLVVIKKK  214 (216)
T ss_pred             CCCEEEEEEE-EECCCCCCEEEEEEEEEC
T ss_conf             3975999999-988999873899999955


No 114
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair]
Probab=99.04  E-value=2.6e-09  Score=71.79  Aligned_cols=114  Identities=17%  Similarity=0.229  Sum_probs=79.0

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             85578999587843899999986799889999889899998899999806645222530200444235310000123576
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNN   89 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~   89 (225)
                      -.|.++||+.+|+|++++-...|. ..+++.||.|..++...++|+...+   ...+..++..|........    ...+
T Consensus        42 i~g~~~LDlFAGSGaLGlEAlSRG-A~~~~~vE~~~~a~~~l~~N~~~l~---~~~~~~~~~~da~~~L~~~----~~~~  113 (187)
T COG0742          42 IEGARVLDLFAGSGALGLEALSRG-AARVVFVEKDRKAVKILKENLKALG---LEGEARVLRNDALRALKQL----GTRE  113 (187)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHCC-CCEEEEEECCHHHHHHHHHHHHHHC---CCCCEEEEEECHHHHHHHC----CCCC
T ss_conf             579889994687647689998578-8569999659899999999999848---7612599840089998722----7788


Q ss_pred             CCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHH-HHHHHHHCCCCCEEEEECCH
Q ss_conf             52057722654464465478854556520566898999-99999862469837870288
Q gi|255764482|r   90 FYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKW-IRTACAIMRSSGQLSLIARP  147 (225)
Q Consensus        90 ~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~-~~~a~~lLkpgG~~~~i~~~  147 (225)
                      .||+|...|||...-.                .....+ .-.-..+|+|+|.+++-++.
T Consensus       114 ~FDlVflDPPy~~~l~----------------~~~~~~~~~~~~~~L~~~~~iv~E~~~  156 (187)
T COG0742         114 PFDLVFLDPPYAKGLL----------------DKELALLLLEENGWLKPGALIVVEHDK  156 (187)
T ss_pred             CCCEEEECCCCCCCHH----------------HHHHHHHHHHHCCCCCCCCEEEEEECC
T ss_conf             5128996899753606----------------689999888765877889689998278


No 115
>PRK04457 spermidine synthase; Provisional
Probab=99.02  E-value=1.5e-08  Score=67.40  Aligned_cols=150  Identities=11%  Similarity=0.100  Sum_probs=98.7

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             85578999587843899999986799889999889899998899999806645222530200444235310000123576
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNN   89 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~   89 (225)
                      ...++||-+|=|.|.++-.+.+.+|+.+++.|||||..++.||+-...   ...+.+++++.+|-......      ..+
T Consensus        65 p~Pk~vl~iGLGgGsl~k~~~~~~P~~~i~~VEIdp~Vi~vAr~~F~l---P~dd~Rl~V~~~Dg~~fv~~------~~~  135 (262)
T PRK04457         65 PRPQHILQIGLGGGSFAKFIDTYLPDTRQTAVEINPQVIAVARNHFEL---PFEDEKFEIIEADGAEYIKV------FPA  135 (262)
T ss_pred             CCCCEEEEEECCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHCCC---CCCCCCEEEEECCHHHHHHH------CCC
T ss_conf             997869999257019999999839867589998788999999986579---99997269995538999854------867


Q ss_pred             CCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEEC--CHHHHHHHHHHHHCCCCCEEEE
Q ss_conf             52057722654464465478854556520566898999999998624698378702--8888999999852178846999
Q gi|255764482|r   90 FYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIA--RPQSLIQIVNACARRIGSLEIT  167 (225)
Q Consensus        90 ~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~--~~~~l~~~l~~~~~~~~~~~i~  167 (225)
                      +||+|+..--  ...+            ........+|.+.+.+.|+|+|.+++=.  ........+..+...+...-+.
T Consensus       136 ~~DvI~vD~f--d~~g------------~~~~L~t~~Fy~~c~~~L~~~Gvlv~Nl~~~~~~~~~~l~~i~~~F~~~~~~  201 (262)
T PRK04457        136 STDVILVDGF--DGEQ------------IVDALVTQPFFRDCRNALSSDGVFVTNLWSGDKRYQRYIERLLSVFEGRVLE  201 (262)
T ss_pred             CCCEEEEECC--CCCC------------CCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHCCEEEE
T ss_conf             7788999688--9888------------8600082999999998649893999986889986599999999972873999


Q ss_pred             EECCCCCCCCEEEEEEEE
Q ss_conf             814589698309999999
Q gi|255764482|r  168 PLHPREGECASRILVTGR  185 (225)
Q Consensus       168 ~v~~~~~~~~~~vlv~~~  185 (225)
                         -....+.+.|++-++
T Consensus       202 ---~~~~~~GN~Iv~A~k  216 (262)
T PRK04457        202 ---LPAESHGNVAVFAFQ  216 (262)
T ss_pred             ---EECCCCCEEEEEEEC
T ss_conf             ---725899808999978


No 116
>PRK00274 ksgA dimethyladenosine transferase; Reviewed
Probab=99.01  E-value=1.2e-09  Score=73.65  Aligned_cols=85  Identities=21%  Similarity=0.232  Sum_probs=66.4

Q ss_pred             HHHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC
Q ss_conf             24389985578999587843899999986799889999889899998899999806645222530200444235310000
Q gi|255764482|r    4 ASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL   83 (225)
Q Consensus         4 a~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~   83 (225)
                      +..+...+++.|+|+|+|.|++|-.++++  +.++++||+|+.+++..++.          .+++++++|+........ 
T Consensus        32 v~~~~~~~~d~VlEIGpG~G~LT~~Ll~~--~~~v~aiEiD~~l~~~L~~~----------~~~~ii~~D~L~~~~~~~-   98 (267)
T PRK00274         32 VRAADLQPGDRVLEIGPGLGALTEPLLER--AAKVTAIEIDRDLAPILRET----------DNLTIIEGDALKVDLEEL-   98 (267)
T ss_pred             HHHCCCCCCCEEEEECCCCCHHHHHHHHH--CCCEEEEECCHHHHHHHHHC----------CCEEEEECHHHHCCHHHH-
T ss_conf             99608999990799638888899999962--68058863688999998504----------786999650664786774-


Q ss_pred             CCCCCCCCCEEEECCCCCCCC
Q ss_conf             123576520577226544644
Q gi|255764482|r   84 AGLKNNFYDHVIMNPPFNERI  104 (225)
Q Consensus        84 ~~~~~~~fDlii~nPPy~~~~  104 (225)
                         .......|++|.||+-.+
T Consensus        99 ---~~~~~~~vvgNLPY~Iss  116 (267)
T PRK00274         99 ---AEGQPLKVVANLPYNIST  116 (267)
T ss_pred             ---CCCCCEEEEECCCCHHHH
T ss_conf             ---567872799558830312


No 117
>PRK06922 hypothetical protein; Provisional
Probab=99.01  E-value=7.5e-10  Score=74.81  Aligned_cols=119  Identities=13%  Similarity=0.188  Sum_probs=84.2

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             85578999587843899999986799889999889899998899999806645222530200444235310000123576
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNN   89 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~   89 (225)
                      -.|++++|+|.|.|++.-++..+.|+.+++|+|+|...++..++.-...     ...+++.++|..+....+     ..+
T Consensus       419 i~G~~ivdiG~GGGVMldli~E~~p~~~i~GIDiS~NVIe~L~kkK~~e-----~ksW~V~~gDAL~l~d~f-----~~e  488 (679)
T PRK06922        419 IKGDTIVDVGAGGGVMLDMIEEETEDKRIYGIDISENVIDTLKKKKQNE-----GRSWNVIKGDAINLSSSF-----EKE  488 (679)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHCCCCCCEEEECCHHHHHHHHHHHHHC-----CCCCEEECCCCCCCHHHC-----CCC
T ss_conf             1476799866996214876676589986146666088999998877754-----898423214303615434-----756


Q ss_pred             CCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEE
Q ss_conf             520577226544644654788545565205668989999999986246983787
Q gi|255764482|r   90 FYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSL  143 (225)
Q Consensus        90 ~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~  143 (225)
                      +.|-|++..-.+..-+-...+..     -.........+..+.+.|||||+..+
T Consensus       489 SvdTiv~sSIlHElfSYie~dGk-----kfN~~vi~~~l~Saf~vLkpGGRiII  537 (679)
T PRK06922        489 SVDTIVYSSILHELFSYIEYEGK-----KFNHEVIKKGLQSAYEVLKPGGRIII  537 (679)
T ss_pred             CCCEEEEHHHHHHHHHHCCCCCC-----CCCHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             66468742778888863456671-----34799999999999987288864999


No 118
>pfam01728 FtsJ FtsJ-like methyltransferase. This family consists of FtsJ from various bacterial and archaeal sources FtsJ is a methyltransferase, but actually has no effect on cell division. FtsJ's substrate is the 23S rRNA. The 1.5 A crystal structure of FtsJ in complex with its cofactor S-adenosylmethionine revealed that FtsJ has a methyltransferase fold. This family also includes the N terminus of flaviviral NS5 protein. It has been hypothesized that the N-terminal domain of NS5 is a methyltransferase involved in viral RNA capping.
Probab=99.00  E-value=5.7e-09  Score=69.83  Aligned_cols=134  Identities=14%  Similarity=0.150  Sum_probs=85.6

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             85578999587843899999986799889999889899998899999806645222530200444235310000123576
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNN   89 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~   89 (225)
                      +++..|||+||++|+++..+.++.+..+++|||+.+..               ....+.++++|+..............+
T Consensus        20 ~~~~~vlDLg~aPGgwsq~~~~~~~~~~v~~vDl~~~~---------------~~~~~~~i~gDi~~~~~~~~i~~~~~~   84 (176)
T pfam01728        20 PGGKTVLDLGAAPGGFSQVLLERGAKGRVVAVDLGPMK---------------PIQGVTFLRGDITDPETLEKLLELLPG   84 (176)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHCCCCEEEEEECCCCC---------------CCCCCEEECCCCCCHHHHHHHHHHCCC
T ss_conf             79999999689997699999985668739999734465---------------677845651676687899999997399


Q ss_pred             CCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEE-ECCHHHHH-HHHHHHHCCCCCEE
Q ss_conf             520577226544644654788545565205668989999999986246983787-02888899-99998521788469
Q gi|255764482|r   90 FYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSL-IARPQSLI-QIVNACARRIGSLE  165 (225)
Q Consensus        90 ~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~-i~~~~~l~-~~l~~~~~~~~~~~  165 (225)
                      .+|+|++.--....+. ...+.. .     .......-+..+.+.|++||.+.+ ++...... +++..+...+..+.
T Consensus        85 ~~DlV~sD~a~~~~g~-~~~d~~-~-----s~~L~~~~l~~a~~~L~~gG~fv~K~f~~~~~~~~l~~~l~~~F~~v~  155 (176)
T pfam01728        85 KVDLVLCDGAPNVSGL-ENTDSF-I-----SLRLVLAALLLALEVLRPGGNFVVKLFKGFEFSVELLYKLKKGFEKVG  155 (176)
T ss_pred             CCCEEEECCCCCCCCC-CCHHHH-H-----HHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCHHHHHHHHHHCCCEEE
T ss_conf             8468973366565677-334789-9-----999999999999998243763999998278764999999983178899


No 119
>KOG1541 consensus
Probab=99.00  E-value=7e-09  Score=69.32  Aligned_cols=147  Identities=19%  Similarity=0.184  Sum_probs=87.0

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             55789995878438999999867998899998898999988999998066452225302004442353100001235765
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNF   90 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~   90 (225)
                      ++.-|||+|||+|..+-.+...  +-..+|+|+||.|++.|... +..        -.++.+|.-.      -..++.++
T Consensus        50 ~~~~iLDIGCGsGLSg~vL~~~--Gh~wiGvDiSpsML~~a~~~-e~e--------gdlil~DMG~------GlpfrpGt  112 (270)
T KOG1541          50 KSGLILDIGCGSGLSGSVLSDS--GHQWIGVDISPSMLEQAVER-ELE--------GDLILCDMGE------GLPFRPGT  112 (270)
T ss_pred             CCCEEEEECCCCCCCHHEECCC--CCEEEEECCCHHHHHHHHHH-HHH--------CCEEEEECCC------CCCCCCCC
T ss_conf             8717998345777432002168--95588622898999999976-640--------4766312478------87889974


Q ss_pred             CCEEEECC--CCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHH---HHHHHH-HHHHCCCC-C
Q ss_conf             20577226--54464465478854556520566898999999998624698378702888---899999-98521788-4
Q gi|255764482|r   91 YDHVIMNP--PFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQ---SLIQIV-NACARRIG-S  163 (225)
Q Consensus        91 fDlii~nP--Py~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~---~l~~~l-~~~~~~~~-~  163 (225)
                      ||-+|+--  .|.+......-++.+         .+..|+......|+.|++..+-+-++   +++.+. .++..+++ -
T Consensus       113 FDg~ISISAvQWLcnA~~s~~~P~~---------Rl~~FF~tLy~~l~rg~raV~QfYpen~~q~d~i~~~a~~aGF~GG  183 (270)
T KOG1541         113 FDGVISISAVQWLCNADKSLHVPKK---------RLLRFFGTLYSCLKRGARAVLQFYPENEAQIDMIMQQAMKAGFGGG  183 (270)
T ss_pred             CCEEEEEEEEEEECCCCCCCCCHHH---------HHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHCCCCC
T ss_conf             1247886203210146844467389---------9999866453210368615888524546799999999886134784


Q ss_pred             EEEEEECCCCCCCCEEEEEE
Q ss_conf             69998145896983099999
Q gi|255764482|r  164 LEITPLHPREGECASRILVT  183 (225)
Q Consensus       164 ~~i~~v~~~~~~~~~~vlv~  183 (225)
                      ..+-.=.+...++..+||..
T Consensus       184 lvVd~Pes~k~kK~yLVL~~  203 (270)
T KOG1541         184 LVVDWPESTKNKKYYLVLMT  203 (270)
T ss_pred             EEEECCCCCCCCEEEEEEEC
T ss_conf             36646110134305899832


No 120
>KOG1499 consensus
Probab=98.99  E-value=3.3e-09  Score=71.18  Aligned_cols=106  Identities=16%  Similarity=0.190  Sum_probs=75.9

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             85578999587843899999986799889999889899998899999806645222530200444235310000123576
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNN   89 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~   89 (225)
                      -++..|||+|||+|.+|+..|+.. ..+|+|||.+..+ +.|++.+..|+   .++.++++++.+....       .+.+
T Consensus        59 f~dK~VlDVGcGtGILS~F~akAG-A~~V~aVe~S~ia-~~a~~iv~~N~---~~~ii~vi~gkvEdi~-------LP~e  126 (346)
T KOG1499          59 FKDKTVLDVGCGTGILSMFAAKAG-ARKVYAVEASSIA-DFARKIVKDNG---LEDVITVIKGKVEDIE-------LPVE  126 (346)
T ss_pred             CCCCEEEECCCCCCHHHHHHHHHC-CCEEEEEECHHHH-HHHHHHHHHCC---CCCEEEEEECCEEEEE-------CCCC
T ss_conf             079789975788128899988737-5339999626899-99999998568---6605999503057876-------4755


Q ss_pred             CCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEE
Q ss_conf             52057722654464465478854556520566898999999998624698378
Q gi|255764482|r   90 FYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLS  142 (225)
Q Consensus        90 ~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~  142 (225)
                      +.|.|++.=-              ..+. -....++..+-+--+.|+|||.++
T Consensus       127 KVDiIvSEWM--------------Gy~L-l~EsMldsVl~ARdkwL~~~G~i~  164 (346)
T KOG1499         127 KVDIIVSEWM--------------GYFL-LYESMLDSVLYARDKWLKEGGLIY  164 (346)
T ss_pred             CEEEEEEHHH--------------HHHH-HHHHHHHHHHHHHHHCCCCCCEEC
T ss_conf             4029963012--------------4787-776566645533330047795576


No 121
>PRK12335 tellurite resistance protein TehB; Provisional
Probab=98.97  E-value=4e-09  Score=70.72  Aligned_cols=106  Identities=12%  Similarity=0.080  Sum_probs=79.5

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             85578999587843899999986799889999889899998899999806645222530200444235310000123576
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNN   89 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~   89 (225)
                      -++.++||+|||.|.-++.||..  |.+|+|+|+++.+++..+.-+...+.     .++....|+....        ..+
T Consensus       121 i~pgkaLDLGCG~GRNsLyLa~~--GfdVTA~D~N~~sl~~L~~ia~~E~L-----~i~~~~yDIN~a~--------l~~  185 (289)
T PRK12335        121 VKPGKALDLGCGQGRNSLYLALL--GFDVTAVDINQASLENLQQIAEKENL-----NIRAGSYDINSAS--------LQE  185 (289)
T ss_pred             CCCCCEEEECCCCCCCHHHHHHC--CCCEEEEECCHHHHHHHHHHHHHCCC-----CCCCEEECCCCCC--------CCC
T ss_conf             68874666047888227889757--98425886899999999999997198-----8772575166666--------677


Q ss_pred             CCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECC
Q ss_conf             520577226544644654788545565205668989999999986246983787028
Q gi|255764482|r   90 FYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIAR  146 (225)
Q Consensus        90 ~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~  146 (225)
                      .||+|++---++..                ......+++..+...-.|||.-.+|..
T Consensus       186 ~YDfI~STVV~mFL----------------~~~~ip~iI~nMQ~~T~~gGyNlIV~a  226 (289)
T PRK12335        186 EYDFILSTVVLMFL----------------NPERIPDIIKNMQEHTNPGGYNLIVCA  226 (289)
T ss_pred             CCCEEEEEEEEEEE----------------CHHHHHHHHHHHHHHCCCCCEEEEEEE
T ss_conf             76789996788642----------------877869999999984479986899987


No 122
>pfam00398 RrnaAD Ribosomal RNA adenine dimethylase.
Probab=98.96  E-value=4.3e-09  Score=70.51  Aligned_cols=86  Identities=24%  Similarity=0.272  Sum_probs=68.0

Q ss_pred             HHHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC
Q ss_conf             24389985578999587843899999986799889999889899998899999806645222530200444235310000
Q gi|255764482|r    4 ASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL   83 (225)
Q Consensus         4 a~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~   83 (225)
                      +..+++.+++.|||+|.|.|.+|..|+.+  ..+++++|+|+..++..++....      ..+++++++|+..+...   
T Consensus        23 v~~~~~~~~d~VlEIGPG~G~LT~~L~~~--~~~v~aiE~D~~l~~~L~~~~~~------~~~~~ii~~D~l~~d~~---   91 (258)
T pfam00398        23 VDKANLQESDTVLEIGPGKGALTEELAKR--AKQVVAIEIDPRLAKRLQKKLAL------HPNVEVVHQDFLKFSFP---   91 (258)
T ss_pred             HHHCCCCCCCEEEEECCCHHHHHHHHHHC--CCCEEEEECCHHHHHHHHHHHCC------CCCEEEEECCHHCCCCC---
T ss_conf             99708999997999799623999999961--69479995447799999986442------89779996630105754---


Q ss_pred             CCCCCCCCCEEEECCCCCCCC
Q ss_conf             123576520577226544644
Q gi|255764482|r   84 AGLKNNFYDHVIMNPPFNERI  104 (225)
Q Consensus        84 ~~~~~~~fDlii~nPPy~~~~  104 (225)
                          ...--.|++|.||+-..
T Consensus        92 ----~~~~~~vvgNLPY~Iss  108 (258)
T pfam00398        92 ----KHEPFLVVGNIPYNITT  108 (258)
T ss_pred             ----CCCCEEEEECCCCCCCH
T ss_conf             ----57861689448863417


No 123
>TIGR00536 hemK_fam methyltransferase, HemK family; InterPro: IPR004556 The gene hemK from Escherichia coli was found to contribute to heme biosynthesis and originally suggested to be protoporphyrinogen oxidase . Functional analysis of the nearest homolog in Saccharomyces cerevisiae, YNL063w, finds it is not protoporphyrinogen oxidase and sequence analysis suggests that HemK homologs have S-adenosyl-methionine-dependent methyltransferase activity . Homologs are found, usually in a single copy, in nearly all completed genomes, but varying somewhat in apparent domain architecture. Both Escherichia coli and Haemophilus influenzae have two members rather than one. The members from the Mycoplasmas have an additional C-terminal domain.; GO: 0008276 protein methyltransferase activity, 0006479 protein amino acid methylation.
Probab=98.96  E-value=4.1e-09  Score=70.63  Aligned_cols=134  Identities=19%  Similarity=0.226  Sum_probs=97.9

Q ss_pred             CEEEEECCCHHHHHHHHHHHCC--CCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC-
Q ss_conf             7899958784389999998679--9889999889899998899999806645222530200444235310000123576-
Q gi|255764482|r   13 FHLADLGAGAGAAGLAVASRLH--EAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNN-   89 (225)
Q Consensus        13 ~~VLDlGcG~G~~~l~la~r~~--~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~-   89 (225)
                      .+++|+|||+|++++.++...+  ...+.++|+++.++..++.|+..+..   ..++.+.+.++......      ... 
T Consensus       128 ~~~~d~~~g~g~~~~~~~~~~~pc~~~~~~~d~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~------~~~p  198 (311)
T TIGR00536       128 LHILDLGTGSGCIALALAYEFPPCNAEVIAVDLSPDALALAEENAEKLGL---EGRVELLQSDLLEPLPG------LGGP  198 (311)
T ss_pred             CHHHHCCCCCHHHHHHHHHCCCCCCCEEEEECCCHHHHHHHHHHHHHHHH---HCCCEEEHHHHHHHHHH------CCCC
T ss_conf             01110145631566655430466662266411223678888876776432---01200101124443320------3665


Q ss_pred             CCCEEEECCCCCCCCCCCCC--CHHHHHHHC-------CCCCCHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHH
Q ss_conf             52057722654464465478--854556520-------5668989999999986246983787028888999999
Q gi|255764482|r   90 FYDHVIMNPPFNERIGTMTP--DKIKEEAHV-------MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVN  155 (225)
Q Consensus        90 ~fDlii~nPPy~~~~~~~~~--~~~~~~a~~-------~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~~l~~~l~  155 (225)
                      .+|++++||||.........  .........       ........++..+...+.++|.+.+-+-.++...+..
T Consensus       199 ~~~~~~~~ppy~~~~~~~~~~~~~~~~~p~~~l~~~g~~g~~~~~~~~~~~~~~~~~~g~~~~~~g~~~~~~~~~  273 (311)
T TIGR00536       199 KLDLLVSNPPYIDEEDLADLSPGVVLFEPLLALVGFGDDGLKILKRILELAPDYLKPGGFLLLEIGNWQLGLLKE  273 (311)
T ss_pred             CEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHH
T ss_conf             223664588654413455531123432003454304740078999998754543056755899616223567787


No 124
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase; InterPro: IPR014122   MenG is a generic term for a methyltransferase that catalyses the last step in menaquinone biosynthesis; the exact enzymatic activity differs for different MenG because the menaquinone differ in their prenoid side chains in different species. Members of this MenG protein family are 2-heptaprenyl-1,4-naphthoquinone methyltransferase, and are found together in operons with the two subunits of the heptaprenyl diphosphate synthase in Bacillus subtilis and related species..
Probab=98.96  E-value=3.7e-09  Score=70.89  Aligned_cols=113  Identities=12%  Similarity=0.164  Sum_probs=87.2

Q ss_pred             HHCCCCCCCEEEEECCCHHHHHHHHHHHCC-CCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC
Q ss_conf             438998557899958784389999998679-9889999889899998899999806645222530200444235310000
Q gi|255764482|r    5 SLVNATGSFHLADLGAGAGAAGLAVASRLH-EAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL   83 (225)
Q Consensus         5 ~~~~~~~~~~VLDlGcG~G~~~l~la~r~~-~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~   83 (225)
                      ..++++.|..+||+|||++-.++.++.... ..+|.|+|.++.|+..+++.+......    ++.+.+++....+     
T Consensus        39 ~~m~v~~G~~~ldvCCGt~dW~~~l~~~~G~~G~v~Gldfs~nml~~~~~k~~~~~~~----~~~l~hGnam~lP-----  109 (231)
T TIGR02752        39 KRMNVQKGKKALDVCCGTADWAIALAEAVGKEGEVKGLDFSENMLSVGKQKVKDAKLS----NVELVHGNAMELP-----  109 (231)
T ss_pred             HHHHHHHCCHHHHHCCCCHHHHHHHHHHHCCCCCEEEEHHHHHHHHHHHHHHHHHHHH----HEEEECCCHHCCC-----
T ss_conf             7765640412112103733788898886177771674003588999999888754320----0222305200178-----


Q ss_pred             CCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECC
Q ss_conf             123576520577226544644654788545565205668989999999986246983787028
Q gi|255764482|r   84 AGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIAR  146 (225)
Q Consensus        84 ~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~  146 (225)
                        ..+++||.|.--.-.                  ....++...++.+.|..||||.+.++-.
T Consensus       110 --~~~~~fdyvtiGfGl------------------rnvPdy~~vl~em~rv~kPGG~~~C~~t  152 (231)
T TIGR02752       110 --YDDNSFDYVTIGFGL------------------RNVPDYMTVLKEMARVVKPGGKVVCLET  152 (231)
T ss_pred             --CCCCCCCEEEECCCC------------------CCHHHHHHHHHHHHHHHCCCCCEEEEEC
T ss_conf             --776661257752551------------------2302699999998886279971798625


No 125
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only]
Probab=98.95  E-value=1.2e-09  Score=73.69  Aligned_cols=102  Identities=18%  Similarity=0.212  Sum_probs=70.2

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             85578999587843899999986799889999889899998899999806645222530200444235310000123576
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNN   89 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~   89 (225)
                      .+-.++||+|||||..+..+-.+  ..+++|||+|..|++.|.+.-         ..-...++|...+     +.....+
T Consensus       124 g~F~~~lDLGCGTGL~G~~lR~~--a~~ltGvDiS~nMl~kA~eKg---------~YD~L~~Aea~~F-----l~~~~~e  187 (287)
T COG4976         124 GPFRRMLDLGCGTGLTGEALRDM--ADRLTGVDISENMLAKAHEKG---------LYDTLYVAEAVLF-----LEDLTQE  187 (287)
T ss_pred             CCCCEEEECCCCCCCCCHHHHHH--HHHCCCCCHHHHHHHHHHHCC---------CHHHHHHHHHHHH-----HHHCCCC
T ss_conf             76202344266767662767888--865127762699999988624---------1578889899987-----5522677


Q ss_pred             CCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             52057722654464465478854556520566898999999998624698378702
Q gi|255764482|r   90 FYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIA  145 (225)
Q Consensus        90 ~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~  145 (225)
                      .||+|.+.--+                  .-...++.++..+..+|+|||.+.|..
T Consensus       188 r~DLi~AaDVl------------------~YlG~Le~~~~~aa~~L~~gGlfaFSv  225 (287)
T COG4976         188 RFDLIVAADVL------------------PYLGALEGLFAGAAGLLAPGGLFAFSV  225 (287)
T ss_pred             CCCCHHHHHHH------------------HHHCCHHHHHHHHHHHCCCCCEEEEEE
T ss_conf             64301245678------------------864003468999998558986489872


No 126
>PRK06202 hypothetical protein; Provisional
Probab=98.95  E-value=6.9e-09  Score=69.37  Aligned_cols=80  Identities=16%  Similarity=0.243  Sum_probs=56.7

Q ss_pred             CCCCCEEEEECCCHHHHHHHHHHHC----CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC
Q ss_conf             9855789995878438999999867----998899998898999988999998066452225302004442353100001
Q gi|255764482|r    9 ATGSFHLADLGAGAGAAGLAVASRL----HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA   84 (225)
Q Consensus         9 ~~~~~~VLDlGcG~G~~~l~la~r~----~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~   84 (225)
                      ....-+|||+|||.|-++..+|+..    ...+++|+|++|.+++.|+++.+..+     ..+++...|...        
T Consensus        59 ~~r~~~VLDlGcG~Gdl~~~lar~a~~~g~~l~v~GiD~~~~ai~~Ar~~a~~~~-----~~~~~~~~d~l~--------  125 (233)
T PRK06202         59 PDRPLTVLDLGCGGGDLAIDLARWARRDGLRLEVTAIDPDPRAIRFARANARRRG-----VTFRFAVSDELV--------  125 (233)
T ss_pred             CCCCEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEEECCCHHHHHHHHHHCCCCC-----CCEEEEEHHHHC--------
T ss_conf             7887289983478757999999999755996389997798899999987340369-----836997343202--------


Q ss_pred             CCCCCCCCEEEECCCCCC
Q ss_conf             235765205772265446
Q gi|255764482|r   85 GLKNNFYDHVIMNPPFNE  102 (225)
Q Consensus        85 ~~~~~~fDlii~nPPy~~  102 (225)
                       ...++||+|+||--.|+
T Consensus       126 -~~~~~~DvV~~sl~LHH  142 (233)
T PRK06202        126 -AEGERFDVVYSNHFLHH  142 (233)
T ss_pred             -CCCCCCCEEEHHHHHHC
T ss_conf             -45788757603246864


No 127
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB; InterPro: IPR011825    This family consists of RNA methyltransferases designated RumB, formerly YbjF. Members act on 23S rRNA U747 and the equivalent position in other proteobacterial species. This family is homologous to the other 23S rRNA methyltransferase RumA and to the tRNA methyltransferase TrmA .; GO: 0016436 rRNA (uridine) methyltransferase activity, 0016070 RNA metabolic process.
Probab=98.94  E-value=1e-09  Score=74.06  Aligned_cols=134  Identities=13%  Similarity=0.131  Sum_probs=85.8

Q ss_pred             CCCCEEEEECCCHHHHHHHHH----HHC-CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC
Q ss_conf             855789995878438999999----867-998899998898999988999998066452225302004442353100001
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVA----SRL-HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA   84 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la----~r~-~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~   84 (225)
                      -+-...=|+.||.|++++-.|    .++ |+.++|||||++++|+.|++.+...|..+    +.|-.-|-..+..     
T Consensus       236 ~~~~~mWDLFCGVGGFgLHCAkalqekw~p~~~lTGIEI~~eAIa~A~~SA~~lGl~~----~~F~aLDsa~f~~-----  306 (386)
T TIGR02085       236 LPVKQMWDLFCGVGGFGLHCAKALQEKWGPDTQLTGIEIESEAIACAKQSAKILGLEN----LSFAALDSAKFAT-----  306 (386)
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCEEEEEEEECHHHHHHHHHHHHHHCHHH----HHHHHHHHHHHHH-----
T ss_conf             5711032010465412789989876415897044313437789999999998735332----1045445799998-----


Q ss_pred             CCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHCCCCCE
Q ss_conf             23576520577226544644654788545565205668989999999986246983787028888999999852178846
Q gi|255764482|r   85 GLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSL  164 (225)
Q Consensus        85 ~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~~l~~~l~~~~~~~~~~  164 (225)
                      ......-|+|+.|||=-                 +.-..+.+++    ..+.|.=.+|=-+.++-..-=+..+ ..+...
T Consensus       307 ~~~e~~PeLVlVNPPRR-----------------GiG~eL~~~L----~~~aP~fILYSSCNa~TM~KDi~~L-~~Y~~~  364 (386)
T TIGR02085       307 AQAESVPELVLVNPPRR-----------------GIGKELCDYL----SQLAPKFILYSSCNAQTMAKDIAEL-SGYKIE  364 (386)
T ss_pred             HHCCCCCCEEEECCCCC-----------------CCCHHHHHHH----HHCCCCEEEECCCCHHHHHHHHHHC-CCCCEE
T ss_conf             62368896577678888-----------------8760689999----7508862662167722589999755-688357


Q ss_pred             EEEEECCCCC
Q ss_conf             9998145896
Q gi|255764482|r  165 EITPLHPREG  174 (225)
Q Consensus       165 ~i~~v~~~~~  174 (225)
                      +|+-+.-++.
T Consensus       365 rvQlFDMFPh  374 (386)
T TIGR02085       365 RVQLFDMFPH  374 (386)
T ss_pred             EEEEECCCCC
T ss_conf             7653307898


No 128
>KOG1500 consensus
Probab=98.94  E-value=6.4e-09  Score=69.56  Aligned_cols=104  Identities=23%  Similarity=0.251  Sum_probs=77.4

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             55789995878438999999867998899998898999988999998066452225302004442353100001235765
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNF   90 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~   90 (225)
                      .+..|||+|||+|++++..|+. ...+|++||.+ .|.+.|++-++-|   +..+|+.++.+.++++..        .++
T Consensus       177 ~~kiVlDVGaGSGILS~FAaqA-GA~~vYAvEAS-~MAqyA~~Lv~~N---~~~~rItVI~GKiEdieL--------PEk  243 (517)
T KOG1500         177 QDKIVLDVGAGSGILSFFAAQA-GAKKVYAVEAS-EMAQYARKLVASN---NLADRITVIPGKIEDIEL--------PEK  243 (517)
T ss_pred             CCCEEEEECCCCCHHHHHHHHH-CCCEEEEEEHH-HHHHHHHHHHHCC---CCCCEEEECCCCCCEECC--------CCC
T ss_conf             7748998158824899999873-86538987456-7999999987436---632037870563201037--------510


Q ss_pred             CCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEE
Q ss_conf             20577226544644654788545565205668989999999986246983787
Q gi|255764482|r   91 YDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSL  143 (225)
Q Consensus        91 fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~  143 (225)
                      .|.+|+.|--...     -+.+          .++ ---+|++.|+|.|.++.
T Consensus       244 ~DviISEPMG~mL-----~NER----------MLE-sYl~Ark~l~P~GkMfP  280 (517)
T KOG1500         244 VDVIISEPMGYML-----VNER----------MLE-SYLHARKWLKPNGKMFP  280 (517)
T ss_pred             CCEEEECCCHHHH-----HHHH----------HHH-HHHHHHHHCCCCCCCCC
T ss_conf             3478725621411-----1088----------899-99999874287774467


No 129
>TIGR00477 tehB tellurite resistance protein TehB; InterPro: IPR004537   Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB. When present in high copy number, TehB is responsible for potassium tellurite resistance, probably by increasing the reduction rate of tellurite to metallic tellurium within the bacterium. TehB is a cytoplasmic protein which possesses three conserved motifs (I, II, and III) found in S-adenosyl-L-methionine (SAM)-dependent non-nucleic acid methyltransferases . Conformational changes in TehB are observed upon binding of both tellurite and SAM, suggesting that TehB utilises a methyltransferase activity in the detoxification of tellurite.; GO: 0008757 S-adenosylmethionine-dependent methyltransferase activity, 0046690 response to tellurium ion, 0005737 cytoplasm.
Probab=98.94  E-value=3.3e-09  Score=71.16  Aligned_cols=109  Identities=12%  Similarity=0.079  Sum_probs=78.1

Q ss_pred             HCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCC
Q ss_conf             38998557899958784389999998679988999988989999889999980664522253020044423531000012
Q gi|255764482|r    6 LVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAG   85 (225)
Q Consensus         6 ~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~   85 (225)
                      -+++-++.++||+|||.|--||.|+..  |..|.++|-|+.+++...+-.....++++.    -...|+...        
T Consensus        68 Avk~v~PcKtLDLGCGqGrNsLyLsl~--GYDV~awD~n~~siA~v~~~k~~EnL~nl~----t~~yDiNaa--------  133 (239)
T TIGR00477        68 AVKVVKPCKTLDLGCGQGRNSLYLSLA--GYDVDAWDHNEASIASVEEIKEKENLDNLR----TDVYDINAA--------  133 (239)
T ss_pred             HHHCCCCCCEEECCCCCCHHHHHHHHH--CCCCEEECCCHHHHHHHHHHHHHHCCCCHH----HHHHHHHHH--------
T ss_conf             550237986532688885378999761--684101216866887599888762671100----465543355--------


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             35765205772265446446547885455652056689899999999862469837870
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLI  144 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i  144 (225)
                      ...+.||+|++---|.......                ...+|+.+.+.-||||.-.+|
T Consensus       134 ~~~e~YDFI~sTVVf~FL~a~r----------------vP~iIanMq~hT~pGGYNLIV  176 (239)
T TIGR00477       134 ALDEDYDFILSTVVFMFLEAER----------------VPEIIANMQEHTKPGGYNLIV  176 (239)
T ss_pred             HCCCCCCEEEEEHHHHHHCCCC----------------CHHHHHHHHHHCCCCCCEEEE
T ss_conf             4012787421020122105887----------------726788658746798732223


No 130
>KOG0820 consensus
Probab=98.92  E-value=6.1e-09  Score=69.64  Aligned_cols=84  Identities=14%  Similarity=0.210  Sum_probs=69.8

Q ss_pred             HHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC
Q ss_conf             43899855789995878438999999867998899998898999988999998066452225302004442353100001
Q gi|255764482|r    5 SLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA   84 (225)
Q Consensus         5 ~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~   84 (225)
                      .-++.++++.|||+|-|||.++..+-..  +.+|+++|+||.|++...+.+..   ...+.++.++++|+...+      
T Consensus        52 ~ka~~k~tD~VLEvGPGTGnLT~~lLe~--~kkVvA~E~Dprmvael~krv~g---tp~~~kLqV~~gD~lK~d------  120 (315)
T KOG0820          52 EKADLKPTDVVLEVGPGTGNLTVKLLEA--GKKVVAVEIDPRMVAELEKRVQG---TPKSGKLQVLHGDFLKTD------  120 (315)
T ss_pred             HCCCCCCCCEEEEECCCCCHHHHHHHHH--CCEEEEEECCCHHHHHHHHHHCC---CCCCCEEEEEECCCCCCC------
T ss_conf             6047899877999579877899999972--08489994080789999998669---986560468850312578------


Q ss_pred             CCCCCCCCEEEECCCCCC
Q ss_conf             235765205772265446
Q gi|255764482|r   85 GLKNNFYDHVIMNPPFNE  102 (225)
Q Consensus        85 ~~~~~~fDlii~nPPy~~  102 (225)
                         .-.||.+++|-||..
T Consensus       121 ---~P~fd~cVsNlPyqI  135 (315)
T KOG0820         121 ---LPRFDGCVSNLPYQI  135 (315)
T ss_pred             ---CCCCCEEECCCCCCC
T ss_conf             ---851031122698533


No 131
>COG3129 Predicted SAM-dependent methyltransferase [General function prediction only]
Probab=98.92  E-value=2.6e-10  Score=77.43  Aligned_cols=89  Identities=20%  Similarity=0.215  Sum_probs=66.6

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEEC-CCCCCCCCCCCCCCCCC
Q ss_conf             85578999587843899999986799889999889899998899999806645222530200-44423531000012357
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIE-VDVTLVGENRNLAGLKN   88 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~-~D~~~~~~~~~~~~~~~   88 (225)
                      +++-++||+|.|.-++--.+..+.++++.+|.|+|+.+++.|+.++..|.  +++..+++.. .|-..   .+.-.....
T Consensus        77 ~~~i~~LDIGvGAnCIYPliG~~eYgwrfvGseid~~sl~sAk~ii~~N~--~l~~~I~lr~qk~~~~---if~giig~n  151 (292)
T COG3129          77 GKNIRILDIGVGANCIYPLIGVHEYGWRFVGSEIDSQSLSSAKAIISANP--GLERAIRLRRQKDSDA---IFNGIIGKN  151 (292)
T ss_pred             CCCEEEEEECCCCCCCCCCCCCEEECCEEECCCCCHHHHHHHHHHHHCCC--CHHHHEEEEECCCCCC---CCCCCCCCC
T ss_conf             67647885045764200213321212200157468778888899987090--4153336775268543---416510344


Q ss_pred             CCCCEEEECCCCCCC
Q ss_conf             652057722654464
Q gi|255764482|r   89 NFYDHVIMNPPFNER  103 (225)
Q Consensus        89 ~~fDlii~nPPy~~~  103 (225)
                      +.||..+|||||+..
T Consensus       152 E~yd~tlCNPPFh~s  166 (292)
T COG3129         152 ERYDATLCNPPFHDS  166 (292)
T ss_pred             CEEEEEECCCCCCHH
T ss_conf             333057518983020


No 132
>PHA02056 putative methyltransferase
Probab=98.91  E-value=4.8e-09  Score=70.23  Aligned_cols=84  Identities=30%  Similarity=0.374  Sum_probs=67.1

Q ss_pred             CCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCC
Q ss_conf             99855789995878438999999867998899998898999988999998066452225302004442353100001235
Q gi|255764482|r    8 NATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLK   87 (225)
Q Consensus         8 ~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~   87 (225)
                      .+.-+++|+|+|+|.|.+|.++.+|+.-.+++-||.+++.+.+-++-+         +..+.+++|+.....        
T Consensus        61 Da~~tG~iiDLCAGIG~LSy~~~~r~kp~~ivCVErN~~y~~vGkkil---------PeAtWI~~Dv~~~~~--------  123 (279)
T PHA02056         61 DAHCTGKVLDLCAGIGRLSFCMLHRCKPEKIVCVELNPEFARIGKRLL---------PEAEWITSDVFEFES--------  123 (279)
T ss_pred             ECCCCCEEEEECCCCCHHHHHHHHCCCCCCEEEEEECHHHHHHHHHCC---------CCCEEEECCEECCCC--------
T ss_conf             025785388821461235799985068863589940857988643207---------640277323130356--------


Q ss_pred             CCCCCEEEECCCCCCCCCCCC
Q ss_conf             765205772265446446547
Q gi|255764482|r   88 NNFYDHVIMNPPFNERIGTMT  108 (225)
Q Consensus        88 ~~~fDlii~nPPy~~~~~~~~  108 (225)
                      .+.||.+|+||||+.......
T Consensus       124 ~~~FD~aIsNPPFG~i~~~~s  144 (279)
T PHA02056        124 NEKFDVVISNPPFGKINTTDT  144 (279)
T ss_pred             CCCEEEEECCCCCCCCCCCCC
T ss_conf             662004533899764333335


No 133
>KOG2361 consensus
Probab=98.90  E-value=2.4e-08  Score=66.31  Aligned_cols=111  Identities=12%  Similarity=0.178  Sum_probs=77.7

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCC--CEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCC
Q ss_conf             85578999587843899999986799--8899998898999988999998066452225302004442353100001235
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRLHE--AQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLK   87 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~~~--~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~   87 (225)
                      +..++|||+|||.|.....+.+..++  ..+++.|.+|.+++..++|...+.     .+++....|+....   ......
T Consensus        70 ~~~~~ilEvGCGvGNtvfPll~~~~n~~l~v~acDfsp~Ai~~vk~~~~~~e-----~~~~afv~Dlt~~~---~~~~~~  141 (264)
T KOG2361          70 KSAETILEVGCGVGNTVFPLLKTSPNNRLKVYACDFSPRAIELVKKSSGYDE-----SRVEAFVWDLTSPS---LKEPPE  141 (264)
T ss_pred             CCHHHHEEECCCCCCCCCHHHHCCCCCCEEEEECCCCHHHHHHHHHCCCCCH-----HHHCCCCEECCCHH---CCCCCC
T ss_conf             5734511222477751224442489987389974898689999873633264-----55012000165601---037888


Q ss_pred             CCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             765205772265446446547885455652056689899999999862469837870
Q gi|255764482|r   88 NNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLI  144 (225)
Q Consensus        88 ~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i  144 (225)
                      .+++|.+..-.-...   .             ........+....++|||||.+.+-
T Consensus       142 ~~svD~it~IFvLSA---i-------------~pek~~~a~~nl~~llKPGG~llfr  182 (264)
T KOG2361         142 EGSVDIITLIFVLSA---I-------------HPEKMQSVIKNLRTLLKPGGSLLFR  182 (264)
T ss_pred             CCCCCEEEEEEEEEC---C-------------CHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             676334789998751---4-------------8477899999999974888679984


No 134
>KOG1663 consensus
Probab=98.88  E-value=1.2e-08  Score=68.01  Aligned_cols=117  Identities=18%  Similarity=0.268  Sum_probs=90.8

Q ss_pred             CCHHHCCCCCCCEEEEECCCHHHHHHHHHHHCC-CCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCC
Q ss_conf             662438998557899958784389999998679-9889999889899998899999806645222530200444235310
Q gi|255764482|r    2 ILASLVNATGSFHLADLGAGAGAAGLAVASRLH-EAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGEN   80 (225)
Q Consensus         2 lLa~~~~~~~~~~VLDlGcG~G~~~l~la~r~~-~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~   80 (225)
                      |++.+++.-.+.+++|+|.=||..++..|...| +++|+++|+|++.++.+.+-++..+   ...++++++++.......
T Consensus        64 fl~~li~~~~ak~~lelGvfTGySaL~~Alalp~dGrv~a~eid~~~~~~~~~~~k~ag---v~~KI~~i~g~a~esLd~  140 (237)
T KOG1663          64 FLQMLIRLLNAKRTLELGVFTGYSALAVALALPEDGRVVAIEIDADAYEIGLELVKLAG---VDHKITFIEGPALESLDE  140 (237)
T ss_pred             HHHHHHHHHCCCEEEEEECCCCHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHHCC---CCCEEEEEECCHHHHHHH
T ss_conf             99999998587338998121278999999745999659999618688887599998606---330342342525666999


Q ss_pred             CCCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEE
Q ss_conf             000123576520577226544644654788545565205668989999999986246983787
Q gi|255764482|r   81 RNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSL  143 (225)
Q Consensus        81 ~~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~  143 (225)
                      . ......+.||+++-.-                     .+..+..+.+.+.+++|+||.+.+
T Consensus       141 l-~~~~~~~tfDfaFvDa---------------------dK~nY~~y~e~~l~Llr~GGvi~~  181 (237)
T KOG1663         141 L-LADGESGTFDFAFVDA---------------------DKDNYSNYYERLLRLLRVGGVIVV  181 (237)
T ss_pred             H-HHCCCCCCEEEEEECC---------------------CHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             9-8557998425999736---------------------667789999999856213538999


No 135
>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis]
Probab=98.81  E-value=7.2e-08  Score=63.60  Aligned_cols=146  Identities=16%  Similarity=0.193  Sum_probs=97.9

Q ss_pred             CCCCCEEEEECCCHHHHHHHHHHHCC-CCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCC
Q ss_conf             98557899958784389999998679-98899998898999988999998066452225302004442353100001235
Q gi|255764482|r    9 ATGSFHLADLGAGAGAAGLAVASRLH-EAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLK   87 (225)
Q Consensus         9 ~~~~~~VLDlGcG~G~~~l~la~r~~-~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~   87 (225)
                      .+++.+|+|+||-.|..|..++++.. +..|+|+|++|.-.               ...+.++++|++.......+....
T Consensus        43 ~~~~~~ViDLGAAPGgWsQva~~~~~~~~~vvavDi~p~~~---------------~~~V~~iq~d~~~~~~~~~l~~~l  107 (205)
T COG0293          43 FKPGMVVVDLGAAPGGWSQVAAKKLGAGGKIVAVDILPMKP---------------IPGVIFLQGDITDEDTLEKLLEAL  107 (205)
T ss_pred             CCCCCEEEECCCCCCCHHHHHHHHHCCCCCEEEEECCCCCC---------------CCCCEEEEEECCCCCHHHHHHHHC
T ss_conf             05898799838799849999999738888489997754556---------------789468841324843799999870


Q ss_pred             CC-CCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEE-ECCHHHHHHHHHHHHCCCCCEE
Q ss_conf             76-520577226544644654788545565205668989999999986246983787-0288889999998521788469
Q gi|255764482|r   88 NN-FYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSL-IARPQSLIQIVNACARRIGSLE  165 (225)
Q Consensus        88 ~~-~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~-i~~~~~l~~~l~~~~~~~~~~~  165 (225)
                      .+ .+|+|++.+-= ...+....++..      ....-...++.+...|+|||.+.. ++.-+...+++..+...+..++
T Consensus       108 ~~~~~DvV~sD~ap-~~~g~~~~Dh~r------~~~L~~~a~~~a~~vL~~~G~fv~K~fqg~~~~~~l~~~~~~F~~v~  180 (205)
T COG0293         108 GGAPVDVVLSDMAP-NTSGNRSVDHAR------SMYLCELALEFALEVLKPGGSFVAKVFQGEDFEDLLKALRRLFRKVK  180 (205)
T ss_pred             CCCCCCEEEECCCC-CCCCCCCCCHHH------HHHHHHHHHHHHHHEECCCCEEEEEEEECCCHHHHHHHHHHHHCEEE
T ss_conf             77876668725887-767872200889------99999999999987257898399999757987999999998632067


Q ss_pred             EE-EECCCCCCC
Q ss_conf             99-814589698
Q gi|255764482|r  166 IT-PLHPREGEC  176 (225)
Q Consensus       166 i~-~v~~~~~~~  176 (225)
                      +. |-.++..+.
T Consensus       181 ~~KP~aSR~~S~  192 (205)
T COG0293         181 IFKPKASRKRSR  192 (205)
T ss_pred             EECCCCCCCCCC
T ss_conf             735855467771


No 136
>pfam05724 TPMT Thiopurine S-methyltransferase (TPMT). This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes. Thiopurine S-methyltransferase (TPMT) is a cytosolic enzyme that catalyses S-methylation of aromatic and heterocyclic sulfhydryl compounds, including anticancer and immunosuppressive thiopurines.
Probab=98.78  E-value=1.2e-07  Score=62.33  Aligned_cols=114  Identities=12%  Similarity=0.080  Sum_probs=76.9

Q ss_pred             CCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHC--------CCCCCCCCEEECCCCCCCC
Q ss_conf             89985578999587843899999986799889999889899998899999806--------6452225302004442353
Q gi|255764482|r    7 VNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPA--------NAQISKRISLIEVDVTLVG   78 (225)
Q Consensus         7 ~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~--------~~~~~~~~~~~~~D~~~~~   78 (225)
                      .+..++.|||=+|||-|.-...+|.+  +.+|+|+|+++.+++.+.+......        .......+++.++|++...
T Consensus        18 l~~~~~~rvlVPlCGks~D~~wLa~~--G~~VvGvels~~Av~~ff~e~~~~~~~~~~~~~~~~~~~~i~i~~gD~F~l~   95 (203)
T pfam05724        18 LNLPPGLRVLVPLCGKALDMVWLAEQ--GHFVVGVEISELAVEKFFAEANLSPPITELSGFKEYRAGGIELLCGDFFTLP   95 (203)
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHC--CCEEEEEECCHHHHHHHHHHCCCCCCCEECCCCEEECCCCEEEEECCHHCCC
T ss_conf             38999988999689985999999838--9848999567999999999737887510136621320586489977321378


Q ss_pred             CCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             100001235765205772265446446547885455652056689899999999862469837870
Q gi|255764482|r   79 ENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLI  144 (225)
Q Consensus        79 ~~~~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i  144 (225)
                      ..      ..+.||.|.----+      ....+          ..-.++.+.+.++|+|||+..+|
T Consensus        96 ~~------~~g~fD~IyDraal------~ALpp----------~~R~~Ya~~l~~lL~pgg~~lLi  139 (203)
T pfam05724        96 RE------ELGKFDLIYDRAAL------CALPP----------EMRPRYAKQMYELLPPGGEGLLI  139 (203)
T ss_pred             HH------HCCCCCEEEEECCE------EECCH----------HHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             43------46873489970323------53898----------99999999999971899669999


No 137
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism]
Probab=98.78  E-value=1e-07  Score=62.78  Aligned_cols=118  Identities=18%  Similarity=0.179  Sum_probs=87.9

Q ss_pred             HCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCC
Q ss_conf             38998557899958784389999998679988999988989999889999980664522253020044423531000012
Q gi|255764482|r    6 LVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAG   85 (225)
Q Consensus         6 ~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~   85 (225)
                      ++...+ .+||=+|-|.|..+-.+.+..+-.+++.||+|+..++.+|+-.........+.|++++..|...+...     
T Consensus        72 ~ah~~p-k~VLiiGgGdG~tlRevlkh~~ve~i~~VEID~~Vi~~ar~~l~~~~~~~~dpRv~i~i~Dg~~~v~~-----  145 (282)
T COG0421          72 LAHPNP-KRVLIIGGGDGGTLREVLKHLPVERITMVEIDPAVIELARKYLPEPSGGADDPRVEIIIDDGVEFLRD-----  145 (282)
T ss_pred             HHCCCC-CEEEEECCCCCHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHCCCCCCCCCCCCEEEEECCHHHHHHH-----
T ss_conf             437997-76999889766999999836884337999708899999998666754335797368996107999874-----


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             35765205772265446446547885455652056689899999999862469837870
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLI  144 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i  144 (225)
                       ...+||+|+.+---..     .         ......-.+|.+.+.+.|+++|.+..-
T Consensus       146 -~~~~fDvIi~D~tdp~-----g---------p~~~Lft~eFy~~~~~~L~~~Gi~v~q  189 (282)
T COG0421         146 -CEEKFDVIIVDSTDPV-----G---------PAEALFTEEFYEGCRRALKEDGIFVAQ  189 (282)
T ss_pred             -CCCCCCEEEECCCCCC-----C---------CCCCCCCHHHHHHHHHHCCCCCEEEEE
T ss_conf             -8876778998588998-----8---------430237799999999862889689994


No 138
>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family; InterPro: IPR014329   Members of this entry are the m6-adenine DNA methyltransferase protein, or a fusion protein that also carries m5 cytosine methyltransferase activity of type II restriction systems of the Alw26I/Eco31I/Esp3I family.   A type II restriction endonuclease always accompanies a methyltransferase of this type from Alw26I/Eco31I/Esp3I(IPR014328 from INTERPRO) and by an adenine-specific modification methyltransferase. Members of this are unusual in that the regions of similarity to homologues outside this family are circularly permuted..
Probab=98.76  E-value=4.3e-08  Score=64.85  Aligned_cols=142  Identities=22%  Similarity=0.199  Sum_probs=84.3

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC------------CCCEEEEEECCHHHHHHHHHHHHHHC----CCCCCCCCEEECCCC
Q ss_conf             55789995878438999999867------------99889999889899998899999806----645222530200444
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL------------HEAQILLAERSPLMAHYARKTLALPA----NAQISKRISLIEVDV   74 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~------------~~~~v~gvD~~~~~~~~A~~n~~~~~----~~~~~~~~~~~~~D~   74 (225)
                      +.-.++|||||.|.+-..+-..+            -.+.++-.|+++..+..+..++....    ...........+.|.
T Consensus        33 ~~~~~~DP~~G~G~Li~~~L~~~~~i~~~~~~i~~~~~~~~~~Di~~~~L~~~~~~~~~~~k~~F~~~~~~~~~~~~~~~  112 (603)
T TIGR02987        33 EKLKIIDPCCGDGRLIALLLKKFEEINLFKEQIEKVELNIYLADIDKTLLERASKLLSELAKLLFALEISIILTNSLSDV  112 (603)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHHCCHHHHHHHHHEEEEECCCHHHHHHHHHHHHHHHHHHHHCCCCEEECCHHHHH
T ss_conf             15453357527649999999986643034023233111000231444799999998878766654237751001102344


Q ss_pred             CCCCCCCC-----------CCCCCCCCCCEEEECCCCCCC-CC---CC--------------------------CCCHHH
Q ss_conf             23531000-----------012357652057722654464-46---54--------------------------788545
Q gi|255764482|r   75 TLVGENRN-----------LAGLKNNFYDHVIMNPPFNER-IG---TM--------------------------TPDKIK  113 (225)
Q Consensus        75 ~~~~~~~~-----------~~~~~~~~fDlii~nPPy~~~-~~---~~--------------------------~~~~~~  113 (225)
                      ........           ......+.||.||+||||..- ..   ..                          ..++.+
T Consensus       113 ~~~~~~~~~~EYI~~~~~F~~EV~keGFD~~ItNPPy~~~K~dk~~~~n~~~~~~~~~~~~~~~~~~~~~~~~~~S~p~k  192 (603)
T TIGR02987       113 FLLIEEYKEKEYIKLEDVFGDEVKKEGFDIVITNPPYKNLKPDKKELSNLETLEKESYKDSLKELDDFLSRVFPYSDPRK  192 (603)
T ss_pred             HHHHHHHCCCCCEEEEECCCCCEEECCCEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCHHHHH
T ss_conf             45455420102225450155320015741799778885544451000146825544453776412222333024210034


Q ss_pred             HHHHCCC---CCCH-HHHHHHHHHHCCCCCEEEEECCHHHHHH
Q ss_conf             5652056---6898-9999999986246983787028888999
Q gi|255764482|r  114 EEAHVML---EDSF-EKWIRTACAIMRSSGQLSLIARPQSLIQ  152 (225)
Q Consensus       114 ~~a~~~~---~~~~-~~~~~~a~~lLkpgG~~~~i~~~~~l~~  152 (225)
                      .-+-+..   ...+ .-+.+.+.++.+++|.+.+|.|++-|+|
T Consensus       193 Kf~g~g~~~G~~~ysr~~~~~~~~~~~~~G~v~i~~P~S~l~D  235 (603)
T TIGR02987       193 KFAGVGTEKGILNYSRVGEEISLELVKKNGLVSIVIPSSILAD  235 (603)
T ss_pred             HHCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCC
T ss_conf             4336786676067999999999987345987999636301052


No 139
>pfam01564 Spermine_synth Spermine/spermidine synthase. Spermine and spermidine are polyamines. This family includes spermidine synthase that catalyses the fifth (last) step in the biosynthesis of spermidine from arginine, and spermine synthase.
Probab=98.75  E-value=4.7e-07  Score=59.01  Aligned_cols=134  Identities=15%  Similarity=0.124  Sum_probs=93.1

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCC-CEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCC
Q ss_conf             85578999587843899999986799-88999988989999889999980664522253020044423531000012357
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRLHE-AQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKN   88 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~~~-~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~   88 (225)
                      +..++||=+|-|.|..+--+.+ .++ -+|+.||+|+.+++.+++........-.+.|++++.+|...+...      ..
T Consensus        74 ~~pk~VLIiGGGDG~~~rEvlk-~~~v~~v~~VEiD~~Vv~~~~~~lp~~~~~~~dprv~l~~~Dg~~~l~~------~~  146 (240)
T pfam01564        74 PNPKKVLIIGGGDGGALREVVK-HPSVEKITLVEIDEKVIEFSKKFLPSLAGGFDDPRVKVVIGDGFKFLKD------YL  146 (240)
T ss_pred             CCCCEEEEECCCCHHHHHHHHC-CCCCCEEEEECCCHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHH------CC
T ss_conf             8855367645865799999856-7995389997578899999999879852434798559998168999985------72


Q ss_pred             CCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEEC-----CHHHHHHHHHHHHCCCCC
Q ss_conf             652057722654464465478854556520566898999999998624698378702-----888899999985217884
Q gi|255764482|r   89 NFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIA-----RPQSLIQIVNACARRIGS  163 (225)
Q Consensus        89 ~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~-----~~~~l~~~l~~~~~~~~~  163 (225)
                      ++||+|+...|- +.    .+         .....-.+|.+.+.+.|+|+|.++.=.     .+.....+...+...+..
T Consensus       147 ~~yDvII~D~~D-P~----~~---------~~~Lfs~eFy~~~~~~L~~~Gi~v~Q~~sp~~~~~~~~~i~~~l~~~F~~  212 (240)
T pfam01564       147 VKFDVIIVDSTD-PV----GP---------AENLFSKEFYDLLKRALKEDGVFVTQAESPWLHLELIINILKNGKKVFPV  212 (240)
T ss_pred             CCCCEEEEECCC-CC----CH---------HHHHHHHHHHHHHHHHCCCCCEEEEECCCHHHCHHHHHHHHHHHHHHCCC
T ss_conf             544589995899-76----53---------34442299999999865999789992488343799999999999977898


Q ss_pred             E
Q ss_conf             6
Q gi|255764482|r  164 L  164 (225)
Q Consensus       164 ~  164 (225)
                      .
T Consensus       213 v  213 (240)
T pfam01564       213 V  213 (240)
T ss_pred             C
T ss_conf             2


No 140
>KOG2198 consensus
Probab=98.74  E-value=1.4e-07  Score=61.95  Aligned_cols=152  Identities=13%  Similarity=0.119  Sum_probs=96.4

Q ss_pred             HHCCCCCCCEEEEECCCHHHHHHHHHHHCC----CCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCC
Q ss_conf             438998557899958784389999998679----9889999889899998899999806645222530200444235310
Q gi|255764482|r    5 SLVNATGSFHLADLGAGAGAAGLAVASRLH----EAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGEN   80 (225)
Q Consensus         5 ~~~~~~~~~~VLDlGcG~G~~~l~la~r~~----~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~   80 (225)
                      -+..++++++|||+|+-.|.-++.+-+-..    ...|++-|.|+.-++..++.+....    +....+.+.|.......
T Consensus       149 L~L~v~p~~~VLDmCAAPG~Kt~qLLeal~~~~~~g~vvaND~d~~R~~~L~~q~~~l~----~~~~~v~~~~~~~~p~~  224 (375)
T KOG2198         149 LALGVKPGDKVLDMCAAPGGKTAQLLEALHKDPTRGYVVANDVDPKRLNMLVHQLKRLP----SPNLLVTNHDASLFPNI  224 (375)
T ss_pred             HHCCCCCCCEEEEECCCCCCCHHHHHHHHHCCCCCCEEEECCCCHHHHHHHHHHHHCCC----CCCEEEECCCCEECCCC
T ss_conf             20226799844420138984489999997237777736753457889999999985269----84333431211005641


Q ss_pred             C--CCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHH-HH----CCCCCCHHHHHHHHHHHCCCCCEEEEE----CCHHH
Q ss_conf             0--0012357652057722654464465478854556-52----056689899999999862469837870----28888
Q gi|255764482|r   81 R--NLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEE-AH----VMLEDSFEKWIRTACAIMRSSGQLSLI----ARPQS  149 (225)
Q Consensus        81 ~--~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~-a~----~~~~~~~~~~~~~a~~lLkpgG~~~~i----~~~~~  149 (225)
                      .  .+.......||-|++.-|+...+......+.... +.    ...-.....++..+.++||+||++++-    -|.++
T Consensus       225 ~~~~~~~~~~~~fDrVLvDVPCS~Dgt~rk~~~i~~~~w~~~~~~~L~~LQ~~iL~rgl~lLk~GG~lVYSTCSLnpieN  304 (375)
T KOG2198         225 YLKDGNDKEQLKFDRVLVDVPCSGDGTLRKNPNIWKEGWKTQRALGLHALQLRILRRGLRLLKVGGRLVYSTCSLNPIEN  304 (375)
T ss_pred             CCCCCCHHHHHHCCEEEEECCCCCCCCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHH
T ss_conf             01467603344125368714568984302280276665554113597389999999999872578779994257872002


Q ss_pred             H---HHHHHHHHCC
Q ss_conf             9---9999985217
Q gi|255764482|r  150 L---IQIVNACARR  160 (225)
Q Consensus       150 l---~~~l~~~~~~  160 (225)
                      -   ++++......
T Consensus       305 EaVV~~~L~~~~~~  318 (375)
T KOG2198         305 EAVVQEALQKVGGA  318 (375)
T ss_pred             HHHHHHHHHHHCCC
T ss_conf             79999999983685


No 141
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase; InterPro: IPR011023   This domain is found in archaeal, bacterial and eukaryotic proteins.    In the archaea and bacteria, they are primarily restricted to the euryarchaeota and proteobacteria respectively; where they are either described as either nucleolar protein or tRNA/rRNA cytosine-C5-methylase. They all have the S-adenosyl methionine (SAM) binding domain and are related to bacterial Fmu (16S rRNA m5C 967 methyltransferase) where the structure of the methyl transferase domain has been determined .    In the eukaryota, the majority are annotated as being 'nucleolar protein'. None of the eukaryotic members in this family have a the SAM binding signature. Despite this, the yeast Nop2p is a probable RNA m(5)C methyltransferase, essential for processing and maturation of 27S pre-rRNA and large ribosomal subunit biogenesis ; localised to the nucleolus and is essential for viability . Reduced Nop2p expression limits yeast growth and decreases levels of mature 60S ribosomal subunits while altering rRNA processing . There is substantial identity between Nop2p and human p120 (NOL1), which is also called the proliferation-associated nucleolar antigen , . .
Probab=98.73  E-value=7.4e-08  Score=63.55  Aligned_cols=129  Identities=16%  Similarity=0.199  Sum_probs=99.1

Q ss_pred             CCC--CCCEEEEECCCHHHHHHHHHHHCCC-CEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC
Q ss_conf             998--5578999587843899999986799-8899998898999988999998066452225302004442353100001
Q gi|255764482|r    8 NAT--GSFHLADLGAGAGAAGLAVASRLHE-AQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA   84 (225)
Q Consensus         8 ~~~--~~~~VLDlGcG~G~~~l~la~r~~~-~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~   84 (225)
                      .++  ++++|||+++-.|+-|..+|++..+ +-|+|+|.+..-++....|+...|..|    +.+.+.|-+.+...... 
T Consensus        72 ~p~Gn~~~~vlD~AAaPGgKTT~is~~m~N~G~i~Ane~~ksR~k~L~~NI~R~G~~n----~~v~~~DgR~f~~~~~~-  146 (284)
T TIGR00446        72 EPEGNEKERVLDMAAAPGGKTTQISALMKNEGAIVANEVSKSRTKVLIANINRMGVLN----VAVINVDGRKFGAVVLK-  146 (284)
T ss_pred             CCCCCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHHEE----EEEEECCCCHHHHHHCC-
T ss_conf             7787688879997408896489999986588518997376341066786555621003----33241376300123144-


Q ss_pred             CCCCCCCCEEEECCCCCCCCCCCCCCHHH-----HHHHCCCCCCHHHHHHHHHHHCCC----CCEEEEE
Q ss_conf             23576520577226544644654788545-----565205668989999999986246----9837870
Q gi|255764482|r   85 GLKNNFYDHVIMNPPFNERIGTMTPDKIK-----EEAHVMLEDSFEKWIRTACAIMRS----SGQLSLI  144 (225)
Q Consensus        85 ~~~~~~fDlii~nPPy~~~~~~~~~~~~~-----~~a~~~~~~~~~~~~~~a~~lLkp----gG~~~~i  144 (225)
                        ..-.||-|+-..|+...|-. ..|+..     ...-......+.+++..|...||+    ||.+.+-
T Consensus       147 --~eifFD~iLLDAPCSG~GvI-~KD~~~~~~~~~eD~~~~s~lQkeL~~~A~d~lk~nskhGGv~VYS  212 (284)
T TIGR00446       147 --MEIFFDRILLDAPCSGEGVI-RKDPSRKKNRSEEDILEISKLQKELILAAFDALKPNSKHGGVLVYS  212 (284)
T ss_pred             --CEEEEEEEEECCCCCCCCEE-EECHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEE
T ss_conf             --30343214525787988337-6572331147724577646767999999987504456668888985


No 142
>KOG4300 consensus
Probab=98.73  E-value=5.4e-08  Score=64.31  Aligned_cols=111  Identities=16%  Similarity=0.195  Sum_probs=77.3

Q ss_pred             CCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCE-EECCCCCCCCCCCCCCC
Q ss_conf             89985578999587843899999986799889999889899998899999806645222530-20044423531000012
Q gi|255764482|r    7 VNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRIS-LIEVDVTLVGENRNLAG   85 (225)
Q Consensus         7 ~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~-~~~~D~~~~~~~~~~~~   85 (225)
                      +......-|||+|||+|.---..- -.|+.+|+.+|-++.|-+.|.+.+..+.-    .++. ++.++.++..      .
T Consensus        72 ~gk~~K~~vLEvgcGtG~Nfkfy~-~~p~~svt~lDpn~~mee~~~ks~~E~k~----~~~~~fvva~ge~l~------~  140 (252)
T KOG4300          72 LGKSGKGDVLEVGCGTGANFKFYP-WKPINSVTCLDPNEKMEEIADKSAAEKKP----LQVERFVVADGENLP------Q  140 (252)
T ss_pred             HCCCCCCCEEEECCCCCCCCCCCC-CCCCCEEEEECCCHHHHHHHHHHHHHCCC----CCEEEEEEECHHCCC------C
T ss_conf             343575136996146888853555-78885689867848799999988864257----205777850521074------2


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECC
Q ss_conf             3576520577226544644654788545565205668989999999986246983787028
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIAR  146 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~  146 (225)
                      ..++++|.|++.--.-                  .-.+....+....++|+|||++.++-+
T Consensus       141 l~d~s~DtVV~TlvLC------------------Sve~~~k~L~e~~rlLRpgG~iifiEH  183 (252)
T KOG4300         141 LADGSYDTVVCTLVLC------------------SVEDPVKQLNEVRRLLRPGGRIIFIEH  183 (252)
T ss_pred             CCCCCEEEEEEEEEEE------------------CCCCHHHHHHHHHHHCCCCCEEEEEEC
T ss_conf             1367711577788872------------------057799999998875088958999721


No 143
>pfam03291 Pox_MCEL mRNA capping enzyme. This family of enzymes are related to pfam03919.
Probab=98.72  E-value=9.2e-08  Score=63.02  Aligned_cols=129  Identities=11%  Similarity=0.063  Sum_probs=79.3

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCC------CCCCCCEEECCCCCCCCCCCCC
Q ss_conf             8557899958784389999998679988999988989999889999980664------5222530200444235310000
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANA------QISKRISLIEVDVTLVGENRNL   83 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~------~~~~~~~~~~~D~~~~~~~~~~   83 (225)
                      .++.+|||+|||-|+-..--.+. .-..++|+|+++..++.|++........      .......+..+|.........+
T Consensus        62 ~~~~~VLDl~CGkGGDL~Kw~~~-~i~~~vgiDis~~sI~~A~~RY~~~~~~~~~~~~~~~f~~~f~~~D~~~~~l~~~~  140 (327)
T pfam03291        62 KPKRKVLDLDCGKGGDLEKYFKG-GISGLIGTDIAEVSIEQAQERYNDLNSRSKSKYYKFDFIAEFITGDCFVSSVREVF  140 (327)
T ss_pred             CCCCEEEEECCCCCCCHHHHHHC-CCCEEEEECCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEECCCCHHHHHHHC
T ss_conf             88987998368664457889747-98689996689999999999999864211444456675001231562156787753


Q ss_pred             CCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHH-HHHHHH
Q ss_conf             12357652057722654464465478854556520566898999999998624698378702888-899999
Q gi|255764482|r   84 AGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQ-SLIQIV  154 (225)
Q Consensus        84 ~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~-~l~~~l  154 (225)
                       ......||+|-|..-.|              .-.+.......+++.+...|+|||.+.-..|.. .+...+
T Consensus       141 -~~~~~~FDvVS~QFAiH--------------Y~Fese~~a~~~l~Nvs~~Lk~GG~FIGT~~d~~~i~~~l  197 (327)
T pfam03291       141 -EPGQRKFDIVSWQFAIH--------------YSFESEEKARTMLRNLAELLASGGKFIGTTPDGDFIIKKL  197 (327)
T ss_pred             -CCCCCCCCEEEHHHHHH--------------HHHCCHHHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHH
T ss_conf             -57788503775178789--------------8764899999999999986058988999966789999999


No 144
>PRK00811 spermidine synthase; Provisional
Probab=98.69  E-value=9.2e-07  Score=57.36  Aligned_cols=137  Identities=13%  Similarity=0.134  Sum_probs=92.4

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCC-CEEEEEECCHHHHHHHHHHHHH-HCCCCCCCCCEEECCCCCCCCCCCCCCCCC
Q ss_conf             85578999587843899999986799-8899998898999988999998-066452225302004442353100001235
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRLHE-AQILLAERSPLMAHYARKTLAL-PANAQISKRISLIEVDVTLVGENRNLAGLK   87 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~~~-~~v~gvD~~~~~~~~A~~n~~~-~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~   87 (225)
                      ...++||=+|-|.|+..--+.+. +. .+|+.||+|+..++.+++-... +...-.+.|++++.+|...+...      .
T Consensus        77 ~~pk~VLIiGGGDGg~~rE~lkh-~~v~~v~~VeiD~~Vi~~~~~~lp~~~~~~~~dprv~~~~~Dg~~fv~~------~  149 (283)
T PRK00811         77 PNPKKVLIIGGGDGGTLREVLKH-PSVEKITMVEIDERVVEMSRKYLPEISGGAWDDPRVELVIGDGVKFVRE------T  149 (283)
T ss_pred             CCCCEEEEECCCCHHHHHHHHCC-CCCCEEEEEECCHHHHHHHHHHHHHHHHHHCCCCCEEEEHHHHHHHHHH------C
T ss_conf             99774899568747999998427-8856799994689999999998388631330297159982789999984------5


Q ss_pred             CCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEE-----CCHHHHHHHHHHHHCCCC
Q ss_conf             765205772265446446547885455652056689899999999862469837870-----288889999998521788
Q gi|255764482|r   88 NNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLI-----ARPQSLIQIVNACARRIG  162 (225)
Q Consensus        88 ~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i-----~~~~~l~~~l~~~~~~~~  162 (225)
                      .++||+|+.+-|          ++..    ......-.+|.+.+.+.|+|+|.++.=     +.++.+..+...+...+.
T Consensus       150 ~~~yDvII~D~t----------DP~g----pa~~Lft~~Fy~~~~~~L~~~Gi~v~Q~~sp~~~~~~~~~~~~~l~~~F~  215 (283)
T PRK00811        150 ENSFDVIIVDST----------DPVG----PAEGLFTKEFYENCKRALKEGGIFVAQSESPFLQADEIKDLHKKLREVFP  215 (283)
T ss_pred             CCCCCEEEEECC----------CCCC----HHHHHCCHHHHHHHHHHCCCCCEEEECCCCHHHCHHHHHHHHHHHHHHCC
T ss_conf             235548998089----------9886----44553459999999985399958999279832069999999999998688


Q ss_pred             CEEEE
Q ss_conf             46999
Q gi|255764482|r  163 SLEIT  167 (225)
Q Consensus       163 ~~~i~  167 (225)
                      .....
T Consensus       216 ~v~~y  220 (283)
T PRK00811        216 IVRPY  220 (283)
T ss_pred             CEEEE
T ss_conf             66899


No 145
>KOG1975 consensus
Probab=98.69  E-value=6.9e-08  Score=63.71  Aligned_cols=124  Identities=16%  Similarity=0.091  Sum_probs=83.6

Q ss_pred             CCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHC--CCCCCCCCEEECCCCCCCCCCCCCCCC
Q ss_conf             985578999587843899999986799889999889899998899999806--645222530200444235310000123
Q gi|255764482|r    9 ATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPA--NAQISKRISLIEVDVTLVGENRNLAGL   86 (225)
Q Consensus         9 ~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~--~~~~~~~~~~~~~D~~~~~~~~~~~~~   86 (225)
                      .+++..++|+|||-|+-++-.-+. .-.+++|+||.+..++.|++..+...  .......+.++.+|-........+. .
T Consensus       115 ~~~~~~~~~LgCGKGGDLlKw~kA-gI~~~igiDIAevSI~qa~~RYrdm~~r~~~~~f~a~f~~~Dc~~~~l~d~~e-~  192 (389)
T KOG1975         115 TKRGDDVLDLGCGKGGDLLKWDKA-GIGEYIGIDIAEVSINQARKRYRDMKNRFKKFIFTAVFIAADCFKERLMDLLE-F  192 (389)
T ss_pred             HCCCCCCCEECCCCCCCHHHHHHH-CCCCEEEEEHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHCC-C
T ss_conf             612230000056776207676551-45635765343400999999999998666413651699971441668987425-7


Q ss_pred             CCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHH
Q ss_conf             57652057722654464465478854556520566898999999998624698378702888
Q gi|255764482|r   87 KNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQ  148 (225)
Q Consensus        87 ~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~  148 (225)
                      .+.+||+|-|-.-+|-.              ++......-.+..+.+.|+|||.+.-..|..
T Consensus       193 ~dp~fDivScQF~~HYa--------------Fetee~ar~~l~Nva~~LkpGG~FIgTiPds  240 (389)
T KOG1975         193 KDPRFDIVSCQFAFHYA--------------FETEESARIALRNVAKCLKPGGVFIGTIPDS  240 (389)
T ss_pred             CCCCCCEEEEEEEEEEE--------------ECCHHHHHHHHHHHHHHCCCCCEEEEECCCH
T ss_conf             89885556554567543--------------1338889999998996358885799846968


No 146
>KOG2730 consensus
Probab=98.68  E-value=1.4e-08  Score=67.62  Aligned_cols=87  Identities=18%  Similarity=0.256  Sum_probs=70.6

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             55789995878438999999867998899998898999988999998066452225302004442353100001235765
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNF   90 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~   90 (225)
                      ..+.|+|..||.|+-++.-|.+  ...|++||+||.-+++|++|++.-|   ..++++++++|+.+.........   ..
T Consensus        94 ~~~~iidaf~g~gGntiqfa~~--~~~VisIdiDPikIa~AkhNaeiYG---I~~rItFI~GD~ld~~~~lq~~K---~~  165 (263)
T KOG2730          94 NAEVIVDAFCGVGGNTIQFALQ--GPYVIAIDIDPVKIACARHNAEVYG---VPDRITFICGDFLDLASKLKADK---IK  165 (263)
T ss_pred             CCCHHHHHHHCCCCHHHHHHHH--CCEEEEEECCHHHHHHHHCCCEEEC---CCCEEEEEECHHHHHHHHHHHHH---HE
T ss_conf             7430025453688428899871--8807998526788887760650325---77505888330999999886410---10


Q ss_pred             CCEEEECCCCCCCCC
Q ss_conf             205772265446446
Q gi|255764482|r   91 YDHVIMNPPFNERIG  105 (225)
Q Consensus        91 fDlii~nPPy~~~~~  105 (225)
                      +|.+...||++..+.
T Consensus       166 ~~~vf~sppwggp~y  180 (263)
T KOG2730         166 YDCVFLSPPWGGPSY  180 (263)
T ss_pred             EEEEECCCCCCCCCH
T ss_conf             456616999999631


No 147
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed
Probab=98.68  E-value=6.2e-07  Score=58.33  Aligned_cols=134  Identities=13%  Similarity=0.069  Sum_probs=101.3

Q ss_pred             CCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCC
Q ss_conf             98557899958784389999998679988999988989999889999980664522253020044423531000012357
Q gi|255764482|r    9 ATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKN   88 (225)
Q Consensus         9 ~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~   88 (225)
                      ..+...+||+|-|.|-..+..|...|+..++|+|.-..-++..-..+..++..|    +.+..+|+....     ...++
T Consensus       342 ~~k~kv~LEIGFG~Ge~L~~~A~~nP~~~fIG~Evy~nGva~ll~~i~~~~l~N----iri~~~D~~~ll-----~~lp~  412 (503)
T PRK01544        342 NEKRKVFLEIGFGMGEHFINQAKMNPDALFIGVEVYLNGVANVLKLAGEQNITN----FLLFPNNLDLIL-----NDLPN  412 (503)
T ss_pred             CCCCEEEEEECCCCCHHHHHHHHHCCCCCEEEEEECHHHHHHHHHHHHHCCCCE----EEEEHHHHHHHH-----HHCCC
T ss_conf             556708999536987999999996898888999406566999999999869975----998733599999-----85662


Q ss_pred             CCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHHHHH-HHHHHHHCCC
Q ss_conf             652057722654464465478854556520566898999999998624698378702888899-9999852178
Q gi|255764482|r   89 NFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLI-QIVNACARRI  161 (225)
Q Consensus        89 ~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~~l~-~~l~~~~~~~  161 (225)
                      .++|.|.--.|          |+..+..|+-......+++....+.||+||.+.+...-+.+. ++++.+....
T Consensus       413 ~sld~i~ilfP----------DPWpKkRH~KRRli~~efl~~l~~~Lk~~G~l~~aTD~~~Y~~~~le~~~~~~  476 (503)
T PRK01544        413 NSLDGIYILFP----------DPWIKNKQKKKRIFNKERLKILQDKLKDNGNLVFASDIENYFYEAIELIQQNG  476 (503)
T ss_pred             CCCCEEEEECC----------CCCCCCCHHHHCCCCHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHCC
T ss_conf             04041678789----------99975532200177999999999971469889997678899999999998679


No 148
>KOG2912 consensus
Probab=98.68  E-value=1.1e-08  Score=68.11  Aligned_cols=86  Identities=22%  Similarity=0.277  Sum_probs=62.0

Q ss_pred             EEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCEE
Q ss_conf             99958784389999998679988999988989999889999980664522253020044423531000012357652057
Q gi|255764482|r   15 LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHV   94 (225)
Q Consensus        15 VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~fDli   94 (225)
                      =+|+|+|+-++--++..+..++..+++|++...+..|..|++.|+.+   .++.+++..-.....-..+.......||++
T Consensus       106 GiDIgtgasci~~llg~rq~n~~f~~teidd~s~~~a~snV~qn~ls---s~ikvV~~~~~ktll~d~~~~~~e~~ydFc  182 (419)
T KOG2912         106 GIDIGTGASCIYPLLGARQNNWYFLATEIDDMSFNYAKSNVEQNNLS---SLIKVVKVEPQKTLLMDALKEESEIIYDFC  182 (419)
T ss_pred             EEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHCCCCCCCCC---CCEEEEEECCHHHCCHHHHCCCCCCEEEEE
T ss_conf             02026753466786400021632366412102355454240003660---103577845333201213226765324688


Q ss_pred             EECCCCCCC
Q ss_conf             722654464
Q gi|255764482|r   95 IMNPPFNER  103 (225)
Q Consensus        95 i~nPPy~~~  103 (225)
                      +||||||..
T Consensus       183 McNPPFfe~  191 (419)
T KOG2912         183 MCNPPFFEN  191 (419)
T ss_pred             ECCCCHHHC
T ss_conf             328703303


No 149
>PRK03612 spermidine synthase; Provisional
Probab=98.66  E-value=3.5e-07  Score=59.73  Aligned_cols=130  Identities=18%  Similarity=0.199  Sum_probs=90.3

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCC-CEEEEEECCHHHHHHHHHH---HHHHCCCCCCCCCEEECCCCCCCCCCCCCCC
Q ss_conf             85578999587843899999986799-8899998898999988999---9980664522253020044423531000012
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRLHE-AQILLAERSPLMAHYARKT---LALPANAQISKRISLIEVDVTLVGENRNLAG   85 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~~~-~~v~gvD~~~~~~~~A~~n---~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~   85 (225)
                      ...++||=+|-|.|...-.+. |+|+ -+|+.+|+||.+++.||++   .+.|...-.++|++++..|...+...     
T Consensus       292 ~~p~~VLiiGGGdG~a~revL-k~~~ve~v~lVelD~~vv~lar~~~~l~~~n~~a~~DpRv~v~~~Da~~~l~~-----  365 (516)
T PRK03612        292 PRARRVLILGGGDGLALREVL-KYPDVEQVTLVDLDPAVTELARTSPALRALNGGALDDPRVTVVNDDAFNWLRK-----  365 (516)
T ss_pred             CCCCEEEEECCCCCHHHHHHH-CCCCCCEEEEEECCHHHHHHHHHCCCHHHHHCCCCCCCCEEEEEHHHHHHHHH-----
T ss_conf             997738998377608799986-48996637899518899999985721444412323499648985378999986-----


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEE-----CCHHHHHHHHHHHHC
Q ss_conf             35765205772265446446547885455652056689899999999862469837870-----288889999998521
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLI-----ARPQSLIQIVNACAR  159 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i-----~~~~~l~~~l~~~~~  159 (225)
                       ..++||+|+..+|-          +...   .....--.+|.+.+.+.|+|+|.+..=     +.++.+..+...++.
T Consensus       366 -~~~~yDvIi~D~pd----------P~~~---~~~~LYs~eFY~~~~~~L~~~G~~v~qs~Sp~~~~~~f~~i~~T~~~  430 (516)
T PRK03612        366 -LPETFDAIIVDLPD----------PSNP---ALGKLYSVEFYRLLKRRLAPDGLLVVQSTSPYFAPKAFWSIEATLEA  430 (516)
T ss_pred             -CCCCCCEEEEECCC----------CCCC---CCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHHHHHHH
T ss_conf             -88878889981899----------7995---22467539999999984499958999368975522034689999998


No 150
>KOG2915 consensus
Probab=98.64  E-value=2.2e-06  Score=55.24  Aligned_cols=137  Identities=18%  Similarity=0.193  Sum_probs=100.2

Q ss_pred             HHCCCCCCCEEEEECCCHHHHHHHHHHHC-CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC
Q ss_conf             43899855789995878438999999867-99889999889899998899999806645222530200444235310000
Q gi|255764482|r    5 SLVNATGSFHLADLGAGAGAAGLAVASRL-HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL   83 (225)
Q Consensus         5 ~~~~~~~~~~VLDlGcG~G~~~l~la~r~-~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~   83 (225)
                      ..+.+++|.+|+|-|+|+|.+|.++++.. |..+++-+|.+..-.+.|++-.+.++   +.+.+++..-|+......   
T Consensus        99 ~~L~i~PGsvV~EsGTGSGSlShaiaraV~ptGhl~tfefH~~Ra~ka~eeFr~hg---i~~~vt~~hrDVc~~GF~---  172 (314)
T KOG2915          99 SMLEIRPGSVVLESGTGSGSLSHAIARAVAPTGHLYTFEFHETRAEKALEEFREHG---IGDNVTVTHRDVCGSGFL---  172 (314)
T ss_pred             HHHCCCCCCEEEECCCCCCHHHHHHHHHHCCCCCEEEEEECHHHHHHHHHHHHHHC---CCCCEEEEEEECCCCCCC---
T ss_conf             98657999789863788634889999863767626999832878999999999737---786348999641567735---


Q ss_pred             CCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCC-EEEEECCH-HHHHHHHHHHHC-C
Q ss_conf             12357652057722654464465478854556520566898999999998624698-37870288-889999998521-7
Q gi|255764482|r   84 AGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSG-QLSLIARP-QSLIQIVNACAR-R  160 (225)
Q Consensus        84 ~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG-~~~~i~~~-~~l~~~l~~~~~-~  160 (225)
                        .....+|-|...-|-                      .+ .-+-++...||.+| +++.+-|. |+++.-++++.. +
T Consensus       173 --~ks~~aDaVFLDlPa----------------------Pw-~AiPha~~~lk~~g~r~csFSPCIEQvqrtce~l~~~g  227 (314)
T KOG2915         173 --IKSLKADAVFLDLPA----------------------PW-EAIPHAAKILKDEGGRLCSFSPCIEQVQRTCEALRSLG  227 (314)
T ss_pred             --CCCCCCCEEEECCCC----------------------HH-HHHHHHHHHHHHCCCEEEECCHHHHHHHHHHHHHHHCC
T ss_conf             --313423569975898----------------------05-52233677754068259962178999999999998679


Q ss_pred             CCCEEEEEECCC
Q ss_conf             884699981458
Q gi|255764482|r  161 IGSLEITPLHPR  172 (225)
Q Consensus       161 ~~~~~i~~v~~~  172 (225)
                      +....+..++..
T Consensus       228 f~~i~~vEv~~~  239 (314)
T KOG2915         228 FIEIETVEVLLV  239 (314)
T ss_pred             CCEEEEEEEEHH
T ss_conf             823799876033


No 151
>KOG3010 consensus
Probab=98.63  E-value=1.1e-07  Score=62.47  Aligned_cols=103  Identities=17%  Similarity=0.265  Sum_probs=65.7

Q ss_pred             CCCC-EEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCC
Q ss_conf             8557-899958784389999998679988999988989999889999980664522253020044423531000012357
Q gi|255764482|r   10 TGSF-HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKN   88 (225)
Q Consensus        10 ~~~~-~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~   88 (225)
                      .++. .++|+|||+|..+..+|..+.  +|+|+|+++.|+..|++.-...   .......+...+....      .+ ..
T Consensus        31 ~~~h~~a~DvG~G~Gqa~~~iae~~k--~VIatD~s~~mL~~a~k~~~~~---y~~t~~~ms~~~~v~L------~g-~e   98 (261)
T KOG3010          31 TEGHRLAWDVGTGNGQAARGIAEHYK--EVIATDVSEAMLKVAKKHPPVT---YCHTPSTMSSDEMVDL------LG-GE   98 (261)
T ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHH--HHEEECCCHHHHHHHHCCCCCC---CCCCCCCCCCCCCCCC------CC-CC
T ss_conf             88864588845688711478887543--4313068799999861189862---0457853456656532------37-87


Q ss_pred             CCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCC-EEEE
Q ss_conf             652057722654464465478854556520566898999999998624698-3787
Q gi|255764482|r   89 NFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSG-QLSL  143 (225)
Q Consensus        89 ~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG-~~~~  143 (225)
                      ++.|+|++---+|.                   -.++.|...+.|+||+.| .+++
T Consensus        99 ~SVDlI~~Aqa~HW-------------------Fdle~fy~~~~rvLRk~Gg~iav  135 (261)
T KOG3010          99 ESVDLITAAQAVHW-------------------FDLERFYKEAYRVLRKDGGLIAV  135 (261)
T ss_pred             CCEEEEHHHHHHHH-------------------HCHHHHHHHHHHHCCCCCCEEEE
T ss_conf             64121105456776-------------------34299999999980778977999


No 152
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional
Probab=98.62  E-value=3.6e-07  Score=59.67  Aligned_cols=156  Identities=16%  Similarity=0.246  Sum_probs=101.9

Q ss_pred             CCHHHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCC
Q ss_conf             66243899855789995878438999999867998899998898999988999998066452225302004442353100
Q gi|255764482|r    2 ILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENR   81 (225)
Q Consensus         2 lLa~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~   81 (225)
                      ++++....+.+.+|||.-+|||.=++-.+...+..+|+.-|+||.+++..++|++.|+..    ++++.+.|....... 
T Consensus        42 l~~~~~~~~~~~~ilDalsasGiR~iRy~~E~~~~~v~~NDi~~~a~~~i~~N~~~N~~~----~~~v~~~dAn~lm~~-  116 (376)
T PRK04338         42 LALKAFGPKRRKSVLDALSASGIRGIRYALETGVEKVILNDINPDAVELIKKNLELNGLE----NAEVFNEDANVLLHE-  116 (376)
T ss_pred             HHHHHHHCCCCCEEEECCCCCCHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHHCCC----CEEEECCCHHHHHHH-
T ss_conf             999997420697687406765499999987279987999569999999999999982998----269813248999983-


Q ss_pred             CCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEEC----------CH----
Q ss_conf             0012357652057722654464465478854556520566898999999998624698378702----------88----
Q gi|255764482|r   82 NLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIA----------RP----  147 (225)
Q Consensus        82 ~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~----------~~----  147 (225)
                           ....||+|=-+| |+.                     ...|+..|.+.++.||.+++..          |.    
T Consensus       117 -----~~~~fD~IDlDP-fGS---------------------p~pflDsAi~~v~~~GlL~vTaTD~a~L~G~~~~~~~r  169 (376)
T PRK04338        117 -----NERKFDVVDIDP-FGS---------------------PAPFLDSAIRALRRGGLLCVTATDTAVLCGAYPKSCLR  169 (376)
T ss_pred             -----CCCCCCEEEECC-CCC---------------------CCHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCHHHHH
T ss_conf             -----787587786789-999---------------------20879999998403988999946861004888046878


Q ss_pred             -------------HHHHHH-HHHHH--CCCCCEEEEEECCCCCCCCEEEEEEEEECCC
Q ss_conf             -------------889999-99852--1788469998145896983099999997788
Q gi|255764482|r  148 -------------QSLIQI-VNACA--RRIGSLEITPLHPREGECASRILVTGRKGMR  189 (225)
Q Consensus       148 -------------~~l~~~-l~~~~--~~~~~~~i~~v~~~~~~~~~~vlv~~~k~~~  189 (225)
                                   |.--.+ +....  ..-....+.|+.+....--.||+++..|+.+
T Consensus       170 ~Yga~~~~~~~~hE~glRiLl~~i~r~Aa~~~~~i~PllS~~~~hy~Rv~vrV~~~~~  227 (376)
T PRK04338        170 KYGAVPLKTEFYHEMGLRILIGYVAREAAKYDKGLKPLLSHVTDHYYRVFLKVERGAK  227 (376)
T ss_pred             HHCCEECCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEEECCEEEEEEEEECCHH
T ss_conf             7177632571357788999999999999983885389999860758999999806778


No 153
>TIGR00080 pimt protein-L-isoaspartate O-methyltransferase; InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase () (PCMT)  (which is also known as L-isoaspartyl protein carboxyl methyltransferase) is an enzyme that catalyzes the transfer of a methyl group from S- adenosylmethionine to the free carboxyl groups of D-aspartyl or L-isoaspartyl residues in a variety of peptides and proteins. The enzyme does not act on normal L-aspartyl residues L-isoaspartyl and D-aspartyl are the products of the spontaneous deamidation and/or isomerization of normal L-aspartyl and L- asparaginyl residues in proteins. PCMT plays a role in the repair and/or degradation of these damaged proteins; the enzymatic methyl esterification of the abnormal residues can lead to their conversion to normal L-aspartyl residues. The SAM domain is present in most of these proteins.; GO: 0004719 protein-L-isoaspartate (D-aspartate) O-methyltransferase activity, 0006464 protein modification process.
Probab=98.60  E-value=1.2e-07  Score=62.28  Aligned_cols=107  Identities=17%  Similarity=0.229  Sum_probs=73.5

Q ss_pred             HCC--CCCCCEEEEECCCHHHHHHHHHHHCC-CCEEEEEECCHHHHHHHHHHHHHHCCC-CCCCCCEEECCCCCCCCCCC
Q ss_conf             389--98557899958784389999998679-988999988989999889999980664-52225302004442353100
Q gi|255764482|r    6 LVN--ATGSFHLADLGAGAGAAGLAVASRLH-EAQILLAERSPLMAHYARKTLALPANA-QISKRISLIEVDVTLVGENR   81 (225)
Q Consensus         6 ~~~--~~~~~~VLDlGcG~G~~~l~la~r~~-~~~v~gvD~~~~~~~~A~~n~~~~~~~-~~~~~~~~~~~D~~~~~~~~   81 (225)
                      +..  .+++.+|||+|||||..+.++|+-+. +..|++||.=|.....|++|++.+... -.-+++.+..+|=...-   
T Consensus        75 yL~nhL~~~~~vLeiG~GSGY~aavlA~~v~~~G~V~SiEri~~L~~~A~~~Lk~hhseqL~~~NV~v~~GDG~~G~---  151 (228)
T TIGR00080        75 YLENHLKPGAKVLEIGTGSGYQAAVLAEIVGRDGLVVSIERIPELVEKARRRLKKHHSEQLGLDNVIVIEGDGRQGW---  151 (228)
T ss_pred             HHHHHCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEEECHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCH---
T ss_conf             88852140355665047855899999998713971899853578899999876543144406886589977886571---


Q ss_pred             CCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEE
Q ss_conf             00123576520577226544644654788545565205668989999999986246983787
Q gi|255764482|r   82 NLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSL  143 (225)
Q Consensus        82 ~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~  143 (225)
                          ....-||-|+...     ..               ..    +=+...+.|++||++.+
T Consensus       152 ----~~~APYd~I~~~A-----A~---------------k~----iP~AL~~QL~eGG~L~~  185 (228)
T TIGR00080       152 ----EEKAPYDAILVTA-----AA---------------KE----IPKALIDQLEEGGILVL  185 (228)
T ss_pred             ----HHCCCCCEEEEEC-----CC---------------CC----CCHHHHHHHHHCCEEEE
T ss_conf             ----0248835277523-----78---------------98----76578999972898862


No 154
>COG4076 Predicted RNA methylase [General function prediction only]
Probab=98.58  E-value=1.1e-07  Score=62.51  Aligned_cols=100  Identities=21%  Similarity=0.275  Sum_probs=74.7

Q ss_pred             CCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             57899958784389999998679988999988989999889999980664522253020044423531000012357652
Q gi|255764482|r   12 SFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFY   91 (225)
Q Consensus        12 ~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~f   91 (225)
                      .+.+.|+|+|+|.+|+..|+.  .-+|+++|.||....+|.+|+..++.++    ++++++|..+...         +..
T Consensus        33 ~d~~~DLGaGsGiLs~~Aa~~--A~rViAiE~dPk~a~~a~eN~~v~g~~n----~evv~gDA~~y~f---------e~A   97 (252)
T COG4076          33 EDTFADLGAGSGILSVVAAHA--AERVIAIEKDPKRARLAEENLHVPGDVN----WEVVVGDARDYDF---------ENA   97 (252)
T ss_pred             HHCEEECCCCCCHHHHHHHHH--HCEEEEEECCCHHHHHHHHCCCCCCCCC----EEEEECCCCCCCC---------CCC
T ss_conf             410563468863288988753--2027887418078777650577788764----6898055321332---------345


Q ss_pred             CEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEE
Q ss_conf             057722654464465478854556520566898999999998624698378
Q gi|255764482|r   92 DHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLS  142 (225)
Q Consensus        92 Dlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~  142 (225)
                      |.|+|..=                ...-....+-..+..+...||..++..
T Consensus        98 DvvicEml----------------DTaLi~E~qVpV~n~vleFLr~d~tii  132 (252)
T COG4076          98 DVVICEML----------------DTALIEEKQVPVINAVLEFLRYDPTII  132 (252)
T ss_pred             CEEHHHHH----------------HHHHHCCCCCHHHHHHHHHHHCCCCCC
T ss_conf             34087776----------------677633421289999999863388252


No 155
>pfam02527 GidB rRNA small subunit methyltransferase G. This is a family of bacterial glucose inhibited division proteins these are probably involved in the regulation of cell devision. GidB has been shown to be a methyltransferase G specific to the rRNA small subunit. Previously identified as a glucose-inhibited division protein B that appears to be present and in a single copy in all complete eubacterial genomes so far sequenced. GidB specifically methylates the N7 position of a guanosine in 16S rRNA.
Probab=98.55  E-value=4.3e-06  Score=53.62  Aligned_cols=102  Identities=15%  Similarity=0.221  Sum_probs=78.2

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             55789995878438999999867998899998898999988999998066452225302004442353100001235765
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNF   90 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~   90 (225)
                      .+.+++|+|+|.|.=++.+|-.+|+.+++.+|.+..-+.-.+.-+...+..+    +++.+..+....        ...+
T Consensus        48 ~~~~ilDiGSGaGfPGi~LAI~~p~~~~~LvEs~~KK~~FL~~v~~~L~L~n----v~v~~~R~E~~~--------~~~~  115 (184)
T pfam02527        48 IRIKVADVGSGAGFPGIPLAIAFPDKKLTLLESLLKKINFLEELKKELNLEN----VTIVHARAEEYQ--------HEEQ  115 (184)
T ss_pred             CCCEEEECCCCCCCHHHHHHHHCCCCEEEEEECHHHHHHHHHHHHHHCCCCC----EEEEECCHHHCC--------CCCC
T ss_conf             7986883479888467999996778559999282899999999999859997----699956044146--------4467


Q ss_pred             CCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECC
Q ss_conf             20577226544644654788545565205668989999999986246983787028
Q gi|255764482|r   91 YDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIAR  146 (225)
Q Consensus        91 fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~  146 (225)
                      ||.|++-                      .-.....+++.+..+++++|++.+.--
T Consensus       116 ~D~v~aR----------------------A~a~l~~ll~~~~~~l~~~g~~i~~KG  149 (184)
T pfam02527       116 YDVITSR----------------------AVASLNELTEWALPLLKPGGYFLAYKG  149 (184)
T ss_pred             CCEEEEC----------------------HHCCHHHHHHHHHHHCCCCCEEEEECC
T ss_conf             8789981----------------------005799999999986388989999889


No 156
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism]
Probab=98.53  E-value=8.6e-07  Score=57.54  Aligned_cols=116  Identities=20%  Similarity=0.271  Sum_probs=87.6

Q ss_pred             CHHHCCCCCCCEEEEECCCHHHHHHHHHHH-CCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCC
Q ss_conf             624389985578999587843899999986-7998899998898999988999998066452225302004442353100
Q gi|255764482|r    3 LASLVNATGSFHLADLGAGAGAAGLAVASR-LHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENR   81 (225)
Q Consensus         3 La~~~~~~~~~~VLDlGcG~G~~~l~la~r-~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~   81 (225)
                      |++.+.++.|--|||+|-|+|.++-++..+ .+...++++|.|++-+....+..         +-.+++++|..+.... 
T Consensus        40 M~s~I~pesglpVlElGPGTGV~TkaIL~~gv~~~~L~~iE~~~dF~~~L~~~~---------p~~~ii~gda~~l~~~-  109 (194)
T COG3963          40 MASVIDPESGLPVLELGPGTGVITKAILSRGVRPESLTAIEYSPDFVCHLNQLY---------PGVNIINGDAFDLRTT-  109 (194)
T ss_pred             HHHCCCCCCCCEEEEECCCCCHHHHHHHHCCCCCCCEEEEEECHHHHHHHHHHC---------CCCCCCCCCHHHHHHH-
T ss_conf             984348445976477769866768999965799543689982779999999758---------8751305405657877-


Q ss_pred             CCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             0012357652057722654464465478854556520566898999999998624698378702
Q gi|255764482|r   82 NLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIA  145 (225)
Q Consensus        82 ~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~  145 (225)
                       +.......||.|+|--|...-.                ...-.++++.....|.+||.++.+-
T Consensus       110 -l~e~~gq~~D~viS~lPll~~P----------------~~~~iaile~~~~rl~~gg~lvqft  156 (194)
T COG3963         110 -LGEHKGQFFDSVISGLPLLNFP----------------MHRRIAILESLLYRLPAGGPLVQFT  156 (194)
T ss_pred             -HHHCCCCEEEEEEECCCCCCCC----------------HHHHHHHHHHHHHHCCCCCEEEEEE
T ss_conf             -8652797401688656002486----------------7789999999998568997279998


No 157
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane]
Probab=98.53  E-value=5.5e-06  Score=52.97  Aligned_cols=98  Identities=16%  Similarity=0.292  Sum_probs=76.0

Q ss_pred             CCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             57899958784389999998679988999988989999889999980664522253020044423531000012357652
Q gi|255764482|r   12 SFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFY   91 (225)
Q Consensus        12 ~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~f   91 (225)
                      +.+++|+|+|.|.=++.+|--+|+.+++-+|....-++-.+.-....+.+|    ++++++.++......      .. |
T Consensus        68 ~~~~~DIGSGaGfPGipLAI~~p~~~vtLles~~Kk~~FL~~~~~eL~L~n----v~i~~~RaE~~~~~~------~~-~  136 (215)
T COG0357          68 AKRVLDIGSGAGFPGIPLAIAFPDLKVTLLESLGKKIAFLREVKKELGLEN----VEIVHGRAEEFGQEK------KQ-Y  136 (215)
T ss_pred             CCEEEEECCCCCCCHHHHHHHCCCCCEEEECCCCHHHHHHHHHHHHHCCCC----EEEEHHHHHHCCCCC------CC-C
T ss_conf             887998579999731768885668818997167507999999999859997----498631276601446------65-7


Q ss_pred             CEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEE
Q ss_conf             057722654464465478854556520566898999999998624698378
Q gi|255764482|r   92 DHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLS  142 (225)
Q Consensus        92 Dlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~  142 (225)
                      |.|.+-                      .-.....+.+.+..++|+||.+.
T Consensus       137 D~vtsR----------------------Ava~L~~l~e~~~pllk~~g~~~  165 (215)
T COG0357         137 DVVTSR----------------------AVASLNVLLELCLPLLKVGGGFL  165 (215)
T ss_pred             CEEEEE----------------------EECCHHHHHHHHHHHCCCCCCCH
T ss_conf             589854----------------------20256889999998434688320


No 158
>pfam08003 Methyltransf_9 Protein of unknown function (DUF1698). This family contains many hypothetical proteins. It also includes two putative methyltransferase proteins.
Probab=98.52  E-value=2.1e-06  Score=55.31  Aligned_cols=110  Identities=14%  Similarity=0.096  Sum_probs=66.5

Q ss_pred             HHHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC
Q ss_conf             24389985578999587843899999986799889999889899998899999806645222530200444235310000
Q gi|255764482|r    4 ASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL   83 (225)
Q Consensus         4 a~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~   83 (225)
                      +..+..-+|.+|||+|||+|....-+.... ...|+|+|=+..-+-  +.-+-.+ ....+.++.+...-+++..     
T Consensus       108 ~~~i~~L~gk~VlDVGcgNGYy~~RMlg~g-a~~viGiDPs~lf~~--QF~ai~~-~~~~~~~~~~lPlg~E~lp-----  178 (315)
T pfam08003       108 LPHLSPLKGRTILDVGCGNGYHMWRMLGEG-AALVVGIDPSELFLC--QFEAVRK-LLGNDQRAHLLPLGIEQLP-----  178 (315)
T ss_pred             HHHHCCCCCCEEEECCCCCHHHHHHHHHCC-CCEEEEECCHHHHHH--HHHHHHH-HCCCCCCEEEECCCHHHCC-----
T ss_conf             734224268988751778649999862239-987998898199999--9999999-7089875688536765486-----


Q ss_pred             CCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEE
Q ss_conf             123576520577226544644654788545565205668989999999986246983787
Q gi|255764482|r   84 AGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSL  143 (225)
Q Consensus        84 ~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~  143 (225)
                       .  ...||.|.|.--.++                  ..+..+.+......|+|||.+.+
T Consensus       179 -~--~~~FDtVFsMGVLYH------------------rrsP~~hL~~Lk~~L~~gGeLvL  217 (315)
T pfam08003       179 -A--LEAFDTVFSMGVLYH------------------RRSPLDHLLQLKDQLVKGGELVL  217 (315)
T ss_pred             -C--CCCCCEEEEEEEEEC------------------CCCHHHHHHHHHHHCCCCCEEEE
T ss_conf             -6--342155776544432------------------68989999999985287978999


No 159
>pfam06080 DUF938 Protein of unknown function (DUF938). This family consists of several hypothetical proteins from both prokaryotes and eukaryotes. The function of this family is unknown.
Probab=98.49  E-value=1.3e-06  Score=56.50  Aligned_cols=116  Identities=14%  Similarity=0.125  Sum_probs=75.6

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             85578999587843899999986799889999889899998899999806645222530200444235310000123576
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNN   89 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~   89 (225)
                      ..+.+|||+|+|||-.....|+++|...-.-.|.++...+--+..+...+..|...-   +.-|+....+.  +.....+
T Consensus        24 ~~~~~VLEIaSGTGQHav~fA~~lP~l~WqPSD~~~~~~~sI~aw~~~~~l~Nl~~P---~~LDv~~~~w~--~~~~~~~   98 (201)
T pfam06080        24 KTTERVLEIASGTGQHAVFFAPLLPNLTWQPSDPDPNLRGSIAAWADQQGLRNLRPP---LHLDVTRPPWP--VEAPAPA   98 (201)
T ss_pred             CCCCCEEEECCCCHHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHHHHCCCCCCCCC---EEEECCCCCCC--CCCCCCC
T ss_conf             478857997687269999999878998851588887789999999874377766887---37632789987--5556676


Q ss_pred             CCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECC
Q ss_conf             520577226544644654788545565205668989999999986246983787028
Q gi|255764482|r   90 FYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIAR  146 (225)
Q Consensus        90 ~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~  146 (225)
                      .||.|++---                .|...-.....+++.+.++|++||.+++=-|
T Consensus        99 ~~dai~~iN~----------------lHI~pw~~~~~lf~ga~~~L~~gG~l~lYGP  139 (201)
T pfam06080        99 SYDAIFSINM----------------IHISPWSCVEGLFRGAGRLLPPGGVLYIYGP  139 (201)
T ss_pred             CCCHHHHHHH----------------HHHCCHHHHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             6002330025----------------7737899999999999998515882687465


No 160
>PRK01581 speE spermidine synthase; Validated
Probab=98.49  E-value=1.5e-06  Score=56.11  Aligned_cols=115  Identities=17%  Similarity=0.174  Sum_probs=82.8

Q ss_pred             CCCCCEEEEECCCHHHHHHHHHHHCCCC-EEEEEECCHHHHHHHHHH---HHHHCCCCCCCCCEEECCCCCCCCCCCCCC
Q ss_conf             9855789995878438999999867998-899998898999988999---998066452225302004442353100001
Q gi|255764482|r    9 ATGSFHLADLGAGAGAAGLAVASRLHEA-QILLAERSPLMAHYARKT---LALPANAQISKRISLIEVDVTLVGENRNLA   84 (225)
Q Consensus         9 ~~~~~~VLDlGcG~G~~~l~la~r~~~~-~v~gvD~~~~~~~~A~~n---~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~   84 (225)
                      ....++||=+|-|-|...--+. |+++. +|+-||+||.|+++++.+   .++|+..-.+.|+++++.|...+..     
T Consensus       137 ~~~~~rVLILGGGDGLAlREVL-Kyp~Ve~VTLVDLDP~mt~Lar~~p~L~~LN~~AL~DPRV~Vvn~DAf~wL~-----  210 (363)
T PRK01581        137 VIDPKRVLILGGGDGLALREVL-KYETVLHVDLVDLDGSMIDMARNVPELVSLNKSAFFDNRVNTHVCDAKEFLS-----  210 (363)
T ss_pred             CCCCCEEEEEECCCHHHHHHHH-CCCCCCEEEEEECCHHHHHHHHHCHHHHHHHHHHCCCCCEEEEECCHHHHHH-----
T ss_conf             7887738998076439999987-1798562789956999999875197998751200149804999210899986-----


Q ss_pred             CCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEE
Q ss_conf             23576520577226544644654788545565205668989999999986246983787
Q gi|255764482|r   85 GLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSL  143 (225)
Q Consensus        85 ~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~  143 (225)
                       ...+.||.|+...|==        +. ...    ...--..|...+.++|.|+|.+.+
T Consensus       211 -~~~~~FDvIIVDlPDP--------~n-~~L----~KLYS~eFY~Ll~~~La~dG~~vV  255 (363)
T PRK01581        211 -SPSSLYDVIIIDFPDP--------AT-ELL----STLYTSELFARIATFLTEDGAFVC  255 (363)
T ss_pred             -CCCCCCCEEEEECCCC--------CC-HHH----HHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             -1675442899958999--------86-246----667359999999986198853999


No 161
>TIGR00095 TIGR00095 putative methyltransferase; InterPro: IPR004398 This is a family of conserved hypothetical proteins, which includes a putative methylase..
Probab=98.46  E-value=1.2e-06  Score=56.68  Aligned_cols=119  Identities=17%  Similarity=0.271  Sum_probs=78.4

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHC----CCCCCCCCEEECCCCCCCCCCCCCCCC
Q ss_conf             5578999587843899999986799889999889899998899999806----645222530200444235310000123
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPA----NAQISKRISLIEVDVTLVGENRNLAGL   86 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~----~~~~~~~~~~~~~D~~~~~~~~~~~~~   86 (225)
                      .+.++||+++|+|++++-.-.|. ..+++.||.|........+|+...+    ...  ....+...+.....    ....
T Consensus        55 ~~~~~LD~FAGsG~LG~EALSRg-A~~~~f~E~d~~~~~~l~~N~~~L~nrlk~~~--~~~~~~~~~~~~~~----~~~~  127 (210)
T TIGR00095        55 VGAHFLDLFAGSGSLGLEALSRG-AKSAVFVEQDKKVAQTLKENLSTLKNRLKLSG--EQATVLNDAERALL----FLAK  127 (210)
T ss_pred             CCCEEEEEECCCHHHHHHHHHHC-CCEEEEEECCHHHHHHHHHHHHHHHHHHCCCC--CEEEEHHHHHHHHH----HHHC
T ss_conf             68727885406446537664014-16237873686799999999999888715853--00000002566657----7651


Q ss_pred             CCC-CCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECC
Q ss_conf             576-520577226544644654788545565205668989999999986246983787028
Q gi|255764482|r   87 KNN-FYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIAR  146 (225)
Q Consensus        87 ~~~-~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~  146 (225)
                      ... .||.|...|||.......  +        .......+-++....+|+|+|.+++-++
T Consensus       128 ~~ts~~d~iylDPPf~~~~ad~--~--------~~l~l~~~alerl~~~L~~~~~i~ve~~  178 (210)
T TIGR00095       128 KQTSPFDIIYLDPPFNTGLADL--E--------AILELLGEALERLNKWLNPKGLIVVEYD  178 (210)
T ss_pred             CCCCCEEEEEECCCCCCCCCCH--H--------HHHHHHHHHHHHHHHHCCCCCEEEEEEC
T ss_conf             7996114787148888761037--9--------9999999999987310487857998634


No 162
>pfam06962 rRNA_methylase Putative rRNA methylase. This family contains a number of putative rRNA methylases. Note that many family members are hypothetical proteins.
Probab=98.45  E-value=5.9e-06  Score=52.81  Aligned_cols=129  Identities=11%  Similarity=0.124  Sum_probs=80.6

Q ss_pred             EEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHH
Q ss_conf             89999889899998899999806645222530200444235310000123576520577226544644654788545565
Q gi|255764482|r   37 QILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEA  116 (225)
Q Consensus        37 ~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a  116 (225)
                      +|+|+|+++++++.+++.+...+   ...++++++..-.+....     .+.+..|.++-|--|.++++.....      
T Consensus         1 hV~aFDIQ~~Ai~~T~~rL~~~~---~~~~v~li~~~He~l~~~-----v~~~~i~~~~FNLGYLPggDk~i~T------   66 (140)
T pfam06962         1 HVYAFDIQEEALENTKEKLEQAG---LSEIVELILDSHENIDEY-----IPEGPVKAAIFNLGYLPGGDKSITT------   66 (140)
T ss_pred             CEEEEECHHHHHHHHHHHHHHCC---CCCCEEEEECCHHHHHHH-----CCCCCCCEEEEECCCCCCCCCCCEE------
T ss_conf             95799609999999999999659---875689997798889863-----7646766899966768899987587------


Q ss_pred             HCCCCCCHHHHHHHHHHHCCCCCEEEEEC-C--H------HHHHHHHHHHHCCC-CCEEEEEECCCCCCCCEEEEEE
Q ss_conf             20566898999999998624698378702-8--8------88999999852178-8469998145896983099999
Q gi|255764482|r  117 HVMLEDSFEKWIRTACAIMRSSGQLSLIA-R--P------QSLIQIVNACARRI-GSLEITPLHPREGECASRILVT  183 (225)
Q Consensus       117 ~~~~~~~~~~~~~~a~~lLkpgG~~~~i~-~--~------~~l~~~l~~~~~~~-~~~~i~~v~~~~~~~~~~vlv~  183 (225)
                         ....-..-++.+..+|+|||.++++. |  +      +.+.+.+..+.... ...+.. +.-+.+.|+..+++|
T Consensus        67 ---~~~tTi~Al~~al~lL~~gG~i~i~~Y~GH~gG~eE~~aV~~~~~~L~~~~~~V~~~~-~~N~~~~pP~l~~Ie  139 (140)
T pfam06962        67 ---KPDTTLEAIKKLLELLKPGGLIILVIYHGHEEGKKEKDAVLDFVSNLDQKKWNVLQYQ-FINQVNAPPFLIAIE  139 (140)
T ss_pred             ---CCHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHHHHHCCHHHEEEEEEE-CCCCCCCCCEEEEEE
T ss_conf             ---7720999999999963669899999979999879999999999984896057999997-156899998899996


No 163
>pfam00891 Methyltransf_2 O-methyltransferase. This family includes a range of O-methyltransferases. These enzymes utilize S-adenosyl methionine.
Probab=98.35  E-value=4.5e-06  Score=53.45  Aligned_cols=100  Identities=15%  Similarity=0.253  Sum_probs=71.8

Q ss_pred             CCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCC
Q ss_conf             99855789995878438999999867998899998898999988999998066452225302004442353100001235
Q gi|255764482|r    8 NATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLK   87 (225)
Q Consensus         8 ~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~   87 (225)
                      ......+|+|+|.|.|.++..+++++|+.+++-+|. |..++.|+.          .+++++..+|++...        +
T Consensus        98 d~~~~~~vvDvGGG~G~~~~~i~~~~P~l~~~v~Dl-p~v~~~a~~----------~~rv~~~~gdff~~~--------P  158 (239)
T pfam00891        98 DFSGLSSLVDVGGGTGALAAAIVRAYPHIKGIVFDL-PHVIADAPS----------ADRVEFVGGDFFESV--------P  158 (239)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHCCCCEEEEEEC-HHHHHHCCC----------CCCEEEECCCCCCCC--------C
T ss_conf             766787689967981899999999889983898646-877862764----------685488448777788--------8


Q ss_pred             CCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             765205772265446446547885455652056689899999999862469837870
Q gi|255764482|r   88 NNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLI  144 (225)
Q Consensus        88 ~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i  144 (225)
                        ..|+++.---.+..                ....-..+++.+.+.|+|||++.++
T Consensus       159 --~aD~y~l~~vLH~w----------------~d~~~~~iL~~~~~al~~~grllI~  197 (239)
T pfam00891       159 --EADAILLKWVLHDW----------------SDEDCVKILKRCYEALPPGGKVIVV  197 (239)
T ss_pred             --CCCEEEEEHHHCCC----------------CHHHHHHHHHHHHHHCCCCCEEEEE
T ss_conf             --85177640143159----------------9999999999999977999889999


No 164
>pfam05219 DREV DREV methyltransferase. This family contains DREV protein homologues from several eukaryotes. The function of this protein is unknown. However, these proteins appear to be related to other methyltransferases (Bateman A pers obs).
Probab=98.28  E-value=9.2e-06  Score=51.73  Aligned_cols=96  Identities=17%  Similarity=0.137  Sum_probs=64.9

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             55789995878438999999867998899998898999988999998066452225302004442353100001235765
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNF   90 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~   90 (225)
                      ...++||+|+|.|.++..+|..+.  +|++.|.|+.|....++.    +       ++++..  ..+.       ....+
T Consensus        94 ~~~~LLDlGAGdG~VT~~la~~F~--~V~aTE~S~~Mr~rL~~r----g-------f~vl~~--~~~~-------~~~~~  151 (265)
T pfam05219        94 EPVTLLDLGAGDGEITLRMAPTFE--EVYATELSWTMRDRLKKK----N-------YNVLTE--IEWQ-------ETDVN  151 (265)
T ss_pred             CCCEEEEECCCCCHHHHHHHHHHC--EEEEEECCHHHHHHHHHC----C-------CEEEEE--HHCC-------CCCCC
T ss_conf             766478835899789999997523--588872789999999975----9-------868750--1203-------56874


Q ss_pred             CCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEE--ECC
Q ss_conf             20577226544644654788545565205668989999999986246983787--028
Q gi|255764482|r   91 YDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSL--IAR  146 (225)
Q Consensus        91 fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~--i~~  146 (225)
                      ||+|-|..--                  ........+++.+.+.|+|+|++.+  |+|
T Consensus       152 fDvIscLNvL------------------DRc~~P~~LL~~i~~~L~P~G~lilAvVlP  191 (265)
T pfam05219       152 LDLILCLNLL------------------DRCFDPFKLLEDIHLALAPNGRVIVALVLP  191 (265)
T ss_pred             EEEEHHHHHH------------------HCCCCHHHHHHHHHHHCCCCCEEEEEEEEC
T ss_conf             4554222445------------------313886999999997249996799999825


No 165
>PRK13255 thiopurine S-methyltransferase; Reviewed
Probab=98.27  E-value=7.8e-06  Score=52.12  Aligned_cols=114  Identities=16%  Similarity=0.088  Sum_probs=72.5

Q ss_pred             CCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHH--HHHHHHHHCCC------CCCCCCEEECCCCCCCC
Q ss_conf             89985578999587843899999986799889999889899998--89999980664------52225302004442353
Q gi|255764482|r    7 VNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHY--ARKTLALPANA------QISKRISLIEVDVTLVG   78 (225)
Q Consensus         7 ~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~--A~~n~~~~~~~------~~~~~~~~~~~D~~~~~   78 (225)
                      .+..++.||+=++||.+.-...||.+  +.+|+|+|+++.+++.  +..++......      -....+++.++|++...
T Consensus        33 L~~~~~~rVlVPlCGKs~Dm~wLa~~--G~~VvGvEls~~Av~~ff~e~~l~~~~~~~~~~~~y~~~~i~i~~gDfF~L~  110 (218)
T PRK13255         33 LALPAGSRVLVPLCGKSLDMLWLAEQ--GHEVLGVELSELAVEQFFAENGLTPQVRQSGEFEHYQAGEISLYCGDFFALT  110 (218)
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHC--CCEEEEEECHHHHHHHHHHHCCCCCCCCCCCCEEEEECCCEEEEECCCCCCC
T ss_conf             08788986999489867769999848--9726998352999999999738986301367603775388279966420278


Q ss_pred             CCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             100001235765205772265446446547885455652056689899999999862469837870
Q gi|255764482|r   79 ENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLI  144 (225)
Q Consensus        79 ~~~~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i  144 (225)
                      ..      ..+.||.|.--      +.....++          ..-.++.++...+|+|||+..++
T Consensus       111 ~~------~~g~~DaIyDR------aal~ALpp----------~~R~~Y~~~l~~ll~~g~~~LLi  154 (218)
T PRK13255        111 AA------DLADVDAVYDR------AALIALPE----------EMRERYVQQLAALLPAGCRGLLV  154 (218)
T ss_pred             HH------HCCCCCEEEEC------CCEECCCH----------HHHHHHHHHHHHHCCCCCCEEEE
T ss_conf             63------54774889975------38012898----------99999999999864998748999


No 166
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase; InterPro: IPR011869    This family consists exclusively of proteins believed to act as tRNA (uracil-5-)-methyltransferase. All members of this entry belong to the Proteobacteria. ; GO: 0009021 tRNA (uracil-5-)-methyltransferase activity, 0008033 tRNA processing.
Probab=98.27  E-value=2.2e-07  Score=60.83  Aligned_cols=116  Identities=20%  Similarity=0.296  Sum_probs=73.8

Q ss_pred             EEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCC-------CCCCCC--
Q ss_conf             89995878438999999867998899998898999988999998066452225302004442353-------100001--
Q gi|255764482|r   14 HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVG-------ENRNLA--   84 (225)
Q Consensus        14 ~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~-------~~~~~~--   84 (225)
                      =.||+-||.|.+|++||.++.  +|.|+||++..|+.|+.|++.|+..|+    .++.--.+.+.       ....+.  
T Consensus       206 DLLELYCGNGNFsLaLA~~f~--rVLATEiaK~SV~aAq~Ni~~N~idNv----~i~RlSAEEft~A~~~~R~F~RL~d~  279 (361)
T TIGR02143       206 DLLELYCGNGNFSLALAQNFE--RVLATEIAKPSVNAAQYNIAANKIDNV----QIIRLSAEEFTEAMNGVREFRRLKDG  279 (361)
T ss_pred             CCCEEECCCCCCHHHHHHHHH--HHHHHHCCCCCHHHHHHHHHCCCCCCE----EHHHHHHHHHHHHHCCCCCCCCCCCC
T ss_conf             201000267531044565333--455430240247999999871798831----01023279999986037765465668


Q ss_pred             --CCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHH
Q ss_conf             --23576520577226544644654788545565205668989999999986246983787028888999999852
Q gi|255764482|r   85 --GLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACA  158 (225)
Q Consensus        85 --~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~~l~~~l~~~~  158 (225)
                        ...+=.|..|+..||=                 .+.+.   +.++...+.   +-.+|+-+-|+-|.+=+..+.
T Consensus       280 gIdL~~Y~f~tiFVDPPR-----------------aGlD~---~t~~Lv~~y---~rIlYISCNP~TL~~NL~~L~  332 (361)
T TIGR02143       280 GIDLKSYNFNTIFVDPPR-----------------AGLDP---DTVKLVQKY---ERILYISCNPETLKENLEQLS  332 (361)
T ss_pred             CCCCCCCCCCEEEECCCC-----------------CCCCH---HHHHHHHHC---CCEEEEECCHHHHHHHHHHHH
T ss_conf             863342025602677988-----------------88898---999999625---987998469689999999886


No 167
>pfam02005 TRM N2,N2-dimethylguanosine tRNA methyltransferase. This enzyme EC:2.1.1.32 used S-AdoMet to methylate tRNA. The TRM1 gene of Saccharomyces cerevisiae is necessary for the N2,N2-dimethylguanosine modification of both mitochondrial and cytoplasmic tRNAs. The enzyme is found in both eukaryotes and archaebacteria
Probab=98.26  E-value=1.3e-05  Score=50.81  Aligned_cols=105  Identities=12%  Similarity=0.229  Sum_probs=78.4

Q ss_pred             CCCCCEEEEECCCHHHHHHHHHHHCCC-CEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCC
Q ss_conf             985578999587843899999986799-8899998898999988999998066452225302004442353100001235
Q gi|255764482|r    9 ATGSFHLADLGAGAGAAGLAVASRLHE-AQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLK   87 (225)
Q Consensus         9 ~~~~~~VLDlGcG~G~~~l~la~r~~~-~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~   87 (225)
                      .+.+-+|||.-+|+|.=++-.+...++ .+|+.-|+||.+++..++|++.|+.   ++.+.+.+.|......      ..
T Consensus        47 ~~~~~~iLDalsasGiR~iRya~E~~~~~~V~~NDi~~~a~~~i~~N~~lN~~---~~~~~~~~~DAn~lm~------~~  117 (375)
T pfam02005        47 LGRGIIVLDALSASGIRAIRFALEVPGVEEVFANDISPKAVELIKENVKLNEV---ENIVVINGDDANMLMR------EN  117 (375)
T ss_pred             CCCCCEEEECCCCCHHHHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHHCCC---CCEEEECHHHHHHHHH------HC
T ss_conf             25886697546754199999997469986699955998999999998886599---8737875475999998------55


Q ss_pred             CCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             765205772265446446547885455652056689899999999862469837870
Q gi|255764482|r   88 NNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLI  144 (225)
Q Consensus        88 ~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i  144 (225)
                      ...||+|=-+| |+.                     ...|+..|.+.++.||.+++.
T Consensus       118 ~~~fD~IDlDP-fGS---------------------p~pfldsAi~av~~~GlL~vT  152 (375)
T pfam02005       118 HRRFDVIDLDP-FGS---------------------PAPFLDSAVQSVKRGGLLCVT  152 (375)
T ss_pred             CCCCCEEEECC-CCC---------------------CCHHHHHHHHHHCCCCEEEEE
T ss_conf             88675686789-999---------------------217799999983159889999


No 168
>KOG1661 consensus
Probab=98.24  E-value=2.5e-06  Score=54.89  Aligned_cols=105  Identities=15%  Similarity=0.193  Sum_probs=66.4

Q ss_pred             CCCCCEEEEECCCHHHHHHHHHHHCC--CCEEEEEECCHHHHHHHHHHHHHHCCCC------CCCCCEEECCCCCCCCCC
Q ss_conf             98557899958784389999998679--9889999889899998899999806645------222530200444235310
Q gi|255764482|r    9 ATGSFHLADLGAGAGAAGLAVASRLH--EAQILLAERSPLMAHYARKTLALPANAQ------ISKRISLIEVDVTLVGEN   80 (225)
Q Consensus         9 ~~~~~~VLDlGcG~G~~~l~la~r~~--~~~v~gvD~~~~~~~~A~~n~~~~~~~~------~~~~~~~~~~D~~~~~~~   80 (225)
                      .+||.+.||+|+|+|.++.+.+....  +....|||.-|+.++.+++|+...-...      ...+..++.+|-+.... 
T Consensus        80 L~pG~s~LdvGsGSGYLt~~~~~mvg~~g~~~~GIEh~~eLVe~Sk~nl~k~i~~~e~~~~~~~~~l~ivvGDgr~g~~-  158 (237)
T KOG1661          80 LQPGASFLDVGSGSGYLTACFARMVGATGGNVHGIEHIPELVEYSKKNLDKDITTSESSSKLKRGELSIVVGDGRKGYA-  158 (237)
T ss_pred             HCCCCCEEECCCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCHHHHHHCCCCEEEEECCCCCCCC-
T ss_conf             2347310133787408999999994577766514441599999999877765047304556414864799677623477-


Q ss_pred             CCCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             0001235765205772265446446547885455652056689899999999862469837870
Q gi|255764482|r   81 RNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLI  144 (225)
Q Consensus        81 ~~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i  144 (225)
                            ....||-|.+-                        ....+.-+.....|++||++.+-
T Consensus       159 ------e~a~YDaIhvG------------------------Aaa~~~pq~l~dqL~~gGrllip  192 (237)
T KOG1661         159 ------EQAPYDAIHVG------------------------AAASELPQELLDQLKPGGRLLIP  192 (237)
T ss_pred             ------CCCCCCEEEEC------------------------CCCCCCHHHHHHHHCCCCEEEEE
T ss_conf             ------56876657876------------------------67622479999863438728986


No 169
>TIGR00138 gidB methyltransferase GidB; InterPro: IPR003682   GidB (glucose-inhibited division protein B) appears to be present and in a single copy in all complete eubacterial genomes so far. Its mode of action is unknown, but a methytransferase fold is reported from the crystal structure. It may be a family of bacterial glucose inhibited division proteins that are involved in the regulation of cell division .; GO: 0007049 cell cycle.
Probab=98.23  E-value=1.3e-05  Score=50.87  Aligned_cols=112  Identities=14%  Similarity=0.213  Sum_probs=83.4

Q ss_pred             CCCEEEEECCCHHHHHHHHH-HHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             55789995878438999999-86799889999889899998899999806645222530200444235310000123576
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVA-SRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNN   89 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la-~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~   89 (225)
                      ++.+++|+|+|+|.=++.++ --.|+.+++-+|.+..=++-.+.-+...+.+|    ++++++.+.... ..    ....
T Consensus        49 ~~~~~~DiGSG~GfPGipL~Ci~~p~~~~~Lles~~KK~~FL~~v~~~L~L~N----~~i~~~R~E~~g-~~----~~~~  119 (197)
T TIGR00138        49 TGKKVIDIGSGAGFPGIPLACILRPELKLTLLESNKKKVNFLKEVKKELGLNN----VEILNGRVEDLG-SK----QHEE  119 (197)
T ss_pred             CCCEEEEECCCCCHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHHHCCCC----CHHEEHHHHHCC-CC----CCCC
T ss_conf             33126773478971456534220576428984277406899999999838998----242001125505-54----5333


Q ss_pred             CCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHHHHHHH
Q ss_conf             5205772265446446547885455652056689899999999862469837870288889999
Q gi|255764482|r   90 FYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQI  153 (225)
Q Consensus        90 ~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~~l~~~  153 (225)
                      +||.|++-+                      -.....+.+.+..++++||.+.+.-=..-.+|+
T Consensus       120 ~~D~~~~RA----------------------l~~l~~~~e~~~~L~~~~G~~~~~KG~~~~~E~  161 (197)
T TIGR00138       120 QFDVITSRA----------------------LVSLNELLELTLPLLKVGGYFLAYKGKYLEDEI  161 (197)
T ss_pred             CCCEEEECC----------------------CHHHHHHHHHHHHCCCCCCEEEEECCCCHHHHH
T ss_conf             578789803----------------------102468888663037889789997086658887


No 170
>pfam08123 DOT1 Histone methylation protein DOT1. The DOT1 domain regulates gene expression by methylating histone H3. H3 methylation by DOT1 has been shown to be required for the DNA damage checkpoint in yeast.
Probab=98.15  E-value=3.1e-05  Score=48.73  Aligned_cols=114  Identities=12%  Similarity=-0.000  Sum_probs=76.5

Q ss_pred             HHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHH-------CCCCCCCCCEEECCCCCCC
Q ss_conf             438998557899958784389999998679988999988989999889999980-------6645222530200444235
Q gi|255764482|r    5 SLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALP-------ANAQISKRISLIEVDVTLV   77 (225)
Q Consensus         5 ~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~-------~~~~~~~~~~~~~~D~~~~   77 (225)
                      ..++.++.+..+|+|||.|...+.+|....-...+|+|+.+....+|+.+.+..       +.  ....+++..+|+...
T Consensus        36 ~~~~l~~~dvF~DLGSGVGnvv~QaAl~tgc~~s~GiEi~~~~a~~A~~~~~~~~~~~~~~G~--~~~~~~l~~gdFl~~  113 (205)
T pfam08123        36 DKCNLGPQDVFVDLGSGVGNCVLQAALEFGCKLSFGCEIMDNASNLAELQDEEFKKRCKLFGK--KLGKIEFIRGSFLDN  113 (205)
T ss_pred             HHHCCCCCCEEEECCCCCCHHHHHHHHHHCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHHCC--CCCCEEEEECCCCCC
T ss_conf             983989768899858883299999998709653888886566899999999999999999588--768738997777885


Q ss_pred             CCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEE
Q ss_conf             310000123576520577226544644654788545565205668989999999986246983787
Q gi|255764482|r   78 GENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSL  143 (225)
Q Consensus        78 ~~~~~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~  143 (225)
                      .....    .....|+|+.|.=-|.                   ..+..-+.....-||+|-++.-
T Consensus       114 ~~~~~----~~~~a~VI~vNN~~F~-------------------~~Ln~~L~e~f~~lk~GtkIVS  156 (205)
T pfam08123       114 ERVEE----IIPEADVILVNNFAFD-------------------PELNLQLKEMLQDLKDGCKIIS  156 (205)
T ss_pred             HHHHH----HHCCCCEEEEECCCCC-------------------HHHHHHHHHHHHCCCCCCEEEE
T ss_conf             88998----6347988999432469-------------------8899999999972999888997


No 171
>COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only]
Probab=98.10  E-value=5.7e-05  Score=47.26  Aligned_cols=114  Identities=19%  Similarity=0.229  Sum_probs=81.6

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHCC-CCEEEEEECCHHHHHHHHHHHH---HHCCCCCCCCCEEECCCCCCCCCCCCCCC
Q ss_conf             8557899958784389999998679-9889999889899998899999---80664522253020044423531000012
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRLH-EAQILLAERSPLMAHYARKTLA---LPANAQISKRISLIEVDVTLVGENRNLAG   85 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~~-~~~v~gvD~~~~~~~~A~~n~~---~~~~~~~~~~~~~~~~D~~~~~~~~~~~~   85 (225)
                      +..++||=+|-|-|-..-.+- |+| -.+++-||.||.|++.+++|.-   .|+..-.+.|++++..|...+...     
T Consensus       288 ~~a~~vLvlGGGDGLAlRell-kyP~~~qI~lVdLDP~miela~~~~vlr~~N~~sf~dpRv~Vv~dDAf~wlr~-----  361 (508)
T COG4262         288 RGARSVLVLGGGDGLALRELL-KYPQVEQITLVDLDPRMIELASHATVLRALNQGSFSDPRVTVVNDDAFQWLRT-----  361 (508)
T ss_pred             CCCCEEEEECCCCHHHHHHHH-HCCCCCEEEEEECCHHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCHHHHHHH-----
T ss_conf             664269997287518799997-18885527897438899987300267666036776687569996547889974-----


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEE
Q ss_conf             3576520577226544644654788545565205668989999999986246983787
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSL  143 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~  143 (225)
                       ..+.||.+|.+-|--.     .    ...+    ..-..+|-..+.+.|+++|.+..
T Consensus       362 -a~~~fD~vIVDl~DP~-----t----ps~~----rlYS~eFY~ll~~~l~e~Gl~Vv  405 (508)
T COG4262         362 -AADMFDVVIVDLPDPS-----T----PSIG----RLYSVEFYRLLSRHLAETGLMVV  405 (508)
T ss_pred             -HCCCCCEEEEECCCCC-----C----CCHH----HHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             -1345557999689989-----9----5134----32108999999973375754999


No 172
>PRK13699 putative methylase; Provisional
Probab=98.10  E-value=9.8e-06  Score=51.58  Aligned_cols=83  Identities=11%  Similarity=0.116  Sum_probs=46.7

Q ss_pred             EECCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHH
Q ss_conf             20044423531000012357652057722654464465478854556520566898999999998624698378702888
Q gi|255764482|r   69 LIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQ  148 (225)
Q Consensus        69 ~~~~D~~~~~~~~~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~  148 (225)
                      ++++|....     +...+++++|+|++.|||+.........   .........-...++..+.|.||++|.++..+.-.
T Consensus         4 ii~GDcle~-----l~~lpd~SVDliiTDPPY~~g~~~~~~~---~~~~d~~~ew~~~~~~e~~Rvlk~~g~~~~~~~~~   75 (227)
T PRK13699          4 FILGNCVDV-----MARFPDNAVDFILTDPPYLVGFRDRQGR---TIAGDKTDEWLQPACNEMYRVLKKDALMVSFYGWN   75 (227)
T ss_pred             EEHHHHHHH-----HHHCCCCCCCEEEECCCCCCCCCCCCCC---CCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEECCC
T ss_conf             433019999-----9528887729799898998898788997---44576208999999999999956881699993310


Q ss_pred             HHHHHHHHHHC
Q ss_conf             89999998521
Q gi|255764482|r  149 SLIQIVNACAR  159 (225)
Q Consensus       149 ~l~~~l~~~~~  159 (225)
                      +....+..+..
T Consensus        76 ~~~~~~~~~~~   86 (227)
T PRK13699         76 RVDRFMAAWKN   86 (227)
T ss_pred             HHHHHHHHHHH
T ss_conf             04699999997


No 173
>PRK11524 putative methyltransferase; Provisional
Probab=98.09  E-value=9e-06  Score=51.77  Aligned_cols=78  Identities=12%  Similarity=0.151  Sum_probs=46.7

Q ss_pred             CCEEECCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             53020044423531000012357652057722654464465478854556520566898999999998624698378702
Q gi|255764482|r   66 RISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIA  145 (225)
Q Consensus        66 ~~~~~~~D~~~~~~~~~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~  145 (225)
                      ...++++|.....     ...+++++|+|++.|||..........+..  ....-..-...|+..+.|+|||+|.+++..
T Consensus         8 ~~kIy~gDcle~l-----k~lpd~SIDLIiTDPPYn~~k~y~~~~d~~--~~~~y~~~~~~~l~e~~RvLk~~Gsi~i~~   80 (284)
T PRK11524          8 AKTIIHGDALTEL-----KKIPSESVDLIFADPPYNIGKNFDGLIEKW--KEDLFIDWLYEVIDECHRVLKKQGTMYIMN   80 (284)
T ss_pred             CCEEEECCHHHHH-----HHCCCCCCCEEEECCCCCCCCCCCCCCCCC--CHHHHHHHHHHHHHHHHHHHCCCCCEEEEC
T ss_conf             9989953189998-----538557738799899998887578746777--989999999999999999834057459962


Q ss_pred             CHHHH
Q ss_conf             88889
Q gi|255764482|r  146 RPQSL  150 (225)
Q Consensus       146 ~~~~l  150 (225)
                      ..+.+
T Consensus        81 ~~~~~   85 (284)
T PRK11524         81 STENM   85 (284)
T ss_pred             CCCCC
T ss_conf             85525


No 174
>pfam05148 Methyltransf_8 Hypothetical methyltransferase. This family consists of several uncharacterized eukaryotic proteins which are related to methyltransferases pfam01209.
Probab=98.07  E-value=5.9e-05  Score=47.15  Aligned_cols=129  Identities=17%  Similarity=0.223  Sum_probs=77.9

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHCC-CCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             557899958784389999998679-9889999889899998899999806645222530200444235310000123576
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRLH-EAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNN   89 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~~-~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~   89 (225)
                      ....|.|+|||-+.++.    ..+ ..+|..+|.-..                   .-.+..+|+.+.+       ..++
T Consensus        67 ~~~vIaD~GCGdA~lA~----~~~~~~kV~SfDLva~-------------------n~~Vt~cDi~~~P-------L~d~  116 (214)
T pfam05148        67 GNGVIADLGCGEARIAF----RKREFENVHSFDLVAV-------------------NKRVIPCDMARVP-------LEDE  116 (214)
T ss_pred             CCEEEEECCCCHHHHHH----HCCCCCEEEEEECCCC-------------------CCCCCCCCCCCCC-------CCCC
T ss_conf             97189975886579998----6467873885132568-------------------9883513533687-------8877


Q ss_pred             CCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHHHHH---HHHHHHHCCCCCEEE
Q ss_conf             52057722654464465478854556520566898999999998624698378702888899---999985217884699
Q gi|255764482|r   90 FYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLI---QIVNACARRIGSLEI  166 (225)
Q Consensus        90 ~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~~l~---~~l~~~~~~~~~~~i  166 (225)
                      +.|.++.--                   .-...++.+|+..|.|.|||||.+.++--.+|+.   +....+.. .+..  
T Consensus       117 svDvaVfCL-------------------SLMGTN~~~fi~EA~RvLk~~G~L~IAEV~SRf~~~~~Fv~~~~~-~GF~--  174 (214)
T pfam05148       117 SVDVAVFCL-------------------SLMGTNIADFLKEANRILKNGGLLKIAEVRSRFPSVGLFERAFTK-LGFE--  174 (214)
T ss_pred             CEEEEEEEH-------------------HHHCCCHHHHHHHHHHHCCCCCEEEEEEEECCCCCHHHHHHHHHH-CCCE--
T ss_conf             263687758-------------------762887799999987603108789999974016898999999997-5976--


Q ss_pred             EEECCCCCCCCEEEEEEEEECCCCCCE
Q ss_conf             981458969830999999977888747
Q gi|255764482|r  167 TPLHPREGECASRILVTGRKGMRGQLR  193 (225)
Q Consensus       167 ~~v~~~~~~~~~~vlv~~~k~~~~~~~  193 (225)
                        +..........++++|+|.++.+.+
T Consensus       175 --~~~~d~~n~~F~~f~F~K~~~~~~k  199 (214)
T pfam05148       175 --VEHVDLSNAQFVLFEFQKTSRVGPK  199 (214)
T ss_pred             --EEEEECCCCEEEEEEEEECCCCCCC
T ss_conf             --7753068888999999986656756


No 175
>TIGR01177 TIGR01177 conserved hypothetical protein TIGR01177; InterPro: IPR005885    This family of largely hypothetical proteins is found exclusively in the Archaea and contain a putative RNA methylase domain..
Probab=98.07  E-value=6.6e-06  Score=52.53  Aligned_cols=130  Identities=18%  Similarity=0.175  Sum_probs=92.7

Q ss_pred             CHHHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEE-ECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCC
Q ss_conf             624389985578999587843899999986799889999-8898999988999998066452225302004442353100
Q gi|255764482|r    3 LASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLA-ERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENR   81 (225)
Q Consensus         3 La~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gv-D~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~   81 (225)
                      +.+...+++|+.++|+.||+|.+.+-....  +.+++|. |++..++.-++.|+...+...  ..+.+...|........
T Consensus       195 ~~~~~~~~~g~~~~dp~~g~gg~~~~~gl~--g~~~~g~gd~~~~~~~g~~~~l~~~~~~~--~~~~~~~~~~~~~~~~~  270 (358)
T TIGR01177       195 LVNLAGVKEGDRLLDPFCGTGGFLIEAGLL--GAKPIGCGDLDWKLVEGARLNLEHYGIED--KVFSVKRGDAKDLPLRL  270 (358)
T ss_pred             HHHHHHCCCCCCEECCCCCCCCHHHHHHHH--CCCCCCCCHHHHHHHCCCHHHHHHCCCCC--CEEEEEECCCHHCCCCC
T ss_conf             765420246751004222666033233332--11000244035676425211133305543--15676403300111003


Q ss_pred             CCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHH
Q ss_conf             0012357652057722654464465478854556520566898999999998624698378702888
Q gi|255764482|r   82 NLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQ  148 (225)
Q Consensus        82 ~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~  148 (225)
                      .  . ....+|-+.++|||.........         .....+..+++...+.++++|+.++..+..
T Consensus       271 ~--~-~~~~~~~~~~d~p~g~~~~~~~~---------~~~~l~~~~~~~~~~~~~~~g~~~~~~~~~  325 (358)
T TIGR01177       271 P--G-LDESVDAIATDPPYGRSTTAAGD---------GLEELYEKSLEELHEVLKGGGWLAVAVPTD  325 (358)
T ss_pred             C--C-CHHHHHHHHCCCCCCCCCCCCCH---------HHHHHHHHHHHHHHHHHCCCCCEEEEEECC
T ss_conf             5--3-10112222125654531112210---------368888888888888642687179974033


No 176
>PRK04266 fibrillarin; Provisional
Probab=98.06  E-value=0.00055  Score=41.69  Aligned_cols=139  Identities=18%  Similarity=0.150  Sum_probs=87.2

Q ss_pred             HCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCC
Q ss_conf             38998557899958784389999998679988999988989999889999980664522253020044423531000012
Q gi|255764482|r    6 LVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAG   85 (225)
Q Consensus         6 ~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~   85 (225)
                      .++.++|.+||=+|+++|+.-=-++.-..+..|+|||.+|.+....-.-.+      ...++-.+-+|......-..+  
T Consensus        67 ~~~i~~gskVLYLGAasGTTVSHvsDiV~~G~VyAVE~spr~~RdL~~la~------~R~NivPIl~DAr~P~~Y~~~--  138 (226)
T PRK04266         67 NFPIKKGSKVLYLGAASGTTVSHVSDIVEEGRVYAVEFAPRVMRELLLVAE------ERKNIIPILGDARKPEEYAHL--  138 (226)
T ss_pred             CCCCCCCCEEEEECCCCCCCHHHHHHHCCCCEEEEEEECCHHHHHHHHHHH------HCCCCEEEECCCCCHHHHHHH--
T ss_conf             567589987999547779848889875179649999827077899999985------089962575467884564420--


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECC----------HHHHHHHHH
Q ss_conf             3576520577226544644654788545565205668989999999986246983787028----------888999999
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIAR----------PQSLIQIVN  155 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~----------~~~l~~~l~  155 (225)
                        -+..|+|.++-.        -++            -.+-++.+|...||+||.+.+...          .+.+.+...
T Consensus       139 --v~~VD~i~qDvA--------Q~d------------Qa~I~~~Na~~FLk~gG~~~l~iKA~Sid~t~~p~~vf~~~~~  196 (226)
T PRK04266        139 --VEKVDVIYQDVA--------QPN------------QAEIAADNADIFLKPGGYLMLAIKARSIDVTKDPKEIFKEEIK  196 (226)
T ss_pred             --CCCCCEEEEECC--------CHH------------HHHHHHHHHHHHHHCCCEEEEEEEEEEEECCCCHHHHHHHHHH
T ss_conf             --565658996067--------742------------8999999999860159889999974235646898999999999


Q ss_pred             HHH-CCCCCEEEEEECCCCC
Q ss_conf             852-1788469998145896
Q gi|255764482|r  156 ACA-RRIGSLEITPLHPREG  174 (225)
Q Consensus       156 ~~~-~~~~~~~i~~v~~~~~  174 (225)
                      .+. .++.+.+..-+.|+..
T Consensus       197 ~L~~~~~~~~e~i~L~py~~  216 (226)
T PRK04266        197 KLEEGGFEILEVVDLEPYHK  216 (226)
T ss_pred             HHHHCCCCEEEEEECCCCCC
T ss_conf             99876996689981577678


No 177
>pfam01861 DUF43 Protein of unknown function DUF43. This family includes archaebacterial proteins of unknown function. All the members are 350-400 amino acids long.
Probab=98.03  E-value=0.00015  Score=44.94  Aligned_cols=110  Identities=14%  Similarity=0.170  Sum_probs=81.2

Q ss_pred             CCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCC
Q ss_conf             99855789995878438999999867998899998898999988999998066452225302004442353100001235
Q gi|255764482|r    8 NATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLK   87 (225)
Q Consensus         8 ~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~   87 (225)
                      ..-.|.+||=+|=. -..|+++|-.....+|+-+|+|+..++.-.+..+..+.     +++....|++.....     ..
T Consensus        41 gdL~Gk~iL~vGDD-DLtSlA~al~~~p~~I~VvDIDeRll~fI~~~A~~~gl-----~i~~~~~DlR~pLP~-----~l  109 (243)
T pfam01861        41 GDLEGKEILVLGDD-DLTSLAAALTGLPKRIAVVDIDERLIKFIERVAKEEGL-----KIEAFVHDLRNPLPE-----DL  109 (243)
T ss_pred             CCCCCCEEEEECCC-CHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHHCCC-----CEEEEEECCCCCCCH-----HH
T ss_conf             88579879997286-18789999648985489996758999999999997499-----716887410148999-----99


Q ss_pred             CCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCC---EEEEECCH
Q ss_conf             7652057722654464465478854556520566898999999998624698---37870288
Q gi|255764482|r   88 NNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSG---QLSLIARP  147 (225)
Q Consensus        88 ~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG---~~~~i~~~  147 (225)
                      .++||.++++|||-..                   ....|+..+...||..|   .+.+.+..
T Consensus       110 ~~~FD~f~TDPPyT~~-------------------G~~LFlsRgi~~Lk~eg~agYfglt~~e  153 (243)
T pfam01861       110 KHKFDVFITDPPETVD-------------------GLKAFLGRGIATLKGEGCAGYFGITHRE  153 (243)
T ss_pred             HCCCCEEECCCCCCHH-------------------HHHHHHHHHHHHHCCCCCCCEEEEECCC
T ss_conf             6167989718998778-------------------9999999999982668852268764260


No 178
>pfam11599 AviRa RRNA methyltransferase AviRa. This family of proteins represents the methyltransferase AviRa from Streptomyces viridochromogenes. This protein mediates the resistance to the antibiotic avilamycin. AviRa methylates a specific guanine base within the peptidyl-transferase loop of the 23S ribosomal RNA.
Probab=98.03  E-value=3.2e-05  Score=48.63  Aligned_cols=126  Identities=15%  Similarity=0.096  Sum_probs=79.6

Q ss_pred             CCCCEEEEECCCHHHHHHHHHH--HCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCC--------------------
Q ss_conf             8557899958784389999998--679988999988989999889999980664522253--------------------
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVAS--RLHEAQILLAERSPLMAHYARKTLALPANAQISKRI--------------------   67 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~--r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~--------------------   67 (225)
                      +..-++-|+|||+|.+...++-  +..-..++|-|+|+..+++|++|+.+.....++.|-                    
T Consensus        50 ~~p~tlwDpCCG~gYlLTvlgLLhr~~i~~v~aSDVd~~al~LA~~NL~LLt~~GL~~R~~eL~e~~~~f~k~s~~~aa~  129 (249)
T pfam11599        50 DAEISLWDCCCGGAYLLSILGLLHRNSIANLIASDIDPAPIELAADNLALLSKAGINAREDELKALSERFGKASHIDAAH  129 (249)
T ss_pred             CCCCCEEECCCCCHHHHHHHHHHCHHHHHHHHHCCCCHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHCCCHHHHHHH
T ss_conf             88730330577711899999985315787777425887899999864544032016778999999999848825788998


Q ss_pred             ------------------EEECCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHH
Q ss_conf             ------------------02004442353100001235765205772265446446547885455652056689899999
Q gi|255764482|r   68 ------------------SLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIR  129 (225)
Q Consensus        68 ------------------~~~~~D~~~~~~~~~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~  129 (225)
                                        .+..+|+++.......  .....-|+|++.-||+....+...         ........++.
T Consensus       130 aA~Rl~~~l~a~gg~~p~~~~~ADvfdp~~l~~~--~~g~~pDiVvTDlPYGe~t~Weg~---------~~~~~v~g~l~  198 (249)
T pfam11599       130 AADRIEELLTAEGGALPCAIKTADLFDGNALEAC--DAGFAPDIIITDLPYGEMTEWEEQ---------VGAGGIAGLLN  198 (249)
T ss_pred             HHHHHHHHHHCCCCCCCCHHHEECCCCCCHHHHH--HCCCCCCEEEECCCCCCEEEECCC---------CCCCCHHHHHH
T ss_conf             8899999986038998612100023586036777--437888868843787740022377---------89976789999


Q ss_pred             HHHHHCCCCCEEEEECC
Q ss_conf             99986246983787028
Q gi|255764482|r  130 TACAIMRSSGQLSLIAR  146 (225)
Q Consensus       130 ~a~~lLkpgG~~~~i~~  146 (225)
                      .....|.+.+.++++..
T Consensus       199 ~l~~vlp~~aVv~V~~~  215 (249)
T pfam11599       199 ALAAACGADAIIAVCMD  215 (249)
T ss_pred             HHHHHCCCCEEEEEEEC
T ss_conf             99865799808999816


No 179
>TIGR00740 TIGR00740 methyltransferase, putative; InterPro: IPR005271   Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals. The reaction is catalyzed by methyltransferases (Mtases) and modifies DNA, RNA, proteins and small molecules, such as catechol for regulatory purposes. The various aspects of the role of DNA methylation in prokaryotic restriction-modification systems and in a number of cellular processes in eukaryotes including gene regulation and differentiation is well documented.   Three classes of DNA Mtases transfer the methyl group from AdoMet to the target base to form either N-6-methyladenine, or N-4-methylcytosine, or C-5- methylcytosine. In C-5-cytosine Mtases, ten conserved motifs are arranged in the same order . Motif I (a glycine-rich or closely related consensus sequence; FAGxGG in M.HhaI ), shared by other AdoMet-Mtases , is part of the cofactor binding site and motif IV (PCQ) is part of the catalytic site. In contrast, sequence comparison among N-6-adenine and N-4-cytosine Mtases indicated two of the conserved segments , although more conserved segments may be present. One of them corresponds to motif I in C-5-cytosine Mtases, and the other is named (D/N/S)PP(Y/F). Crystal structures are known for a number of Mtases , , , . The cofactor binding sites are almost identical and the essential catalytic amino acids coincide. The comparable protein folding and the existence of equivalent amino acids in similar secondary and tertiary positions indicate that many (if not all) AdoMet-Mtases have a common catalytic domain structure. This permits tertiary structure prediction of other DNA, RNA, protein, and small-molecule AdoMet-Mtases from their amino acid sequences .   The proteins of this family are restricted to the Proteobacteria, sharing consistent length, full-length homology, and on average better than 35 0dentity. It is reasonable to predict equivalent function within this subfamily. .
Probab=98.02  E-value=1.2e-05  Score=51.10  Aligned_cols=109  Identities=17%  Similarity=0.193  Sum_probs=76.0

Q ss_pred             CCCCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCC
Q ss_conf             9855789995878438999999867--99889999889899998899999806645222530200444235310000123
Q gi|255764482|r    9 ATGSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGL   86 (225)
Q Consensus         9 ~~~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~   86 (225)
                      .-++..|.|+||-.|..++.+-+..  ++.+++|||.|+.|++.||+.+..-.   ....+++.+.|+.+........  
T Consensus        59 slp~~~vYDLGCS~G~~~l~~~R~I~~~~~~~igIDNS~pM~~~~~~~~~~y~---~~~Pv~~~~~D~~~v~~~~AS~--  133 (247)
T TIGR00740        59 SLPKPLVYDLGCSTGAATLSLRRNIQQDNIKIIGIDNSMPMLERCREHIKAYK---NAIPVEVLCMDIREVEIKNASM--  133 (247)
T ss_pred             CCCCCCEEECCCCHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHHHC---CCCCEEEEHHHHHHHHHHHHHH--
T ss_conf             16887412233432357766530468785379884188889999999998742---4788232010245666655468--


Q ss_pred             CCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             57652057722654464465478854556520566898999999998624698378702
Q gi|255764482|r   87 KNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIA  145 (225)
Q Consensus        87 ~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~  145 (225)
                      ..-.|-+-...|                       ..-..++...-.-|.|+|.+.+--
T Consensus       134 ~~L~F~LQFl~P-----------------------~~R~~LL~KIY~~L~~nGvL~lsE  169 (247)
T TIGR00740       134 VVLNFTLQFLRP-----------------------EEREALLKKIYNGLNPNGVLVLSE  169 (247)
T ss_pred             HHHHHHHHCCCC-----------------------HHHHHHHHHHHHHCCCCCEEEEEC
T ss_conf             878877604782-----------------------347999999874107786688632


No 180
>KOG4589 consensus
Probab=97.99  E-value=7.7e-05  Score=46.50  Aligned_cols=114  Identities=18%  Similarity=0.135  Sum_probs=69.9

Q ss_pred             CCCCCEEEEECCCHHHHHHHHHHHC-CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECC-CCCCCCCCC-CCCC
Q ss_conf             9855789995878438999999867-998899998898999988999998066452225302004-442353100-0012
Q gi|255764482|r    9 ATGSFHLADLGAGAGAAGLAVASRL-HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEV-DVTLVGENR-NLAG   85 (225)
Q Consensus         9 ~~~~~~VLDlGcG~G~~~l~la~r~-~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~-D~~~~~~~~-~~~~   85 (225)
                      .+|+++|||+||..|..+....++. |.+.|.|||+..-.-        ..|       +.++++ |+.+..... ....
T Consensus        67 l~p~~~VlD~G~APGsWsQVavqr~~p~g~v~gVDllh~~p--------~~G-------a~~i~~~dvtdp~~~~ki~e~  131 (232)
T KOG4589          67 LRPEDTVLDCGAAPGSWSQVAVQRVNPNGMVLGVDLLHIEP--------PEG-------ATIIQGNDVTDPETYRKIFEA  131 (232)
T ss_pred             CCCCCEEEECCCCCCHHHHHHHHHHCCCCEEEEEEEEECCC--------CCC-------CCCCCCCCCCCHHHHHHHHHH
T ss_conf             68887799816788718999988628874288874331148--------887-------640143246888899999986


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             35765205772265446446547885455652056689899999999862469837870
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLI  144 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i  144 (225)
                      .++...|.|++..--.. .+....|+.      .....-...+..+..+++|+|.+.+=
T Consensus       132 lp~r~VdvVlSDMapna-TGvr~~Dh~------~~i~LC~s~l~~al~~~~p~g~fvcK  183 (232)
T KOG4589         132 LPNRPVDVVLSDMAPNA-TGVRIRDHY------RSIELCDSALLFALTLLIPNGSFVCK  183 (232)
T ss_pred             CCCCCCCEEEECCCCCC-CCCCHHHHH------HHHHHHHHHHHHHHHHCCCCCEEEEE
T ss_conf             79983218871357787-675124378------99999999998863214778579999


No 181
>KOG1709 consensus
Probab=97.97  E-value=3.2e-05  Score=48.70  Aligned_cols=108  Identities=14%  Similarity=0.197  Sum_probs=73.8

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             85578999587843899999986799889999889899998899999806645222530200444235310000123576
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNN   89 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~   89 (225)
                      .+|.|||.+|-|-|.+.-.+-++.|.-+.+ +|.+|+.++..|++....     ..++.+..+-..+.     ....+++
T Consensus       100 tkggrvLnVGFGMgIidT~iQe~~p~~H~I-iE~hp~V~krmr~~gw~e-----k~nViil~g~WeDv-----l~~L~d~  168 (271)
T KOG1709         100 TKGGRVLNVGFGMGIIDTFIQEAPPDEHWI-IEAHPDVLKRMRDWGWRE-----KENVIILEGRWEDV-----LNTLPDK  168 (271)
T ss_pred             HCCCEEEEECCCHHHHHHHHHHCCCCCEEE-EECCHHHHHHHHHCCCCC-----CCCEEEEECCHHHH-----HCCCCCC
T ss_conf             179648984231677888886359863178-735978999998636654-----45468871346764-----4014456


Q ss_pred             CCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECC
Q ss_conf             520577226544644654788545565205668989999999986246983787028
Q gi|255764482|r   90 FYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIAR  146 (225)
Q Consensus        90 ~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~  146 (225)
                      .||-|.-.     .-             .+.......+.+++.++|||+|.+++..-
T Consensus       169 ~FDGI~yD-----Ty-------------~e~yEdl~~~hqh~~rLLkP~gv~SyfNg  207 (271)
T KOG1709         169 HFDGIYYD-----TY-------------SELYEDLRHFHQHVVRLLKPEGVFSYFNG  207 (271)
T ss_pred             CCCEEEEE-----CH-------------HHHHHHHHHHHHHHHHHCCCCCEEEEECC
T ss_conf             75626751-----30-------------16789999999877640087744888437


No 182
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase. Members of this small clade are methyltransferases of the pfam08241 family and are observed within operons for the biosynthesis of pseudaminic acid, a component of exopolysaccharide and flagellin glycosyl modifications. Notable among these genomes is Pseudomonas fluorescens PfO-1. Possibly one of the two hydroxyl groups of pseudaminic acid, at positions 4 and 8 is converted to a methoxy group by this enzyme
Probab=97.96  E-value=5.2e-05  Score=47.49  Aligned_cols=74  Identities=23%  Similarity=0.235  Sum_probs=55.9

Q ss_pred             CCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCC
Q ss_conf             98557899958784389999998679988999988989999889999980664522253020044423531000012357
Q gi|255764482|r    9 ATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKN   88 (225)
Q Consensus         9 ~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~   88 (225)
                      ..+-..++|+||+.|.-..+|-.-.|..++.||||++.+++.+++.+.         ..++.++.+.+        ....
T Consensus        41 ~~~ikSilE~GcNIGlNL~ALk~L~P~~~l~gIEIN~~A~~~lk~~~~---------~~~i~n~SIld--------~~~~  103 (204)
T TIGR03587        41 LPKIASILELGANIGMNLAALKRLLPFKHIYGVEINEYAVEKAKAYLP---------NINIIQGSLFD--------PFKD  103 (204)
T ss_pred             CCCCCEEEEECCCCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHCC---------CCEEEECCCCC--------CCCC
T ss_conf             788882689668847769999874874404999539999999986589---------72699653346--------6778


Q ss_pred             CCCCEEEECCC
Q ss_conf             65205772265
Q gi|255764482|r   89 NFYDHVIMNPP   99 (225)
Q Consensus        89 ~~fDlii~nPP   99 (225)
                      .+||+|++.-.
T Consensus       104 ~~~DLv~t~GV  114 (204)
T TIGR03587       104 NFFDLVLTKGV  114 (204)
T ss_pred             CCEEEEEEEEE
T ss_conf             74238998308


No 183
>smart00138 MeTrc Methyltransferase, chemotaxis proteins. Methylates methyl-accepting chemotaxis proteins to form gamma-glutamyl methyl ester residues.
Probab=97.95  E-value=0.00013  Score=45.29  Aligned_cols=114  Identities=14%  Similarity=0.167  Sum_probs=68.6

Q ss_pred             CCCCCEEEEECCCHHH----HHHHHHHHC-----CCCEEEEEECCHHHHHHHHHHH----HHHCCC--------------
Q ss_conf             9855789995878438----999999867-----9988999988989999889999----980664--------------
Q gi|255764482|r    9 ATGSFHLADLGAGAGA----AGLAVASRL-----HEAQILLAERSPLMAHYARKTL----ALPANA--------------   61 (225)
Q Consensus         9 ~~~~~~VLDlGcG~G~----~~l~la~r~-----~~~~v~gvD~~~~~~~~A~~n~----~~~~~~--------------   61 (225)
                      ..+.-||.-.||.+|-    +++++.+..     ...+|+|+|+|+.+++.|++=+    ...+..              
T Consensus        97 ~~~~lrIWsagCStGEE~YSlAm~l~e~~~~~~~~~~~I~aTDIs~~~L~~Ar~G~Y~~~~~~~~~~~~~~kyF~~~~~~  176 (264)
T smart00138       97 HGRRVRIWSAGCSTGEEPYSLAMLLAETLPKAREPDVKILATDIDLKALEKARAGIYPERELEDLPKALLARYFSRVEDK  176 (264)
T ss_pred             CCCCEEEEECCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEEEECCHHHHHHHHHCCCCHHHHHCCCHHHHHHHCCCCCCE
T ss_conf             79974899777888820899999999974334898569999839999999998689898998469999999880656988


Q ss_pred             -----CCCCCCEEECCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCC
Q ss_conf             -----522253020044423531000012357652057722654464465478854556520566898999999998624
Q gi|255764482|r   62 -----QISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMR  136 (225)
Q Consensus        62 -----~~~~~~~~~~~D~~~~~~~~~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLk  136 (225)
                           .+...+.|.+.|+...       ..+.+.||+|+|-.-..                +-.......+++...+.|+
T Consensus       177 ~~v~~~lr~~v~F~~~NL~~~-------~~~~~~fDlI~CRNVlI----------------YF~~~~~~~vl~~l~~~L~  233 (264)
T smart00138      177 YRVKPELKERVRFAKHNLLAE-------SPPLGDFDLIFCRNVLI----------------YFDEPTQRKLLNRFAEALK  233 (264)
T ss_pred             EEECHHHHCCCCEECCCCCCC-------CCCCCCCEEEEECCCEE----------------ECCHHHHHHHHHHHHHHHC
T ss_conf             999889985091832789999-------87778841999763235----------------4599999999999999838


Q ss_pred             CCCEEEEEC
Q ss_conf             698378702
Q gi|255764482|r  137 SSGQLSLIA  145 (225)
Q Consensus       137 pgG~~~~i~  145 (225)
                      |||.+.+-+
T Consensus       234 pgG~L~lG~  242 (264)
T smart00138      234 PGGYLFLGH  242 (264)
T ss_pred             CCCEEEEEC
T ss_conf             993999827


No 184
>PRK00536 speE spermidine synthase; Provisional
Probab=97.94  E-value=0.00036  Score=42.74  Aligned_cols=117  Identities=8%  Similarity=-0.005  Sum_probs=75.8

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             85578999587843899999986799889999889899998899999806645222530200444235310000123576
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNN   89 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~   89 (225)
                      ...+|||=+|-|-|++.--+.+. + .+++-||+|+..++.+++-.........+.+++...          .......+
T Consensus        71 p~Pk~VLIIGGGDGG~~REvlKH-~-~~v~~VEID~~Vv~~sk~ylP~~~~~~~dpr~~~~~----------~~~~~~~~  138 (262)
T PRK00536         71 KELKEVLIVDGFDLELAHQLFKY-D-THVDFVQADEKILDSFISFFPHFHEVKNNKNFTHAK----------QLLDLDIK  138 (262)
T ss_pred             CCCCEEEEECCCCHHHHHHHHCC-C-CEEEEEEECHHHHHHHHHHCHHHHHHHCCCCEEHHH----------HHHHHCCC
T ss_conf             99787999868755999998728-9-766999967899999999785656541399611399----------98761547


Q ss_pred             CCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEE-----CCHHHHHHHHHHHHCCC
Q ss_conf             5205772265446446547885455652056689899999999862469837870-----28888999999852178
Q gi|255764482|r   90 FYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLI-----ARPQSLIQIVNACARRI  161 (225)
Q Consensus        90 ~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i-----~~~~~l~~~l~~~~~~~  161 (225)
                      +||+|+..-                       .....+.+.+.+.|+|+|.++.=     +..+.+.+.+..+...+
T Consensus       139 ~fDvIIvDs-----------------------l~~~~~~~~l~~~L~~~Gi~v~Q~esp~~~~~~~~~~~~~~~~~F  192 (262)
T PRK00536        139 KYDLIICLQ-----------------------EPDIHKIDGLKRMLKEDGVFISVAKHPLLEHVSMQNALKNMGHFF  192 (262)
T ss_pred             CCCEEEECC-----------------------CCCCCHHHHHHHHHCCCCEEEECCCCHHHCHHHHHHHHHHHHHHC
T ss_conf             668899889-----------------------998054999999858998999838971207999999999988659


No 185
>COG1867 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis]
Probab=97.94  E-value=7.4e-05  Score=46.63  Aligned_cols=101  Identities=17%  Similarity=0.272  Sum_probs=72.2

Q ss_pred             CCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             57899958784389999998679988999988989999889999980664522253020044423531000012357652
Q gi|255764482|r   12 SFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFY   91 (225)
Q Consensus        12 ~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~f   91 (225)
                      ..+|+|.-||+|.=++-.|...+..+++.-|+||+++++.++|++.|...    ...+++.|......      .....|
T Consensus        53 ~~~v~DalsatGiRgIRya~E~~~~~v~lNDisp~Avelik~Nv~~N~~~----~~~v~n~DAN~lm~------~~~~~f  122 (380)
T COG1867          53 PKRVLDALSATGIRGIRYAVETGVVKVVLNDISPKAVELIKENVRLNSGE----DAEVINKDANALLH------ELHRAF  122 (380)
T ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHCCCC----CCEEECCHHHHHHH------HCCCCC
T ss_conf             73886435553366754534257617997158989999999999834766----63255342899987------258876


Q ss_pred             CEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             05772265446446547885455652056689899999999862469837870
Q gi|255764482|r   92 DHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLI  144 (225)
Q Consensus        92 Dlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i  144 (225)
                      |+|=-.| |+.                     ...|++.|.+..+.+|.+++.
T Consensus       123 d~IDiDP-FGS---------------------PaPFlDaA~~s~~~~G~l~vT  153 (380)
T COG1867         123 DVIDIDP-FGS---------------------PAPFLDAALRSVRRGGLLCVT  153 (380)
T ss_pred             CEEECCC-CCC---------------------CCHHHHHHHHHHHCCCEEEEE
T ss_conf             3781389-999---------------------726799999972229889998


No 186
>KOG3115 consensus
Probab=97.94  E-value=8.1e-05  Score=46.40  Aligned_cols=131  Identities=17%  Similarity=0.240  Sum_probs=73.5

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             55789995878438999999867998899998898999988999998066452225302004442353100001235765
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNF   90 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~   90 (225)
                      +.--..|||||-|.+.+.|+-.+|+.-+.|.||--..-+.-++.|........+..  +.+..+.+......+.    +.
T Consensus        60 ~kvefaDIGCGyGGLlv~Lsp~fPdtLiLGmEIR~KVsdYVk~RI~ALR~~~a~~~--~~ni~vlr~namk~lp----n~  133 (249)
T KOG3115          60 KKVEFADIGCGYGGLLMKLAPKFPDTLILGMEIRDKVSDYVKERIQALRRTSAEGQ--YPNISVLRTNAMKFLP----NF  133 (249)
T ss_pred             CCCEEEEECCCCCCHHHHCCCCCCCCEEEEEHHHHHHHHHHHHHHHHHHCCCCCCC--CCCCEEEECCCHHHCC----CH
T ss_conf             56427860467650101205468630122001268888999999999752654334--5653034212022051----03


Q ss_pred             CCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHHHHHH
Q ss_conf             20577226544644654788545565205668989999999986246983787028888999
Q gi|255764482|r   91 YDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQ  152 (225)
Q Consensus        91 fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~~l~~  152 (225)
                      |..--..+-|+     ..|++-.....+-....-...+..-..+|++||.++.+.....+.+
T Consensus       134 f~kgqLskmff-----~fpdpHfk~~khk~rii~~~l~~eyay~l~~gg~~ytitDv~elh~  190 (249)
T KOG3115         134 FEKGQLSKMFF-----LFPDPHFKARKHKWRIITSTLLSEYAYVLREGGILYTITDVKELHE  190 (249)
T ss_pred             HHHCCCCCCEE-----ECCCHHHHHHHCCCEEECHHHHHHHHHHHHCCCEEEEEEEHHHHHH
T ss_conf             43123344403-----2588057665212101203479877742213844899700888899


No 187
>COG3897 Predicted methyltransferase [General function prediction only]
Probab=97.88  E-value=2.1e-05  Score=49.72  Aligned_cols=106  Identities=20%  Similarity=0.286  Sum_probs=72.8

Q ss_pred             CCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCC
Q ss_conf             98557899958784389999998679988999988989999889999980664522253020044423531000012357
Q gi|255764482|r    9 ATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKN   88 (225)
Q Consensus         9 ~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~   88 (225)
                      .-.|.+|||+|+|+|..+++.+. .....+++.|++|......+.|++.|+.+     +.+...|..-          .+
T Consensus        77 tVrgkrVLd~gagsgLvaIAaa~-aGA~~v~a~d~~P~~~~ai~lNa~angv~-----i~~~~~d~~g----------~~  140 (218)
T COG3897          77 TVRGKRVLDLGAGSGLVAIAAAR-AGAAEVVAADIDPWLEQAIRLNAAANGVS-----ILFTHADLIG----------SP  140 (218)
T ss_pred             CCCCCEEEECCCCCCHHHHHHHH-HHHHHHHHCCCCHHHHHHHHCCHHHCCCE-----EEEEECCCCC----------CC
T ss_conf             10365324415666708899998-50378876278847888853062215621-----6774313368----------98


Q ss_pred             CCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHHH
Q ss_conf             6520577226544644654788545565205668989999999986246983787028888
Q gi|255764482|r   89 NFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQS  149 (225)
Q Consensus        89 ~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~~  149 (225)
                      ..||+++..--|+..                  ......+. ....|+..|...+|..+.|
T Consensus       141 ~~~Dl~LagDlfy~~------------------~~a~~l~~-~~~~l~~~g~~vlvgdp~R  182 (218)
T COG3897         141 PAFDLLLAGDLFYNH------------------TEADRLIP-WKDRLAEAGAAVLVGDPGR  182 (218)
T ss_pred             CCEEEEEEECEECCC------------------HHHHHHHH-HHHHHHHCCCEEEEECCCC
T ss_conf             640389850300283------------------58898899-9999985797799728997


No 188
>pfam01269 Fibrillarin Fibrillarin.
Probab=97.86  E-value=0.0011  Score=40.07  Aligned_cols=139  Identities=17%  Similarity=0.158  Sum_probs=84.4

Q ss_pred             HCCCCCCCEEEEECCCHHHHHHHHHHHC-CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC
Q ss_conf             3899855789995878438999999867-998899998898999988999998066452225302004442353100001
Q gi|255764482|r    6 LVNATGSFHLADLGAGAGAAGLAVASRL-HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA   84 (225)
Q Consensus         6 ~~~~~~~~~VLDlGcG~G~~~l~la~r~-~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~   84 (225)
                      -++.++|.+||=+|+++|+.-=-++.-. ++..|+|||.+|.+....-.-.      ....++-.+-+|......-..+ 
T Consensus        68 ~~~i~~gskVLYLGAasGTTVSHvsDIvg~~G~VyAVE~spr~~RdL~~la------~~R~NIvPIl~DAr~P~~Y~~l-  140 (229)
T pfam01269        68 DIPIKPGSKVLYLGAASGTTVSHVSDIVGPEGVVYAVEFSPRVGRELINVA------KKRPNIVPILEDARHPQKYRML-  140 (229)
T ss_pred             CCCCCCCCEEEEECCCCCCCHHHHHHHCCCCCEEEEEECCCHHHHHHHHHH------HCCCCCEEEECCCCCHHHHHHH-
T ss_conf             568589987999447779857678872288953999971735578999997------4279944576677875676542-


Q ss_pred             CCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCH----------HHHHHHH
Q ss_conf             235765205772265446446547885455652056689899999999862469837870288----------8899999
Q gi|255764482|r   85 GLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARP----------QSLIQIV  154 (225)
Q Consensus        85 ~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~----------~~l~~~l  154 (225)
                         -+..|+|.++-.        -+            .-.+-++.+|...||+||.+.+...+          +.+.+..
T Consensus       141 ---v~~VD~ifqDva--------Q~------------~Qa~i~~~Na~~FLk~gG~~~l~iKA~Sid~t~~p~~vf~~e~  197 (229)
T pfam01269       141 ---VEMVDVIFADVA--------QP------------DQARILALNAKYFLKNGGYFMISIKARSIDVTKEPEEVFAREV  197 (229)
T ss_pred             ---CCCCCEEEECCC--------CH------------HHHHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCHHHHHHHHH
T ss_conf             ---556668996278--------77------------7899999999986126988999997134216789899999999


Q ss_pred             HHHH-CCCCCEEEEEECCCCC
Q ss_conf             9852-1788469998145896
Q gi|255764482|r  155 NACA-RRIGSLEITPLHPREG  174 (225)
Q Consensus       155 ~~~~-~~~~~~~i~~v~~~~~  174 (225)
                      ..+. .++.+.+..-+.|+..
T Consensus       198 ~~L~~~~~~~~e~i~L~py~~  218 (229)
T pfam01269       198 EKLKEEGFKPKEQVTLEPYER  218 (229)
T ss_pred             HHHHHCCCCEEEEECCCCCCC
T ss_conf             999876996589980577778


No 189
>pfam01739 CheR CheR methyltransferase, SAM binding domain. CheR proteins are part of the chemotaxis signaling mechanism in bacteria. CheR methylates the chemotaxis receptor at specific glutamate residues. CheR is an S-adenosylmethionine- dependent methyltransferase - the C-terminal domain (this one) binds SAM.
Probab=97.81  E-value=0.00015  Score=44.85  Aligned_cols=116  Identities=15%  Similarity=0.144  Sum_probs=67.2

Q ss_pred             CCCCCEEEEECCCHHH----HHHHHHHHCC-----CCEEEEEECCHHHHHHHHHHH----HHHCCCC-------------
Q ss_conf             9855789995878438----9999998679-----988999988989999889999----9806645-------------
Q gi|255764482|r    9 ATGSFHLADLGAGAGA----AGLAVASRLH-----EAQILLAERSPLMAHYARKTL----ALPANAQ-------------   62 (225)
Q Consensus         9 ~~~~~~VLDlGcG~G~----~~l~la~r~~-----~~~v~gvD~~~~~~~~A~~n~----~~~~~~~-------------   62 (225)
                      ..+.-||.=.||.||-    +++++.+..+     ..+|+|+|+|..+++.|++-+    ...+...             
T Consensus        28 ~~~~lrIWsagCStGEE~YSlAi~l~e~~~~~~~~~~~I~atDI~~~~l~~Ar~G~Y~~~~~~~~p~~~~~ryF~~~~~~  107 (194)
T pfam01739        28 NSRRVRIWSAGCSSGEEPYSLAMLLAETLPNALPWDFKILATDIDLSALEKARAGVYPERELEGLPPELLRRYFTKGAGG  107 (194)
T ss_pred             CCCCEEEEECCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHCCCCHHHHHCCCHHHHHHHCCCCCCC
T ss_conf             89955999736889951899999999974325787449999739889999998789889998459999999628607899


Q ss_pred             -------CCCCCEEECCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHC
Q ss_conf             -------2225302004442353100001235765205772265446446547885455652056689899999999862
Q gi|255764482|r   63 -------ISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIM  135 (225)
Q Consensus        63 -------~~~~~~~~~~D~~~~~~~~~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lL  135 (225)
                             +...+.|.+.|+.        .+.....||+|+|---.                -+-........++.....|
T Consensus       108 ~~~i~~~lr~~V~F~~~NL~--------~~~~~~~~DlIfCRNVl----------------IYF~~~~~~~vl~~l~~~L  163 (194)
T pfam01739       108 GYRVKPEIKEMVLFEYHNLL--------DYPPLGDFDVIFCRNVL----------------IYFDEETQRKILNRFASAL  163 (194)
T ss_pred             CEEECHHHHCCCEEEECCCC--------CCCCCCCEEEEEECCEE----------------EECCHHHHHHHHHHHHHHH
T ss_conf             48768899711668546655--------68876750399980210----------------1379999999999999984


Q ss_pred             CCCCEEEEECCHHH
Q ss_conf             46983787028888
Q gi|255764482|r  136 RSSGQLSLIARPQS  149 (225)
Q Consensus       136 kpgG~~~~i~~~~~  149 (225)
                      +|||.+.+-+ +|.
T Consensus       164 ~~gG~L~lG~-~Es  176 (194)
T pfam01739       164 KPGGYLFLGH-SES  176 (194)
T ss_pred             CCCCEEEEEC-CCC
T ss_conf             8994999807-566


No 190
>PTZ00146 fibrillarin; Provisional
Probab=97.77  E-value=0.0016  Score=39.02  Aligned_cols=138  Identities=17%  Similarity=0.142  Sum_probs=82.9

Q ss_pred             HCCCCCCCEEEEECCCHHHHHHHHHHHC-CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC
Q ss_conf             3899855789995878438999999867-998899998898999988999998066452225302004442353100001
Q gi|255764482|r    6 LVNATGSFHLADLGAGAGAAGLAVASRL-HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA   84 (225)
Q Consensus         6 ~~~~~~~~~VLDlGcG~G~~~l~la~r~-~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~   84 (225)
                      -++.+++.+||=||+.+|+.---++.-. +...|++||.+|.+....-.-.      ....++-.+-.|.........+ 
T Consensus       130 ~i~Ik~GskVLYLGAasGTTVSHVSDIVG~~G~VYAVEfSpr~~RdLl~lA------~~R~NIvPIleDAr~P~kYr~l-  202 (296)
T PTZ00146        130 SIPIKPGSKVLYLGAASGTTVSHVSDLVGPEGVVYAVEFSHRSGRDLVEMA------KRRTNIVPIIEDARYPQKYRML-  202 (296)
T ss_pred             CCCCCCCCEEEEECCCCCCCHHHHHHHCCCCCEEEEEEECCHHHHHHHHHH------HCCCCCEEEECCCCCHHHHHHH-
T ss_conf             444379998998514679865566650178861999970646688999997------2279833577778974675542-


Q ss_pred             CCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHH----------HHHHHH
Q ss_conf             2357652057722654464465478854556520566898999999998624698378702888----------899999
Q gi|255764482|r   85 GLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQ----------SLIQIV  154 (225)
Q Consensus        85 ~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~----------~l~~~l  154 (225)
                         -+..|+|+++-+        .++            -.+-++.+|...||++|.+.+...+.          -+.+.+
T Consensus       203 ---V~~VDvIf~DVA--------Qpd------------QarI~~~Na~~FLK~gG~~~i~IKArsIDst~~p~~VF~~Ev  259 (296)
T PTZ00146        203 ---VPMVDCIFADVA--------QPD------------QARIVALNAQHFLKNGGHFVISIKANCIDSTADPEVVFASEV  259 (296)
T ss_pred             ---CCCCCEEEECCC--------CHH------------HHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCHHHHHHHHH
T ss_conf             ---455558996178--------765------------899999999985316988999997266325679899999999


Q ss_pred             HHHH-CCCCCEEEEEECCCC
Q ss_conf             9852-178846999814589
Q gi|255764482|r  155 NACA-RRIGSLEITPLHPRE  173 (225)
Q Consensus       155 ~~~~-~~~~~~~i~~v~~~~  173 (225)
                      ..+. ..+.+.+..-+.|+.
T Consensus       260 ~kL~~~~f~~~e~v~LePy~  279 (296)
T PTZ00146        260 QKLKKEGLKPKEQLTLEPFE  279 (296)
T ss_pred             HHHHHCCCCEEEEEECCCCC
T ss_conf             99987289636887047777


No 191
>pfam04445 DUF548 Protein of unknown function (DUF548). Protein of unknown function found in proteobacteria. In Salmonella typhimurium, expression of this protein is regulated by heat shock.
Probab=97.74  E-value=0.00043  Score=42.27  Aligned_cols=93  Identities=23%  Similarity=0.304  Sum_probs=67.5

Q ss_pred             CCHHHCCCCCCC--EEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCC-----CCCCCCEEECCCC
Q ss_conf             662438998557--899958784389999998679988999988989999889999980664-----5222530200444
Q gi|255764482|r    2 ILASLVNATGSF--HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANA-----QISKRISLIEVDV   74 (225)
Q Consensus         2 lLa~~~~~~~~~--~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~-----~~~~~~~~~~~D~   74 (225)
                      +|+.-+..+++.  +|+|.-+|-|.-++.+|..  |++|+.+|.+|-+..+...-+......     ....+++++++|.
T Consensus        64 ~l~KAvG~k~~~~p~VlDATAGLG~DafiLAsL--G~~VtliEr~pvl~~LL~Dal~RA~~~~~~~~~~~~rm~L~~gds  141 (235)
T pfam04445        64 AIAKAVGIKGGYLPTVLDATAGLGRDAFVLASL--GCRVRLVERHPVVAALLEDGLQRAYQDPEIGAWLQARLHLLHGSS  141 (235)
T ss_pred             HHHHHHCCCCCCCCEEEECCCCCCHHHHHHHHC--CCEEEEEECCHHHHHHHHHHHHHHHHCCHHHHHHHHHCEEECCCH
T ss_conf             899986678899983898787757889999818--996999978899999999999998748155799996289983887


Q ss_pred             CCCCCCCCCCCCCCCCCCEEEECCCCCC
Q ss_conf             2353100001235765205772265446
Q gi|255764482|r   75 TLVGENRNLAGLKNNFYDHVIMNPPFNE  102 (225)
Q Consensus        75 ~~~~~~~~~~~~~~~~fDlii~nPPy~~  102 (225)
                      .....      .....+|+|.-.|-|-.
T Consensus       142 ~~~l~------~~~~~~DvIYLDPMFP~  163 (235)
T pfam04445       142 ADQLE------PNIDQPDVVYLDPMYPH  163 (235)
T ss_pred             HHHHH------HCCCCCCEEEECCCCCC
T ss_conf             99975------24689878997376887


No 192
>pfam05891 Hydroxy-O-Methy Putative hydroxyindole-O-methyltransferase. This family of proteins is a putative hydroxyindole-O-methyltransferase and by homology, is expected to catalyse the conversion of N-acetyl serotonin to melatonin. The protein is expressed in the tail neuron PVT and in uterine cells [worm-base].
Probab=97.72  E-value=0.00039  Score=42.51  Aligned_cols=103  Identities=15%  Similarity=0.168  Sum_probs=67.8

Q ss_pred             CCEEEEECCCHHHHHHHH-HHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             578999587843899999-9867998899998898999988999998066452225302004442353100001235765
Q gi|255764482|r   12 SFHLADLGAGAGAAGLAV-ASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNF   90 (225)
Q Consensus        12 ~~~VLDlGcG~G~~~l~l-a~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~   90 (225)
                      ..+.||.|||.|-+|--+ ...+  -+|..||-.+..++.|++++....    ....++.+.-+.++.       ...++
T Consensus        56 ~~~alDcGAGIGRVTk~lL~~~f--~~VDlVEpv~~Fl~~ak~~l~~~~----~~~~~~~~~gLQdf~-------P~~~~  122 (217)
T pfam05891        56 HLVALDCGAGIGRVTKNLLLPLF--SKVDLVEPVEDFLAKAKEYLAEEK----KKVGNFFCVGLQDFT-------PEEGR  122 (217)
T ss_pred             CCEEEECCCCCCEECHHHHHHHC--CEEEEECCCHHHHHHHHHHHHHCC----CCCCEEEECCCCCCC-------CCCCE
T ss_conf             32665426763611266788754--813575444999999999874037----976538973610168-------99981


Q ss_pred             CCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEE
Q ss_conf             20577226544644654788545565205668989999999986246983787
Q gi|255764482|r   91 YDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSL  143 (225)
Q Consensus        91 fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~  143 (225)
                      ||+|.+-                ...-|-.+..+.+|+..|...|+|+|.+++
T Consensus       123 YD~IW~Q----------------W~~ghLtD~dlv~Fl~RCk~~L~~~G~Ivv  159 (217)
T pfam05891       123 YDLIWIQ----------------WCIGHLTDEDLVAFLKRCKSGLKPNGIIVI  159 (217)
T ss_pred             EEEEEEH----------------HHHCCCCHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             7699805----------------845218889999999999984789864998


No 193
>cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology. Cytosine-specific DNA methylases are found both in prokaryotes and eukaryotes. DNA methylation, or the covalent addition of a methyl group to cytosine within the context of the CpG dinucleotide, has profound effects on the mammalian genome. These effects include transcriptional repression via inhibition of transcription factor binding or the recruitment of methyl-binding proteins and their associated chromatin remodeling factors, X chromosome inactivation, imprinting and the suppression of parasitic DNA sequences. DNA methylation is also essential for proper embryonic development and is an important player in both DNA repair and genome stability.
Probab=97.70  E-value=0.00012  Score=45.44  Aligned_cols=72  Identities=22%  Similarity=0.145  Sum_probs=53.4

Q ss_pred             EEEEECCCHHHHHHHHHHHCCCC-EEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             89995878438999999867998-89999889899998899999806645222530200444235310000123576520
Q gi|255764482|r   14 HLADLGAGAGAAGLAVASRLHEA-QILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFYD   92 (225)
Q Consensus        14 ~VLDlGcG~G~~~l~la~r~~~~-~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~fD   92 (225)
                      +|+|+.||.|++++.+.+.  +. .+.++|+++.+++..+.|...          ...++|+.......     .....|
T Consensus         2 ~v~dLFsG~GG~s~Gl~~a--G~~~~~a~e~d~~a~~t~~~N~~~----------~~~~~Di~~~~~~~-----~~~~vD   64 (275)
T cd00315           2 RVIDLFAGIGGFRLGLEKA--GFEIVAANEIDKSAAETYEANFPN----------KLIEGDITKIDEKD-----FIPDID   64 (275)
T ss_pred             CEEEECCCCCHHHHHHHHC--CCEEEEEEECCHHHHHHHHHHCCC----------CCCCCCHHHCCCCC-----CCCCCC
T ss_conf             5999767807899999986--998999996899999999988799----------95258864465321-----378878


Q ss_pred             EEEECCCCCC
Q ss_conf             5772265446
Q gi|255764482|r   93 HVIMNPPFNE  102 (225)
Q Consensus        93 lii~nPPy~~  102 (225)
                      ++++-||+-.
T Consensus        65 ll~ggpPCQ~   74 (275)
T cd00315          65 LLTGGFPCQP   74 (275)
T ss_pred             EEEECCCCCC
T ss_conf             8986899987


No 194
>PRK00050 mraW S-adenosyl-methyltransferase MraW; Provisional
Probab=97.68  E-value=0.00021  Score=44.02  Aligned_cols=91  Identities=16%  Similarity=0.192  Sum_probs=62.8

Q ss_pred             HHCCCCCCCEEEEECCCHHHHHHHHHHHC-CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC
Q ss_conf             43899855789995878438999999867-99889999889899998899999806645222530200444235310000
Q gi|255764482|r    5 SLVNATGSFHLADLGAGAGAAGLAVASRL-HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL   83 (225)
Q Consensus         5 ~~~~~~~~~~VLDlGcG~G~~~l~la~r~-~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~   83 (225)
                      .+..+++++.++|-=.|.|+.|.++..+. ++++++|+|.|+++++.|++....     ...++.++++++.........
T Consensus        17 ~~L~~~~~g~yvD~T~G~GGHS~~iL~~l~~~~~li~iDrD~~ai~~a~~~l~~-----~~~r~~~~~~nF~~l~~~l~~   91 (309)
T PRK00050         17 DGLAIKPDGIYVDGTFGRGGHSRAILSQLGPGGRLIAIDRDPQAIAAAKERLDP-----FGGRFTIVHGNFSDLAEYLAE   91 (309)
T ss_pred             HHCCCCCCCEEEEECCCCCHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHH-----CCCCEEEEECCHHHHHHHHHH
T ss_conf             836828999999938898399999997279998899998988999999998652-----588289992779889999986


Q ss_pred             CCCC-CCCCCEEEECCCC
Q ss_conf             1235-7652057722654
Q gi|255764482|r   84 AGLK-NNFYDHVIMNPPF  100 (225)
Q Consensus        84 ~~~~-~~~fDlii~nPPy  100 (225)
                      .... .--+|+-++.+.+
T Consensus        92 ~~~vdgil~DLGvSS~Ql  109 (309)
T PRK00050         92 VGKVDGILLDLGVSSPQL  109 (309)
T ss_pred             CCCCCEEEEEEECCCHHH
T ss_conf             388778999722483320


No 195
>pfam00145 DNA_methylase C-5 cytosine-specific DNA methylase.
Probab=97.68  E-value=0.00017  Score=44.55  Aligned_cols=70  Identities=19%  Similarity=0.129  Sum_probs=50.8

Q ss_pred             EEEEECCCHHHHHHHHHHHCCCCE-EEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             899958784389999998679988-9999889899998899999806645222530200444235310000123576520
Q gi|255764482|r   14 HLADLGAGAGAAGLAVASRLHEAQ-ILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFYD   92 (225)
Q Consensus        14 ~VLDlGcG~G~~~l~la~r~~~~~-v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~fD   92 (225)
                      +|+|+.||.|++++-+.+.  +.+ +.++|+++.+++.-+.|...           ...+|+.......      -...|
T Consensus         2 ~vidlF~G~GG~s~G~~~a--G~~~~~a~e~d~~a~~ty~~N~~~-----------~~~~Di~~~~~~~------~~~~D   62 (319)
T pfam00145         2 KFIDLFAGIGGFRLGLEQA--GFECVAANEIDKSAAKTYEANFPK-----------VPIGDITLIDIKD------IPDID   62 (319)
T ss_pred             CEEEECCCCCHHHHHHHHC--CCEEEEEEECCHHHHHHHHHHCCC-----------CCCCCCCCCCHHH------CCCCC
T ss_conf             5899780707899999987--992999983899999999987799-----------9617754088747------88868


Q ss_pred             EEEECCCCCC
Q ss_conf             5772265446
Q gi|255764482|r   93 HVIMNPPFNE  102 (225)
Q Consensus        93 lii~nPPy~~  102 (225)
                      ++++-||+-.
T Consensus        63 vl~ggpPCQ~   72 (319)
T pfam00145        63 ILTGGFPCQD   72 (319)
T ss_pred             EEEECCCCCC
T ss_conf             8986899987


No 196
>pfam09243 Rsm22 Mitochondrial small ribosomal subunit Rsm22. Rsm22 has been identified as a mitochondrial small ribosomal subunit and is a methyltransferase. In Schizosaccharomyces pombe, Rsm22 is tandemly fused to Cox11 (a factor required for copper insertion into cytochrome oxidase) and the two proteins are proteolytically cleaved after import into the mitochondria.
Probab=97.67  E-value=0.001  Score=40.23  Aligned_cols=48  Identities=17%  Similarity=0.129  Sum_probs=39.8

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCC-CEEEEEECCHHHHHHHHHHHHH
Q ss_conf             85578999587843899999986799-8899998898999988999998
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRLHE-AQILLAERSPLMAHYARKTLAL   57 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~~~-~~v~gvD~~~~~~~~A~~n~~~   57 (225)
                      -...+|||+|+|+|..+.++..-+++ -+++.||-|+.|.++++.-...
T Consensus        33 f~P~slLD~GsGpGt~~wAa~~~w~~l~~~~~vd~s~~m~~l~~~L~~~   81 (275)
T pfam09243        33 FAPLSHLDVGAGPGTALWAASELWPGLEPATVIDASEAALAIGEELARH   81 (275)
T ss_pred             CCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHC
T ss_conf             9987577727757999999998842476899974899999999999851


No 197
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms]
Probab=97.65  E-value=0.00044  Score=42.23  Aligned_cols=112  Identities=13%  Similarity=0.095  Sum_probs=67.8

Q ss_pred             CCCEEEEECCCHHH----HHHHHHHHCC-----CCEEEEEECCHHHHHHHHHHHHH-----HCCC-C--------CC---
Q ss_conf             55789995878438----9999998679-----98899998898999988999998-----0664-5--------22---
Q gi|255764482|r   11 GSFHLADLGAGAGA----AGLAVASRLH-----EAQILLAERSPLMAHYARKTLAL-----PANA-Q--------IS---   64 (225)
Q Consensus        11 ~~~~VLDlGcG~G~----~~l~la~r~~-----~~~v~gvD~~~~~~~~A~~n~~~-----~~~~-~--------~~---   64 (225)
                      ..-||.-.||+||-    +++++.+..+     ..+|+|+|+|..+++.|+.=+-.     .+.. .        ..   
T Consensus        96 ~~irIWSaaCStGEEpYSiAm~l~e~~~~~~~~~~~I~AtDId~~~L~~A~~G~Y~~~~~~~~~~~~~~~ryF~~~~~~~  175 (268)
T COG1352          96 RPIRIWSAACSTGEEPYSLAMLLLEALGKLAGFRVKILATDIDLSVLEKARAGIYPSRELLRGLPPELLRRYFERGGDGS  175 (268)
T ss_pred             CCEEEEECCCCCCCCHHHHHHHHHHHHCCCCCCCEEEEEEECCHHHHHHHHCCCCCHHHHHCCCCHHHHHHHEEECCCCC
T ss_conf             85399966768995589999999987332258743899997999999998628887667654499899963376469984


Q ss_pred             --------CCCEEECCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCC
Q ss_conf             --------253020044423531000012357652057722654464465478854556520566898999999998624
Q gi|255764482|r   65 --------KRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMR  136 (225)
Q Consensus        65 --------~~~~~~~~D~~~~~~~~~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLk  136 (225)
                              ..+.|.+.|+...       ....+.||+|+|-.-.                -+-.......++......|+
T Consensus       176 y~v~~~ir~~V~F~~~NLl~~-------~~~~~~fD~IfCRNVL----------------IYFd~~~q~~il~~f~~~L~  232 (268)
T COG1352         176 YRVKEELRKMVRFRRHNLLDD-------SPFLGKFDLIFCRNVL----------------IYFDEETQERILRRFADSLK  232 (268)
T ss_pred             EEECHHHHCCCEEEECCCCCC-------CCCCCCCCEEEECCEE----------------EEECHHHHHHHHHHHHHHHC
T ss_conf             798768762437753578887-------5435898889984148----------------86378999999999999748


Q ss_pred             CCCEEEEEC
Q ss_conf             698378702
Q gi|255764482|r  137 SSGQLSLIA  145 (225)
Q Consensus       137 pgG~~~~i~  145 (225)
                      |||.+.+=+
T Consensus       233 ~gG~LflG~  241 (268)
T COG1352         233 PGGLLFLGH  241 (268)
T ss_pred             CCCEEEECC
T ss_conf             997899826


No 198
>KOG1501 consensus
Probab=97.61  E-value=0.00013  Score=45.17  Aligned_cols=57  Identities=21%  Similarity=0.309  Sum_probs=46.7

Q ss_pred             CEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCC
Q ss_conf             7899958784389999998679988999988989999889999980664522253020044
Q gi|255764482|r   13 FHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVD   73 (225)
Q Consensus        13 ~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D   73 (225)
                      ..|||+|+|+|.+|++.+... +-.|+++|.-..|..+||+-+..|+   .++++++++.-
T Consensus        68 v~vLdigtGTGLLSmMAvrag-aD~vtA~EvfkPM~d~arkI~~kng---~SdkI~vInkr  124 (636)
T KOG1501          68 VFVLDIGTGTGLLSMMAVRAG-ADSVTACEVFKPMVDLARKIMHKNG---MSDKINVINKR  124 (636)
T ss_pred             EEEEECCCCCCHHHHHHHHHC-CCEEEEEHHHCHHHHHHHHHHHCCC---CCCCEEEECCC
T ss_conf             899972688108999988735-7707752122218999999884188---76522662036


No 199
>PRK11524 putative methyltransferase; Provisional
Probab=97.61  E-value=0.00058  Score=41.57  Aligned_cols=49  Identities=12%  Similarity=0.059  Sum_probs=38.5

Q ss_pred             CCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHC
Q ss_conf             985578999587843899999986799889999889899998899999806
Q gi|255764482|r    9 ATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPA   59 (225)
Q Consensus         9 ~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~   59 (225)
                      ..+|+.|||+.||+|..++++..  -+-+.+|+|++++.+++|++.++...
T Consensus       206 S~egDlVLDPF~GSGTT~~aA~~--lgR~~IGiEi~~eY~~iA~~Ri~~~~  254 (284)
T PRK11524        206 SNPGDIVLDPFAGSFTTGAVAKA--SGRKFIGIEINEEYIKMGLRRLDVAS  254 (284)
T ss_pred             CCCCCEEEECCCCCCHHHHHHHH--CCCCEEEEECCHHHHHHHHHHHHHCC
T ss_conf             88999899579888689999998--29958999689999999999987353


No 200
>PRK10611 chemotaxis methyltransferase CheR; Provisional
Probab=97.59  E-value=0.00087  Score=40.58  Aligned_cols=118  Identities=10%  Similarity=0.156  Sum_probs=67.3

Q ss_pred             HHHCCCCC-CCEEEEECCCHHH----HHHHHHHHC----CCCEEEEEECCHHHHHHHHHHH----HHHCCCC-CC-----
Q ss_conf             24389985-5789995878438----999999867----9988999988989999889999----9806645-22-----
Q gi|255764482|r    4 ASLVNATG-SFHLADLGAGAGA----AGLAVASRL----HEAQILLAERSPLMAHYARKTL----ALPANAQ-IS-----   64 (225)
Q Consensus         4 a~~~~~~~-~~~VLDlGcG~G~----~~l~la~r~----~~~~v~gvD~~~~~~~~A~~n~----~~~~~~~-~~-----   64 (225)
                      +..+..++ .-||.-.||-+|-    ++++++...    .+++|+|.|||+.+++.|++-+    ...+... .-     
T Consensus       107 ~~~~~~~~~~lRIWSAgCSTGEEpYSiAm~l~E~~~~~~~~~~I~aTDIs~~~L~~Ar~GiY~~~~~~~~p~~~~~ryF~  186 (287)
T PRK10611        107 AEHARRRSGEYRVWSAAASTGEEPYSIAMTLADTLGTAPGRWKVFASDIDTEVLEKARSGIYRLEELKTLSPQQLQRYFM  186 (287)
T ss_pred             HHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCCCCEEEEEECCHHHHHHHHCCCCCHHHHHCCCHHHHHHHEE
T ss_conf             99998458975899767788723999999999973237777079999798889999980898889984599999951164


Q ss_pred             -----------------CCCEEECCCCCCCCCCCCCCCCCCCCCCEEEECCC--CCCCCCCCCCCHHHHHHHCCCCCCHH
Q ss_conf             -----------------25302004442353100001235765205772265--44644654788545565205668989
Q gi|255764482|r   65 -----------------KRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPP--FNERIGTMTPDKIKEEAHVMLEDSFE  125 (225)
Q Consensus        65 -----------------~~~~~~~~D~~~~~~~~~~~~~~~~~fDlii~nPP--y~~~~~~~~~~~~~~~a~~~~~~~~~  125 (225)
                                       ..+.|.+.|+...      .....+.||+|.|-.-  ||.                  .....
T Consensus       187 ~~~~~~~g~~~v~~~lr~~V~F~~~NL~~~------~~~~~~~fDlIfCRNVlIYFd------------------~~~q~  242 (287)
T PRK10611        187 RGTGPHEGLVRVRQELANYVDFQSLNLLAK------QYTVPGPFDAIFCRNVMIYFD------------------KTTQQ  242 (287)
T ss_pred             CCCCCCCCEEEECHHHHCCCEEEHHHCCCC------CCCCCCCCEEEEECCCCCCCC------------------HHHHH
T ss_conf             157876661874578763077714006799------888889951999784053678------------------99999


Q ss_pred             HHHHHHHHHCCCCCEEEEEC
Q ss_conf             99999998624698378702
Q gi|255764482|r  126 KWIRTACAIMRSSGQLSLIA  145 (225)
Q Consensus       126 ~~~~~a~~lLkpgG~~~~i~  145 (225)
                      .+++.....|+|||.+.+=+
T Consensus       243 ~vl~~~~~~L~pgG~L~lG~  262 (287)
T PRK10611        243 EILRRFVPLLKPDGLLFAGH  262 (287)
T ss_pred             HHHHHHHHHHCCCCEEEEEC
T ss_conf             99999999868992899838


No 201
>pfam07942 N2227 N2227-like protein. This family features sequences that are similar to a region of hypothetical yeast gene product N2227. This is thought to be expressed during meiosis and may be involved in the defence response to stressful conditions.
Probab=97.58  E-value=0.0013  Score=39.62  Aligned_cols=43  Identities=21%  Similarity=0.139  Sum_probs=36.6

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHH
Q ss_conf             855789995878438999999867998899998898999988999
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKT   54 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n   54 (225)
                      +..-+||=+|||.|.+..-+|.+  +..+.|.|.|-.|+-..+.-
T Consensus        56 ~~~~~VLVPGaGLGRLa~Eia~~--G~~~~gNE~S~~Mllas~fi   98 (268)
T pfam07942        56 RSKIRILVPGAGLGRLAYELATL--GYQVQGNEFSYFMLLCSNFI   98 (268)
T ss_pred             CCCCEEEECCCCCHHHHHHHHHC--CCEEEEECCCHHHHHHHHHH
T ss_conf             77828997698803789998725--64688721219999999999


No 202
>TIGR03438 probable methyltransferase. This model represents a distinct set of uncharacterized proteins found in the bacteria. Analysis by PSI-BLAST shows remote sequence homology to methyltransferases
Probab=97.57  E-value=0.005  Score=36.31  Aligned_cols=184  Identities=16%  Similarity=0.093  Sum_probs=98.0

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHCC-CCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCC
Q ss_conf             8557899958784389999998679-988999988989999889999980664522253020044423531000012357
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRLH-EAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKN   88 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~~-~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~   88 (225)
                      .++..++|+|||++.-+..|..... ....+++|+|.++++.+.+++... .  -.-.+.-+.+|+.+.....   ....
T Consensus        62 ~~~~~lIElGsG~~~Kt~~LL~al~~~~~Y~plDIS~~~L~~s~~~l~~~-~--p~l~v~~v~~dy~~~l~~~---~~~~  135 (301)
T TIGR03438        62 GAGCELVELGSGSSRKTRLLLDALRQPARYVPIDISADALKESAAALAAD-Y--PQLEVHGICADFTQPLALP---PEPA  135 (301)
T ss_pred             CCCCEEEECCCCCCHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHH-C--CCCEEEEEEECHHCHHHCC---CCCC
T ss_conf             76764773178862378999998621563887756899999999999977-8--9976899963331574456---6557


Q ss_pred             CCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEEC----CHHHH--------------
Q ss_conf             652057722654464465478854556520566898999999998624698378702----88889--------------
Q gi|255764482|r   89 NFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIA----RPQSL--------------  150 (225)
Q Consensus        89 ~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~----~~~~l--------------  150 (225)
                      .. .-++    ++.++.+-+.++.          ....|+....+.|.||+.+.+-.    .++.+              
T Consensus       136 ~~-~rl~----~flGSsIGNf~~~----------ea~~fL~~~~~~l~~~d~lLiG~Dl~Kd~~~l~~AYnD~~GvTa~F  200 (301)
T TIGR03438       136 AG-RRLG----FFPGSTIGNFTPE----------EAVAFLRRIRQLLGPGGGLLIGVDLVKDPAVLEAAYNDAAGVTAAF  200 (301)
T ss_pred             CC-CCEE----EECCCCCCCCCHH----------HHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHCCCCCCHHHH
T ss_conf             88-7589----9707544789989----------9999999999971999848994044569899998732964424789


Q ss_pred             -----HHHHHHHHCCCCC--EEEEEECCCCCCCCEEEEE--EEEEC-----CCCCCEEECCEEEECCCCCHHHH-HHHHH
Q ss_conf             -----9999985217884--6999814589698309999--99977-----88874770756898388740018-99999
Q gi|255764482|r  151 -----IQIVNACARRIGS--LEITPLHPREGECASRILV--TGRKG-----MRGQLRFRYPIVLHKPNGQPYSR-FVTDL  215 (225)
Q Consensus       151 -----~~~l~~~~~~~~~--~~i~~v~~~~~~~~~~vlv--~~~k~-----~~~~~~~~~~l~l~~~~g~~yt~-~~~~l  215 (225)
                           ..+-..+...+..  ++-..+|   +....++-.  .+++.     ......|.++-.||.+....||. +++.+
T Consensus       201 nlN~L~~iNr~Lg~dF~~~~f~h~a~y---n~~~~riem~L~s~~~q~V~i~~~~~~f~~GE~I~tE~S~Ky~~~~~~~l  277 (301)
T TIGR03438       201 NLNLLRRLNRELGGDFDPDAFRHRAFY---NEERSRIEMHLVSRRDQTVRLAGLTVRFAAGETIHTENSYKFSLERFAAL  277 (301)
T ss_pred             HHHHHHHHHHHHCCCCCHHHCEEEEEE---CCCCCEEEEEEEECCCEEEEECCEEEEECCCCEEEEEEEECCCHHHHHHH
T ss_conf             997999999984778576556799998---68778799999816855999899788844989899997408799999999


Q ss_pred             HC
Q ss_conf             73
Q gi|255764482|r  216 IN  217 (225)
Q Consensus       216 ~~  217 (225)
                      .+
T Consensus       278 ~~  279 (301)
T TIGR03438       278 AA  279 (301)
T ss_pred             HH
T ss_conf             99


No 203
>KOG3045 consensus
Probab=97.56  E-value=0.0004  Score=42.45  Aligned_cols=123  Identities=14%  Similarity=0.197  Sum_probs=74.5

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             55789995878438999999867998899998898999988999998066452225302004442353100001235765
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNF   90 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~   90 (225)
                      ....|.|+|||-+-++.    .. .-.|..+|+-+                   .+-+++.+|+.+..       ..+++
T Consensus       180 ~~~vIaD~GCGEakiA~----~~-~~kV~SfDL~a-------------------~~~~V~~cDm~~vP-------l~d~s  228 (325)
T KOG3045         180 KNIVIADFGCGEAKIAS----SE-RHKVHSFDLVA-------------------VNERVIACDMRNVP-------LEDES  228 (325)
T ss_pred             CCEEEEECCCCHHHHHH----CC-CCCEEEEEEEC-------------------CCCCEEECCCCCCC-------CCCCC
T ss_conf             76478853664233320----46-66504663002-------------------78853532244786-------76675


Q ss_pred             CCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHHHHHHHH---HHHHC-CCCCEEE
Q ss_conf             2057722654464465478854556520566898999999998624698378702888899999---98521-7884699
Q gi|255764482|r   91 YDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIV---NACAR-RIGSLEI  166 (225)
Q Consensus        91 fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~~l~~~l---~~~~~-~~~~~~i  166 (225)
                      .|+++.--                   .....++.+|+..|.|.|++||.+++.-=.+|+.++-   .++.. ++.    
T Consensus       229 vDvaV~CL-------------------SLMgtn~~df~kEa~RiLk~gG~l~IAEv~SRf~dv~~f~r~l~~lGF~----  285 (325)
T KOG3045         229 VDVAVFCL-------------------SLMGTNLADFIKEANRILKPGGLLYIAEVKSRFSDVKGFVRALTKLGFD----  285 (325)
T ss_pred             CCEEEEEH-------------------HHHCCCHHHHHHHHHHHHCCCCEEEEEEHHHHCCCHHHHHHHHHHCCCE----
T ss_conf             44787527-------------------5534338999999988733586699986022134088999999872870----


Q ss_pred             EEECCCCCCCCEEEEEEEEECCC
Q ss_conf             98145896983099999997788
Q gi|255764482|r  167 TPLHPREGECASRILVTGRKGMR  189 (225)
Q Consensus       167 ~~v~~~~~~~~~~vlv~~~k~~~  189 (225)
                        +...........+++|.|-..
T Consensus       286 --~~~~d~~n~~F~lfefkK~~~  306 (325)
T KOG3045         286 --VKHKDVSNKYFTLFEFKKTPK  306 (325)
T ss_pred             --EEEHHHHCCEEEEEEEECCCC
T ss_conf             --221100004189899733783


No 204
>PRK09880 L-idonate 5-dehydrogenase; Provisional
Probab=97.54  E-value=0.0014  Score=39.39  Aligned_cols=102  Identities=15%  Similarity=0.149  Sum_probs=63.0

Q ss_pred             HCCCCCCCEEEEECCCHHH-HHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC
Q ss_conf             3899855789995878438-999999867998899998898999988999998066452225302004442353100001
Q gi|255764482|r    6 LVNATGSFHLADLGAGAGA-AGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA   84 (225)
Q Consensus         6 ~~~~~~~~~VLDlGcG~G~-~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~   84 (225)
                      .....+|++||=+|+|+-. +.+.+++.....+|+++|.++.-++.|++.    +...   -+.....|+...       
T Consensus       164 ~~~~~~g~~VlV~G~G~iGl~~~~~ak~~Ga~~Vi~~d~~~~rl~~a~~~----Ga~~---~i~~~~~~~~~~-------  229 (343)
T PRK09880        164 QAGDLQGKRVFISGVGPIGCLIVSAVKTLGAAEIVCADLSPRSLSLARQM----GADV---LVNPQNDDMDHW-------  229 (343)
T ss_pred             HCCCCCCCEEEEECCCHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHC----CCCE---EECCCCCCHHHH-------
T ss_conf             24775698899984776799999999986998799997978999999972----9979---987987439999-------


Q ss_pred             CCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             2357652057722654464465478854556520566898999999998624698378702
Q gi|255764482|r   85 GLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIA  145 (225)
Q Consensus        85 ~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~  145 (225)
                      ....+.+|.++--                        ......++.+.+++++||++.++-
T Consensus       230 ~~~~g~~Dvvie~------------------------~G~~~~~~~al~~~r~gG~iv~vG  266 (343)
T PRK09880        230 KAEKGYFDVSFEV------------------------SGHPSSVNTCLEVTRAKGVMVQVG  266 (343)
T ss_pred             HHHCCCCCEEEEE------------------------CCCHHHHHHHHHHCCCCEEEEEEE
T ss_conf             9636997789992------------------------199999999997377983999997


No 205
>pfam05185 PRMT5 PRMT5 arginine-N-methyltransferase. The human homologue of yeast Skb1 (Shk1 kinase-binding protein 1) is PRMT5, an arginine-N-methyltransferase. These proteins appear to be key mitotic regulators. They play a role in Jak signalling in higher eukaryotes.
Probab=97.54  E-value=0.0017  Score=38.87  Aligned_cols=103  Identities=16%  Similarity=0.164  Sum_probs=70.7

Q ss_pred             CEEEEECCCHHHH---HHHHHHHCC-CCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCC
Q ss_conf             7899958784389---999998679-988999988989999889999980664522253020044423531000012357
Q gi|255764482|r   13 FHLADLGAGAGAA---GLAVASRLH-EAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKN   88 (225)
Q Consensus        13 ~~VLDlGcG~G~~---~l~la~r~~-~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~   88 (225)
                      -.|+=+|+|-|-+   ++-++++.. ..+|++||.+|.++-..+..+...   ...++++++..|.+.+..        .
T Consensus       188 ~vI~VvGAGRGPLV~~~l~A~~~~~~~v~i~AVEKNpnA~vtL~~r~n~~---~W~~~V~ii~~DMR~w~~--------p  256 (447)
T pfam05185       188 LVILVVGAGRGPLVDRALRAAEETGRKVKIYAVEKNPNAVVTLQKRVNFE---EWGDKVTLISSDMREWKG--------P  256 (447)
T ss_pred             EEEEEECCCCCHHHHHHHHHHHHCCCCEEEEEEECCHHHHHHHHHHHHHH---HCCCCEEEEECCHHCCCC--------C
T ss_conf             69999858964899999999998199669999956877999999985054---317806999080005799--------8


Q ss_pred             CCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEE
Q ss_conf             652057722654464465478854556520566898999999998624698378
Q gi|255764482|r   89 NFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLS  142 (225)
Q Consensus        89 ~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~  142 (225)
                      .++|++++.-=-..+.                .....+-+..+.+.|||.|...
T Consensus       257 ~k~Di~VSELLGSFGD----------------NELSPECLdg~q~~lk~~gIsI  294 (447)
T pfam05185       257 EKADILVSELLGSFGD----------------NELSPECLDGAQRFLKPDGISI  294 (447)
T ss_pred             CCCCEEEEECCCCCCC----------------CCCCHHHHHHHHHHCCCCCEEE
T ss_conf             7735897521166666----------------5579778778997468984682


No 206
>pfam01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family.
Probab=97.54  E-value=0.0011  Score=39.97  Aligned_cols=119  Identities=19%  Similarity=0.144  Sum_probs=64.9

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHH-CCCCCCCCCE--------------------
Q ss_conf             8557899958784389999998679988999988989999889999980-6645222530--------------------
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALP-ANAQISKRIS--------------------   68 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~-~~~~~~~~~~--------------------   68 (225)
                      .+|+++||+|||+-...+.-|.+. --+|+..|..+.-.+..++.++.. +.-.++..++                    
T Consensus        55 ~kg~~LiDvG~GPtiy~~lsA~~~-f~~I~lsDy~~~Nr~el~kWl~~ep~afDWs~~~~~v~~lEG~~~~~~e~ee~lR  133 (261)
T pfam01234        55 VKGDTLIDIGSGPTIYQLLSACEV-FKEIHLSDYLPQNRDELIKWLKKEPGAFDWSPVLKHICELEGDRECWQEKEEKLR  133 (261)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHH-CCEEEECCCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHH
T ss_conf             466689984789458888767765-0717860255767999999970699866661999999862267641578889999


Q ss_pred             -----EECCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEE
Q ss_conf             -----200444235310000123576520577226544644654788545565205668989999999986246983787
Q gi|255764482|r   69 -----LIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSL  143 (225)
Q Consensus        69 -----~~~~D~~~~~~~~~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~  143 (225)
                           ++..|+.......  ....-..||.+++.   +.           ..+-......+..-++....+|||||.+.+
T Consensus       134 ~~Ik~Vl~cDV~~~~pl~--~~~~lp~~D~v~S~---~c-----------LE~ac~d~~~Y~~av~ni~~LLkpGG~Lil  197 (261)
T pfam01234       134 ALVKRVLKCDVHQSPPLG--AGVQLPPADCVVTI---FC-----------LEYACPDLEEYCRALRNLASLLKPGGHLVL  197 (261)
T ss_pred             HHHHEEEECCCCCCCCCC--CCCCCCCCCEEEEE---EE-----------HHHHCCCHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             886448876556888888--86667885588476---22-----------556619999999999999864788846999


Q ss_pred             EC
Q ss_conf             02
Q gi|255764482|r  144 IA  145 (225)
Q Consensus       144 i~  145 (225)
                      +.
T Consensus       198 ~g  199 (261)
T pfam01234       198 GG  199 (261)
T ss_pred             EE
T ss_conf             98


No 207
>KOG1253 consensus
Probab=97.53  E-value=9.8e-05  Score=45.91  Aligned_cols=109  Identities=14%  Similarity=0.261  Sum_probs=84.6

Q ss_pred             CCCCCCEEEEECCCHHHHHHHHHHHCCC-CEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCC
Q ss_conf             9985578999587843899999986799-889999889899998899999806645222530200444235310000123
Q gi|255764482|r    8 NATGSFHLADLGAGAGAAGLAVASRLHE-AQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGL   86 (225)
Q Consensus         8 ~~~~~~~VLDlGcG~G~~~l~la~r~~~-~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~   86 (225)
                      .-.++-+|||.-|++|.-++-.|+..++ .++++.|.++.+++.-++|++.|+   .++.++..+.|........   ..
T Consensus       106 ~~~~~l~vLealsAtGlrslRya~El~~v~~v~AnD~~~~aV~~i~~Nv~~N~---v~~ive~~~~DA~~lM~~~---~~  179 (525)
T KOG1253         106 REEKSLRVLEALSATGLRSLRYAKELPGVRQVVANDLNENAVTSIQRNVELNG---VEDIVEPHHSDANVLMYEH---PM  179 (525)
T ss_pred             HCCCCCHHHHHHHHHHHHHHHHHHHHCCHHHHCCCCCCHHHHHHHHHHHHHCC---CHHHCCCCCCHHHHHHHHC---CC
T ss_conf             32675008987645517888998870424531036787778899986655067---3221124410277898756---45


Q ss_pred             CCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             5765205772265446446547885455652056689899999999862469837870
Q gi|255764482|r   87 KNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLI  144 (225)
Q Consensus        87 ~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i  144 (225)
                      ....||.|--. ||+.                     ...|++.|.+-++.||.+++.
T Consensus       180 ~~~~FDvIDLD-PyGs---------------------~s~FLDsAvqav~~gGLL~vT  215 (525)
T KOG1253         180 VAKFFDVIDLD-PYGS---------------------PSPFLDSAVQAVRDGGLLCVT  215 (525)
T ss_pred             CCCCCCEEECC-CCCC---------------------CCHHHHHHHHHHHCCCEEEEE
T ss_conf             21246667237-8899---------------------627799999986408779998


No 208
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only]
Probab=97.50  E-value=0.0017  Score=38.92  Aligned_cols=98  Identities=19%  Similarity=0.231  Sum_probs=64.5

Q ss_pred             CCCCCCCEEEEECCC-HHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCC
Q ss_conf             899855789995878-4389999998679988999988989999889999980664522253020044423531000012
Q gi|255764482|r    7 VNATGSFHLADLGAG-AGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAG   85 (225)
Q Consensus         7 ~~~~~~~~VLDlGcG-~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~   85 (225)
                      .++++|++|+=.|+| .|.+++.+|+.. +++|+++|++++-.+.|++--    ..      .++..-      +.....
T Consensus       162 ~~~~pG~~V~I~G~GGlGh~avQ~Aka~-ga~Via~~~~~~K~e~a~~lG----Ad------~~i~~~------~~~~~~  224 (339)
T COG1064         162 ANVKPGKWVAVVGAGGLGHMAVQYAKAM-GAEVIAITRSEEKLELAKKLG----AD------HVINSS------DSDALE  224 (339)
T ss_pred             CCCCCCCEEEEECCCHHHHHHHHHHHHC-CCEEEEEECCHHHHHHHHHHC----CC------EEEECC------CCHHHH
T ss_conf             3899998999987748999999999986-996999957877999999848----82------899767------811667


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECC
Q ss_conf             3576520577226544644654788545565205668989999999986246983787028
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIAR  146 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~  146 (225)
                      ...+.||.++..-|                         ..-+..+.++|+++|++.++--
T Consensus       225 ~~~~~~d~ii~tv~-------------------------~~~~~~~l~~l~~~G~~v~vG~  260 (339)
T COG1064         225 AVKEIADAIIDTVG-------------------------PATLEPSLKALRRGGTLVLVGL  260 (339)
T ss_pred             HHHHHCCEEEECCC-------------------------HHHHHHHHHHHHCCCEEEEECC
T ss_conf             76734739999877-------------------------4559999998642978999788


No 209
>PRK10742 putative methyltransferase; Provisional
Probab=97.45  E-value=0.002  Score=38.52  Aligned_cols=94  Identities=22%  Similarity=0.332  Sum_probs=67.2

Q ss_pred             CCHHHCCCCCCC--EEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCC-----CCCCCEEECCCC
Q ss_conf             662438998557--8999587843899999986799889999889899998899999806645-----222530200444
Q gi|255764482|r    2 ILASLVNATGSF--HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQ-----ISKRISLIEVDV   74 (225)
Q Consensus         2 lLa~~~~~~~~~--~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~-----~~~~~~~~~~D~   74 (225)
                      .||.-+..+.+.  +|+|.-+|-|.-+..||..  +++|+.+|.+|-+..+...-+.......     +..+++++++|.
T Consensus        77 ~lakAvG~k~~~~P~VlDATAGLGrDAfvLAsl--Gc~VtliER~Pvv~aLL~DgL~RA~~~~e~~~~i~~Rm~L~~gds  154 (250)
T PRK10742         77 AVAKAVGIKGDYLPDVVDATAGLGRDAFVLASV--GCRVRMLERNPVVAALLDDGLARGYADAEIGGWLQERLQLIHASS  154 (250)
T ss_pred             HHHHHHCCCCCCCCEEEECCCCCCHHHHHHHHC--CCEEEEEECCHHHHHHHHHHHHHHHHCCHHHHHHHHHCEEECCCH
T ss_conf             667875667899981898788746889999817--986999978899999999999998738155899996167865868


Q ss_pred             CCCCCCCCCCCCCCCCCCEEEECCCCCCC
Q ss_conf             23531000012357652057722654464
Q gi|255764482|r   75 TLVGENRNLAGLKNNFYDHVIMNPPFNER  103 (225)
Q Consensus        75 ~~~~~~~~~~~~~~~~fDlii~nPPy~~~  103 (225)
                      ......      ....+|.|.-.|-|-..
T Consensus       155 ~~~L~~------~~~~~DVIYLDPMFP~r  177 (250)
T PRK10742        155 LTALTD------ITPRPQVVYLDPMFPHK  177 (250)
T ss_pred             HHHHHH------CCCCCCEEEECCCCCCC
T ss_conf             999973------58898889973667765


No 210
>pfam01795 Methyltransf_5 MraW methylase family. Members of this family are probably SAM dependent methyltransferases based on Escherichia coli mraW. This family appears to be related to pfam01596.
Probab=97.40  E-value=0.001  Score=40.21  Aligned_cols=69  Identities=22%  Similarity=0.279  Sum_probs=56.0

Q ss_pred             HHCCCCCCCEEEEECCCHHHHHHHHHHHCC-CCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCC
Q ss_conf             438998557899958784389999998679-98899998898999988999998066452225302004442353
Q gi|255764482|r    5 SLVNATGSFHLADLGAGAGAAGLAVASRLH-EAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVG   78 (225)
Q Consensus         5 ~~~~~~~~~~VLDlGcG~G~~~l~la~r~~-~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~   78 (225)
                      .+..+++++.++|-=.|.|+.|..+..+.+ +++++|+|.|+.+++.|+++...     ...++.++++++....
T Consensus        14 ~~L~~~~~g~yvD~T~G~GGHS~~iL~~~~~~~~li~iDrD~~ai~~a~~~l~~-----~~~r~~~~~~nF~~l~   83 (310)
T pfam01795        14 ELLNIKPDGIYIDCTLGGGGHSEAILEQLPEEGRLIGIDRDPQAIANAKERLKP-----FKGRVTLIHSNFANLF   83 (310)
T ss_pred             HHCCCCCCCEEEEECCCCCHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHCCC-----CCCCEEEEECCHHHHH
T ss_conf             726838999999958897199999998489999799998989999999985302-----5885899925375799


No 211
>pfam03141 DUF248 Putative methyltransferase. Members of this family of hypothetical plant proteins are probably methyltransferases: several of the aligned sequences either match the methyltransferase profile, or contain a SAM-binding motif. A protein from Arabidopsis thaliana contains both. Several family members are described as ankyrin like.
Probab=97.39  E-value=9.1e-05  Score=46.10  Aligned_cols=104  Identities=17%  Similarity=0.226  Sum_probs=58.0

Q ss_pred             CHHHCCC----CCCCEEEEECCCHHHHHHHHHHHCCCCEEEEE-----ECCHHHHHHHHHHHHHHCCCCCCCCCEEECCC
Q ss_conf             6243899----85578999587843899999986799889999-----88989999889999980664522253020044
Q gi|255764482|r    3 LASLVNA----TGSFHLADLGAGAGAAGLAVASRLHEAQILLA-----ERSPLMAHYARKTLALPANAQISKRISLIEVD   73 (225)
Q Consensus         3 La~~~~~----~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gv-----D~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D   73 (225)
                      |+..++.    ..-..|||+|||.+.++-.|..+    .|...     |..+.++..|-+.    |....          
T Consensus       105 i~~~ip~~~~~~~vRt~LDvGCGVASfGayLl~r----~vltMS~AP~D~HeaQVQfALER----GiPA~----------  166 (506)
T pfam03141       105 LAQVIPLIAWGGRVRTALDVGCGVASFGAYLLSR----DVLTMSFAPKDVHEAQVQFALER----GVPAM----------  166 (506)
T ss_pred             HHHHCCCCCCCCCEEEEEECCCCEECHHHHHHCC----CCEEEEECCCCCHHHHHHHHHHC----CCHHH----------
T ss_conf             9985675557985689997688721037776327----84588734764118889999971----85256----------


Q ss_pred             CCCCCCCCCCCCCCCCCCCEEEE---CCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECC
Q ss_conf             42353100001235765205772---26544644654788545565205668989999999986246983787028
Q gi|255764482|r   74 VTLVGENRNLAGLKNNFYDHVIM---NPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIAR  146 (225)
Q Consensus        74 ~~~~~~~~~~~~~~~~~fDlii~---nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~  146 (225)
                      +- ..... -...+..+||++-|   .-|++..++.                    ++-..-|+|+|||.+.+.-|
T Consensus       167 ig-vlgT~-rLPyPs~sFDm~HCsRC~IpW~~~dG~--------------------~LlEvdRvLRPGGYfV~S~p  220 (506)
T pfam03141       167 LG-VLGTR-RLPYPSRSFDMAHCSRCLIPWHANDGI--------------------LLLEVDRVLRPGGYFVLSGP  220 (506)
T ss_pred             HH-HHHCC-CCCCCCCCCCHHHHCCCCCCCCCCCCE--------------------EEEEEEHCCCCCCEEEECCC
T ss_conf             65-64035-358875330124422456741047977--------------------88654000047866994678


No 212
>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only]
Probab=97.34  E-value=0.0037  Score=37.00  Aligned_cols=103  Identities=20%  Similarity=0.212  Sum_probs=62.0

Q ss_pred             EEEECCCHHHHHHHHHHHCCC-CEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCC-CCCC
Q ss_conf             999587843899999986799-88999988989999889999980664522253020044423531000012357-6520
Q gi|255764482|r   15 LADLGAGAGAAGLAVASRLHE-AQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKN-NFYD   92 (225)
Q Consensus        15 VLDlGcG~G~~~l~la~r~~~-~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~-~~fD   92 (225)
                      ++|+|||+|..+ .++..... ..++|+|.++.++..++..... .....   +.+...|....     ...... ..||
T Consensus        52 ~ld~~~g~g~~~-~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~-~~~~~---~~~~~~~~~~~-----~~~~~~~~~~d  121 (257)
T COG0500          52 VLDIGCGTGRLA-LLARLGGRGAYVVGVDLSPEMLALARARAEG-AGLGL---VDFVVADALGG-----VLPFEDSASFD  121 (257)
T ss_pred             EEEEECCCCHHH-HHHHHHCCCCEEEEECCCHHHHHHHHHHHCC-CCCCC---EEEEECCCCCC-----CCCCCCCCEEE
T ss_conf             588603854689-9999735785799936888999999986300-45663---57676042135-----56756666577


Q ss_pred             EEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECC
Q ss_conf             577226544644654788545565205668989999999986246983787028
Q gi|255764482|r   93 HVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIAR  146 (225)
Q Consensus        93 lii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~  146 (225)
                      .+.....+...                .   ....+..+.+.++|+|.+.+...
T Consensus       122 ~~~~~~~~~~~----------------~---~~~~~~~~~~~l~~~g~~~~~~~  156 (257)
T COG0500         122 LVISLLVLHLL----------------P---PAKALRELLRVLKPGGRLVLSDL  156 (257)
T ss_pred             EEEECCHHHHH----------------H---HHHHHHHHHHHCCCCCEEEEEEC
T ss_conf             89861234430----------------2---89999999987078868999962


No 213
>PRK13699 putative methylase; Provisional
Probab=97.32  E-value=0.00096  Score=40.34  Aligned_cols=47  Identities=17%  Similarity=0.078  Sum_probs=39.0

Q ss_pred             CCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHH
Q ss_conf             9855789995878438999999867998899998898999988999998
Q gi|255764482|r    9 ATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLAL   57 (225)
Q Consensus         9 ~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~   57 (225)
                      ..+|+.|||+.+|+|..+++..  .-+.+.+|+|++++.+++|++.++.
T Consensus       161 S~~gdlVLDPF~GSGTT~vAA~--~lgR~fIGiEi~~~Y~~ia~~Rl~~  207 (227)
T PRK13699        161 THPNAIVLDPFAGSGSTCVAAL--QSGRRYIGIELLEQYHRAGQQRLAA  207 (227)
T ss_pred             CCCCCEEEECCCCCCHHHHHHH--HCCCCEEEEECCHHHHHHHHHHHHH
T ss_conf             9999999977998758999999--8199489996899999999999999


No 214
>KOG1099 consensus
Probab=97.26  E-value=0.00036  Score=42.76  Aligned_cols=116  Identities=15%  Similarity=0.216  Sum_probs=69.8

Q ss_pred             CEEEEECCCHHHHHHHHHHHCCC------C---EEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC
Q ss_conf             78999587843899999986799------8---89999889899998899999806645222530200444235310000
Q gi|255764482|r   13 FHLADLGAGAGAAGLAVASRLHE------A---QILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL   83 (225)
Q Consensus        13 ~~VLDlGcG~G~~~l~la~r~~~------~---~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~   83 (225)
                      .||+|+|+-.|..|..++++...      .   .+++||+++.+=        .       .-+.-+++||.+.......
T Consensus        43 ~rvVDLCAAPGSWSQvlSrkL~~~~~~~~~~~~kIVaVDLQ~MaP--------I-------~GV~qlq~DIT~~stae~I  107 (294)
T KOG1099          43 KRVVDLCAAPGSWSQVLSRKLYKPLPSSGERDKKIVAVDLQPMAP--------I-------EGVIQLQGDITSASTAEAI  107 (294)
T ss_pred             HHHHHHHCCCCCHHHHHHHHHHCCCCCCCHHHCCEEEEECCCCCC--------C-------CCEEEEECCCCCHHHHHHH
T ss_conf             677435308983999999997324887420116279985565776--------6-------7627850455777689999


Q ss_pred             CCCCC-CCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEE-ECCHHHH
Q ss_conf             12357-6520577226544644654788545565205668989999999986246983787-0288889
Q gi|255764482|r   84 AGLKN-NFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSL-IARPQSL  150 (225)
Q Consensus        84 ~~~~~-~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~-i~~~~~l  150 (225)
                      ..+.. ++.|+|+|.--= +-.+....+... .     ...+-.-+..+...|||||.|.- |++....
T Consensus       108 i~hfggekAdlVvcDGAP-DvTGlHd~DEy~-Q-----~qLllaAl~i~t~Vlk~Gg~FVaKifRg~~t  169 (294)
T KOG1099         108 IEHFGGEKADLVVCDGAP-DVTGLHDLDEYV-Q-----AQLLLAALNIATCVLKPGGSFVAKIFRGRDT  169 (294)
T ss_pred             HHHHCCCCCCEEEECCCC-CCCCCCCHHHHH-H-----HHHHHHHHHHHHHEECCCCEEEHHHHCCCCH
T ss_conf             998579976678847998-744532088999-9-----9999999877742014787525546426750


No 215
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase. Members of this protein family are mycothiol-dependent formaldehyde dehydrogenase (EC 1.2.1.66). This protein is found, so far, only in the Actinobacteria (Mycobacterium sp., Streptomyces sp., Corynebacterium sp., and related species), where mycothione replaces glutathione.
Probab=97.26  E-value=0.0071  Score=35.44  Aligned_cols=104  Identities=16%  Similarity=0.129  Sum_probs=63.1

Q ss_pred             HCCCCCCCEEEEECCCHHH-HHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC
Q ss_conf             3899855789995878438-999999867998899998898999988999998066452225302004442353100001
Q gi|255764482|r    6 LVNATGSFHLADLGAGAGA-AGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA   84 (225)
Q Consensus         6 ~~~~~~~~~VLDlGcG~G~-~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~   84 (225)
                      ..+.++|++||=+|+|.-. +++.+|+.....+|+++|.++.-++.|++.    +..   ..+.....|..     ....
T Consensus       171 ~~~~~~g~~VlV~GaG~iGl~a~~~ak~~Ga~~Vi~~d~~~~rl~~A~~l----Ga~---~~i~~~~~~~~-----~~v~  238 (358)
T TIGR03451       171 TGGVKRGDSVAVIGCGGVGDAAIAGAALAGASKIIAVDIDDRKLEWAREF----GAT---HTVNSSGTDPV-----EAIR  238 (358)
T ss_pred             HCCCCCCCEEEEECCCHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHC----CCE---EEECCCCCCHH-----HHHH
T ss_conf             40799998899967376999999999983991899991988999999965----990---99739987889-----9999


Q ss_pred             CCCCC-CCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             23576-52057722654464465478854556520566898999999998624698378702
Q gi|255764482|r   85 GLKNN-FYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIA  145 (225)
Q Consensus        85 ~~~~~-~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~  145 (225)
                      ...++ .+|.++---                        .....++.+.+++++||++.++-
T Consensus       239 ~~t~g~G~Dvvie~~------------------------G~~~~~~~al~~~~~gG~iv~~G  276 (358)
T TIGR03451       239 ALTGGFGADVVIDAV------------------------GRPETYKQAFYARDLAGTVVLVG  276 (358)
T ss_pred             HHHCCCCCCEEEECC------------------------CCHHHHHHHHHHHCCCCEEEEEE
T ss_conf             985898874999999------------------------99899999999762796999992


No 216
>KOG2793 consensus
Probab=97.25  E-value=0.013  Score=34.03  Aligned_cols=119  Identities=18%  Similarity=0.227  Sum_probs=64.2

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             55789995878438999999867998899998898999988999998066452225302004442353100001235765
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNF   90 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~   90 (225)
                      +..+||++|+|+|..+++.|.. ..+++.-.|.-..... ...|...+.........++... ...+.............
T Consensus        86 ~~~~vlELGsGtglvG~~aa~~-~~~~v~ltD~~~~~~~-L~~~~~~~~~~l~~~g~~v~v~-~L~Wg~~~~~~~~~~~~  162 (248)
T KOG2793          86 KYINVLELGSGTGLVGILAALL-LGAEVVLTDLPKVVEN-LKFNRDKNNIALNQLGGSVIVA-ILVWGNALDVSFRLPNP  162 (248)
T ss_pred             CCEEEEEECCCCCHHHHHHHHH-HCCEECCCCCHHHHHH-HHHHHHHHHHHHHHCCCCEEEE-EEECCCCCCHHHCCCCC
T ss_conf             6405899668755899999987-3664512775026788-8886656566664037823699-87468865575526876


Q ss_pred             CCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHHHH
Q ss_conf             205772265446446547885455652056689899999999862469837870288889
Q gi|255764482|r   91 YDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSL  150 (225)
Q Consensus        91 fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~~l  150 (225)
                      ||+|++.-+++.                  ...++.++.....+|-.+|...+.++-.+.
T Consensus       163 ~DlilasDvvy~------------------~~~~e~Lv~tla~ll~~~~~i~l~~~lr~~  204 (248)
T KOG2793         163 FDLILASDVVYE------------------EESFEGLVKTLAFLLAKDGTIFLAYPLRRD  204 (248)
T ss_pred             CCEEEEEEEEEC------------------CCCCHHHHHHHHHHHHCCCEEEEEEECCCC
T ss_conf             557998530551------------------776146999999997438848999860020


No 217
>KOG2940 consensus
Probab=97.25  E-value=0.00043  Score=42.27  Aligned_cols=101  Identities=15%  Similarity=0.122  Sum_probs=65.0

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             85578999587843899999986799889999889899998899999806645222530200444235310000123576
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNN   89 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~   89 (225)
                      +....++|+||+.|.++-.+-.+. -.+++-+|.|-.|++.+++.--      -+.......+|-.       ......+
T Consensus        71 k~fp~a~diGcs~G~v~rhl~~e~-vekli~~DtS~~M~~s~~~~qd------p~i~~~~~v~DEE-------~Ldf~en  136 (325)
T KOG2940          71 KSFPTAFDIGCSLGAVKRHLRGEG-VEKLIMMDTSYDMIKSCRDAQD------PSIETSYFVGDEE-------FLDFKEN  136 (325)
T ss_pred             HHCCCEEECCCCHHHHHHHHHHCC-HHHEEEEECCHHHHHHHHCCCC------CCEEEEEEECCHH-------CCCCCCC
T ss_conf             607520440655446568877525-1340664041679997532689------8537999725510-------1565535


Q ss_pred             CCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEE
Q ss_conf             52057722654464465478854556520566898999999998624698378
Q gi|255764482|r   90 FYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLS  142 (225)
Q Consensus        90 ~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~  142 (225)
                      ++|+|++.-..++.                  +.+..|+..+...|||.|.+.
T Consensus       137 s~DLiisSlslHW~------------------NdLPg~m~~ck~~lKPDg~Fi  171 (325)
T KOG2940         137 SVDLIISSLSLHWT------------------NDLPGSMIQCKLALKPDGLFI  171 (325)
T ss_pred             CHHHHHHHHHHHHH------------------CCCCHHHHHHHHHCCCCCCCH
T ss_conf             01112654334564------------------048368999887428975121


No 218
>TIGR00452 TIGR00452 methyltransferase, putative; InterPro: IPR010017   Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals. The reaction is catalyzed by methyltransferases (Mtases) and modifies DNA, RNA, proteins and small molecules, such as catechol for regulatory purposes. The various aspects of the role of DNA methylation in prokaryotic restriction-modification systems and in a number of cellular processes in eukaryotes including gene regulation and differentiation is well documented.   Three classes of DNA Mtases transfer the methyl group from AdoMet to the target base to form either N-6-methyladenine, or N-4-methylcytosine, or C-5- methylcytosine. In C-5-cytosine Mtases, ten conserved motifs are arranged in the same order . Motif I (a glycine-rich or closely related consensus sequence; FAGxGG in M.HhaI ), shared by other AdoMet-Mtases , is part of the cofactor binding site and motif IV (PCQ) is part of the catalytic site. In contrast, sequence comparison among N-6-adenine and N-4-cytosine Mtases indicated two of the conserved segments , although more conserved segments may be present. One of them corresponds to motif I in C-5-cytosine Mtases, and the other is named (D/N/S)PP(Y/F). Crystal structures are known for a number of Mtases , , , . The cofactor binding sites are almost identical and the essential catalytic amino acids coincide. The comparable protein folding and the existence of equivalent amino acids in similar secondary and tertiary positions indicate that many (if not all) AdoMet-Mtases have a common catalytic domain structure. This permits tertiary structure prediction of other DNA, RNA, protein, and small-molecule AdoMet-Mtases from their amino acid sequences .   This is a set of proteobacterial proteins, which have homology in their central region to a large number of methyltransferases active on a variety of substrates. .
Probab=97.22  E-value=0.0038  Score=36.98  Aligned_cols=107  Identities=21%  Similarity=0.223  Sum_probs=63.4

Q ss_pred             CCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCC
Q ss_conf             98557899958784389999998679988999988989999889999980664522253020044423531000012357
Q gi|255764482|r    9 ATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKN   88 (225)
Q Consensus         9 ~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~   88 (225)
                      +-.+..|+|+|||+|....-+...  |++ ..|=+||..+-..+.-+-..- -+.+.++....-=++      .+.....
T Consensus       119 pL~~~~i~DVGC~~GY~~~~M~~~--Gak-~~VG~DP~~L~~~QFE~~~~l-l~~~~~~~l~~LGiE------~l~~~~p  188 (316)
T TIGR00452       119 PLKGRTILDVGCGSGYHLWRMLGE--GAK-LLVGIDPTELFLCQFEAVRKL-LDNDKRAILLPLGIE------QLQELKP  188 (316)
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHC--CCC-EEEECCHHHHHHHHHHHHHHH-HCCCCEEEEECCCHH------HHHHCCC
T ss_conf             545777898336870688977620--782-787436578999999999987-242355754036702------2232076


Q ss_pred             CCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEE
Q ss_conf             6520577226544644654788545565205668989999999986246983787
Q gi|255764482|r   89 NFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSL  143 (225)
Q Consensus        89 ~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~  143 (225)
                      +.||.|.|---.+++                  .+.-+-+......|+.+|.+.+
T Consensus       189 nAFD~vFs~GVLYHR------------------kSPLe~L~~L~~~L~~~GELVL  225 (316)
T TIGR00452       189 NAFDTVFSLGVLYHR------------------KSPLEHLKQLKDQLVKKGELVL  225 (316)
T ss_pred             CCCEEEEECCHHHCC------------------CCCHHHHHHHHHHHHHCCCEEE
T ss_conf             412031220202115------------------5708999999999875793586


No 219
>TIGR00497 hsdM type I restriction-modification system, M subunit; InterPro: IPR004546   There are four classes of restriction endonucleases: types I, II,III and IV. All types of enzymes recognise specific short DNA sequences and carry out the endonucleolytic cleavage of DNA to give specific double-stranded fragments with terminal 5'-phosphates. They differ in their recognition sequence, subunit composition, cleavage position, and cofactor requirements , , as summarised below:    Type I enzymes (3.1.21.3 from EC) cleave at sites remote from recognition site; require both ATP and S-adenosyl-L-methionine to function; multifunctional protein with both restriction and methylase (2.1.1.72 from EC) activities. Type II enzymes (3.1.21.4 from EC) cleave within or at short specific distances from recognition site; most require magnesium; single function (restriction) enzymes independent of methylase. Type III enzymes (3.1.21.5 from EC) cleave at sites a short distance from recognition site; require ATP (but doesn't hydrolyse it); S-adenosyl-L-methionine stimulates reaction but is not required; exists as part of a complex with a modification methylase methylase (2.1.1.72 from EC). Type IV enzymes target methylated DNA.    Type I restriction endonucleases are components of prokaryotic DNA restriction-modification mechanisms that protects the organism against invading foreign DNA. Type I enzymes have three different subunits subunits - M (modification), S (specificity) and R (restriction) - that form multifunctional enzymes with restriction (3.1.21.3 from EC), methylase (2.1.1.72 from EC) and ATPase activities , . The S subunit is required for both restriction and modification and is responsible for recognition of the DNA sequence specific for the system. The M subunit is necessary for modification, and the R subunit is required for restriction. These enzymes use S-Adenosyl-L-methionine (AdoMet) as the methyl group donor in the methylation reaction, and have a requirement for ATP. They recognize asymmetric DNA sequences split into two domains of specific sequence, one 3-4 bp long and another 4-5 bp long, separated by a nonspecific spacer 6-8 bp in length. Cleavage occurs a considerable distance from the recognition sites, rarely less than 400 bp away and up to 7000 bp away. Adenosyl residues are methylated, one on each strand of the recognition sequence. These enzymes are widespread in eubacteria and archaea. In enteric bacteria they have been subdivide into four families: types IA, IB, IC and ID.   This entry represents the M subunit (HsdM) of type I restriction endonucleases such as EcoRI (3.1.21.3 from EC), which recognises the DNA sequence 5'-GAATTC. The M subunit (HsdM) functions in methylation of specific adenine residues, which is required for both restriction and modification activities , , . Methylation of specific residues prevents the host from digesting its own genome via its restriction enzymes. The M and S subunits together form a methyltransferase that methylates two adenine residues in complementary strands of a bipartite DNA recognition sequence. In the presence of the R subunit, the complex can also act as an endonuclease, binding to the same target sequence but cutting the DNA some distance from this site. Whether the DNA is cut or modified depends on the methylation state of the target sequence: when the target site is unmodified, the DNA is cut; when the target site is hemi-methylated, the complex acts as a maintenance methyltransferase, modifying the DNA so that both strands become methylated.; GO: 0003677 DNA binding, 0009007 site-specific DNA-methyltransferase (adenine-specific) activity, 0006306 DNA methylation.
Probab=97.22  E-value=0.00064  Score=41.32  Aligned_cols=135  Identities=17%  Similarity=0.160  Sum_probs=87.9

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHCC-----CCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCC--CC
Q ss_conf             557899958784389999998679-----98899998898999988999998066452225302004442353100--00
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRLH-----EAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENR--NL   83 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~~-----~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~--~~   83 (225)
                      .-..+.|++||+|.+.+...+-..     ....+|-+++-....+++.|+-.+..+.  .++++.++|........  ..
T Consensus       223 ~~~~~~d~~cg~g~~~~~~~~~~g~~~~~~~~~~g~~~~~~~~~~c~~~~~~~~~~~--~~~~~~~~d~~~~~~~~~~~~  300 (516)
T TIGR00497       223 TVDDVYDPCCGSGSLLLQFSKVLGKDKNSLKGYFGQEINLTTYNLCRLNLFLHDIDY--ANFNIANGDTLLDPEWEKHYV  300 (516)
T ss_pred             HHHHHHHHCCCCCHHHHHHHHHHCCCHHHHHHHCCCHHCCHHHHHHHHHHHHHHCCC--CCCEECCCCCCCCCHHHHCCC
T ss_conf             023444310475136778787732310112222021001103445555455531230--010000231003620121001


Q ss_pred             CCCCCCCCCEEEECCCCCC-CCCCCCCC----HHHHHHHCC--CCCCHHHHHHHHHHHCCCCCEEEEECCH
Q ss_conf             1235765205772265446-44654788----545565205--6689899999999862469837870288
Q gi|255764482|r   84 AGLKNNFYDHVIMNPPFNE-RIGTMTPD----KIKEEAHVM--LEDSFEKWIRTACAIMRSSGQLSLIARP  147 (225)
Q Consensus        84 ~~~~~~~fDlii~nPPy~~-~~~~~~~~----~~~~~a~~~--~~~~~~~~~~~a~~lLkpgG~~~~i~~~  147 (225)
                      .......|+.+++||||.. +.+...+.    .....+-..  .......|..++...|...|..+++.-+
T Consensus       301 ~c~~~~~~~~~~~~pp~~~~w~gd~~~~~~~d~~~~~~g~~~p~~~~d~~~~~~~~~~~~~~g~~~~~~~p  371 (516)
T TIGR00497       301 NCSDDEGFDAVVSNPPYSTKWAGDKNPNLVNDERFKPAGTLAPNNKADLAFTLHALYYLGNEGTAAIVCFP  371 (516)
T ss_pred             CCCCCCCCEEEECCCCCCEEECCCCCCCEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEECC
T ss_conf             24677773245537874200046654420010102533222655113588888898873256642322214


No 220
>COG0270 Dcm Site-specific DNA methylase [DNA replication, recombination, and repair]
Probab=97.20  E-value=0.00092  Score=40.44  Aligned_cols=76  Identities=18%  Similarity=0.169  Sum_probs=52.6

Q ss_pred             CCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             57899958784389999998679988999988989999889999980664522253020044423531000012357652
Q gi|255764482|r   12 SFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFY   91 (225)
Q Consensus        12 ~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~f   91 (225)
                      .-+++|+.||.|++++-+.... ---+.++|++|.+++.-+.|...         ..+.+.|+.........    ...+
T Consensus         3 ~~~~idLFsG~GG~~lGf~~ag-f~~~~a~Eid~~a~~ty~~n~~~---------~~~~~~di~~~~~~~~~----~~~~   68 (328)
T COG0270           3 KMKVIDLFAGIGGLSLGFEEAG-FEIVFANEIDPPAVATYKANFPH---------GDIILGDIKELDGEALR----KSDV   68 (328)
T ss_pred             CCEEEEECCCCCHHHHHHHHCC-CEEEEEEECCHHHHHHHHHHCCC---------CCCHHHHHHHHCHHHCC----CCCC
T ss_conf             8549986587565889998649-84899874698899999985888---------74203037660522235----5676


Q ss_pred             CEEEECCCCC
Q ss_conf             0577226544
Q gi|255764482|r   92 DHVIMNPPFN  101 (225)
Q Consensus        92 Dlii~nPPy~  101 (225)
                      |++++-||+-
T Consensus        69 DvligGpPCQ   78 (328)
T COG0270          69 DVLIGGPPCQ   78 (328)
T ss_pred             CEEEECCCCC
T ss_conf             3798589972


No 221
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family. This model represents an uncharacterized domain of about 300 amino acids with homology to S-adenosylmethionine-dependent methyltransferases. Proteins with this domain are exclusively fungal. A few, such as EasF from Neotyphodium lolii, are associated with the biosynthesis of ergot alkaloids, a class of fungal secondary metabolites. EasF may, in fact, be the AdoMet:dimethylallyltryptophan N-methyltransferase, the enzyme that follows tryptophan dimethylallyltransferase (DMATS) in ergot alkaloid biosynthesis. Several other members of this family, including mug158 (meiotically up-regulated gene 158 protein) from Schizosaccharomyces pombe, contain an additional uncharacterized domain DUF323 (pfam03781).
Probab=97.20  E-value=0.014  Score=33.69  Aligned_cols=191  Identities=9%  Similarity=-0.045  Sum_probs=92.7

Q ss_pred             CCCCCEEEEECCCHHHHHHHHHHHC----CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC
Q ss_conf             9855789995878438999999867----998899998898999988999998066452225302004442353100001
Q gi|255764482|r    9 ATGSFHLADLGAGAGAAGLAVASRL----HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA   84 (225)
Q Consensus         9 ~~~~~~VLDlGcG~G~~~l~la~r~----~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~   84 (225)
                      ..++..++|+|||++.-+..+-..+    .....+.+|+|.++++.+-.++......+  -.+.-+.+|+.+........
T Consensus        74 i~~~~~lVElGsG~~~Kt~~LL~al~~~~~~~~Y~piDIS~~~L~~s~~~l~~~~~~~--l~v~~i~gdy~~~~~~l~~~  151 (319)
T TIGR03439        74 IPSGSMLVELGSGNLRKVGILLEALERQKKSVDYYALDVSRSELQRTLAELPLGNFSH--VRCAGLLGTYDDGLAWLKRP  151 (319)
T ss_pred             CCCCCEEEEECCCCCHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHHCCCCC--CEEEEEEECHHHHHHHCCCC
T ss_conf             5899769974688724589999999854997428865176999999998742404897--55888875378765420575


Q ss_pred             CCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHH-HHHCCCCCEEEEEC----CHHHH---------
Q ss_conf             23576520577226544644654788545565205668989999999-98624698378702----88889---------
Q gi|255764482|r   85 GLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTA-CAIMRSSGQLSLIA----RPQSL---------  150 (225)
Q Consensus        85 ~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a-~~lLkpgG~~~~i~----~~~~l---------  150 (225)
                      ..  ...-.++    ++.++.+-+.++.          ....|+... ...+.|||.+.+-.    .++.+         
T Consensus       152 ~~--~~~~~l~----~flGStIGNf~~~----------eA~~fL~~~~~~~l~~~d~lLiG~Dl~Kd~~~l~~AYnD~~G  215 (319)
T TIGR03439       152 EN--RSRPTTI----LWLGSSIGNFSRP----------EAAAFLAGFLATALSPSDSFLIGLDGCKDPDKVLRAYNDPGG  215 (319)
T ss_pred             CC--CCCCEEE----EECCCCCCCCCHH----------HHHHHHHHHHHHHCCCCCEEEECCCCCCCHHHHHHHHCCCCC
T ss_conf             44--6787599----9616544678979----------999999999997259887589656677798998976308854


Q ss_pred             ----------HHHHHHHHCC-C--CCEEEEEECCCCCCCCEEEEEEEEE---CCCCCCEEECCEEEECCCCCHHHH-HHH
Q ss_conf             ----------9999985217-8--8469998145896983099999997---788874770756898388740018-999
Q gi|255764482|r  151 ----------IQIVNACARR-I--GSLEITPLHPREGECASRILVTGRK---GMRGQLRFRYPIVLHKPNGQPYSR-FVT  213 (225)
Q Consensus       151 ----------~~~l~~~~~~-~--~~~~i~~v~~~~~~~~~~vlv~~~k---~~~~~~~~~~~l~l~~~~g~~yt~-~~~  213 (225)
                                ..+-..+... +  ..++...+|.....--...++ .++   -...+..|.++-.||.+....||. +++
T Consensus       216 vTa~FnlN~L~riNr~Lg~d~F~~~~f~h~a~yn~~~~riem~L~-s~~~v~i~~~~~~f~~GE~I~tE~S~Kyt~~~~~  294 (319)
T TIGR03439       216 VTRRFVLNGLVHANEILGSEAFREEDWEFLGEWDEELGRHEAFYI-PKKDVSIGLEGVVIRKGEKIRFECSGKYDKDERE  294 (319)
T ss_pred             CHHHHHHHHHHHHHHHHCCCCCCHHHCEEEEEECCCCCCCHHEEE-CCCEEEECCCCEEECCCCEEEEEEEECCCHHHHH
T ss_conf             109999859999999847345765306799998477581311277-0654897057279779998999975188999999


Q ss_pred             HHHCC
Q ss_conf             99738
Q gi|255764482|r  214 DLING  218 (225)
Q Consensus       214 ~l~~~  218 (225)
                      .+.+.
T Consensus       295 ~l~~~  299 (319)
T TIGR03439       295 KLCQS  299 (319)
T ss_pred             HHHHH
T ss_conf             99998


No 222
>PRK13256 thiopurine S-methyltransferase; Reviewed
Probab=97.16  E-value=0.0058  Score=35.91  Aligned_cols=117  Identities=13%  Similarity=0.039  Sum_probs=69.1

Q ss_pred             CCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHH--HHHHHHCCC------CCCCCCEEECCCCCCCC
Q ss_conf             8998557899958784389999998679988999988989999889--999980664------52225302004442353
Q gi|255764482|r    7 VNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYAR--KTLALPANA------QISKRISLIEVDVTLVG   78 (225)
Q Consensus         7 ~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~--~n~~~~~~~------~~~~~~~~~~~D~~~~~   78 (225)
                      ....++.+|+=+.||-..--..+|.+  +.+|+|+|+++.+++.--  .|+......      -....+++.++|++...
T Consensus        39 L~~~~~~rVfVPLCGKSlDm~WLa~q--G~~VvGvELse~Av~~FF~E~~l~~~v~~~~~~~~y~~~~I~i~~GD~F~L~  116 (226)
T PRK13256         39 LNINDSSVCLIPMCGCSIDMLFFLSK--GVKVIGIELSEKAVLSFFSQNTINYEVIHGNDYKLYKGDDIEIYVADIFNLP  116 (226)
T ss_pred             HCCCCCCEEEEECCCCHHHHHHHHHC--CCEEEEEEHHHHHHHHHHHHCCCCCEEECCCCCEEEECCCEEEEECCCCCCC
T ss_conf             48899986999678878989999978--9825643101899999999769984551378812885188769963621586


Q ss_pred             CCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             1000012357652057722654464465478854556520566898999999998624698378702
Q gi|255764482|r   79 ENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIA  145 (225)
Q Consensus        79 ~~~~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~  145 (225)
                      ...    ..-+.||.|.      +++......+          ..-....++...++++|++..+|.
T Consensus       117 ~~~----~~lg~~daiY------DRAALVALP~----------~mR~~Ya~~L~~ll~~~~~~LLit  163 (226)
T PRK13256        117 KIA----NNLPVFDIWY------DRGAYIALPN----------DLRTNYAKMMLEVCSNNTQILLLV  163 (226)
T ss_pred             CHH----CCCCCCCEEE------EEHHHHCCCH----------HHHHHHHHHHHHHCCCCCCEEEEE
T ss_conf             201----1576403697------4022531998----------999999999998658777099999


No 223
>PRK09422 alcohol dehydrogenase; Provisional
Probab=97.13  E-value=0.015  Score=33.68  Aligned_cols=105  Identities=15%  Similarity=0.175  Sum_probs=62.2

Q ss_pred             HHCCCCCCCEEEEECCC-HHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC
Q ss_conf             43899855789995878-43899999986799889999889899998899999806645222530200444235310000
Q gi|255764482|r    5 SLVNATGSFHLADLGAG-AGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL   83 (225)
Q Consensus         5 ~~~~~~~~~~VLDlGcG-~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~   83 (225)
                      ...+.++|++||=.|+| .|.+++.+|++..+++|+++|.++.-++.|++.    +...   -+.....|  ..  ....
T Consensus       156 ~~~~~~~G~~VlV~GaGgvG~~aiq~ak~~~g~~Vi~~~~~~~k~~~a~~l----Gad~---vi~~~~~~--~~--~~~~  224 (338)
T PRK09422        156 KVSGIKPGQWIAIYGAGGLGNLALQYAKNVFNAKVIAVDINDDKLALAKEV----GADL---TINSKRVE--DV--AKII  224 (338)
T ss_pred             HHHCCCCCCEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHC----CCCE---EECCCCCC--CH--HHHH
T ss_conf             984899998899968868999999999980898699998999999999972----9989---98188743--49--9999


Q ss_pred             CCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             12357652057722654464465478854556520566898999999998624698378702
Q gi|255764482|r   84 AGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIA  145 (225)
Q Consensus        84 ~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~  145 (225)
                      . ...+.+|.++.+..                        ....+..+.+.|+++|++.++-
T Consensus       225 ~-~~~gg~~~~v~~~~------------------------~~~~~~~~~~~l~~gG~~v~vG  261 (338)
T PRK09422        225 Q-EKTGGAHAAVVTAV------------------------AKAAFNQAVDAVRAGGRVVAVG  261 (338)
T ss_pred             H-HHCCCCCEEEEECC------------------------CHHHHHHHHHHHHCCCEEEEEC
T ss_conf             9-95099776999678------------------------7899999999811699999987


No 224
>KOG0024 consensus
Probab=97.13  E-value=0.0071  Score=35.41  Aligned_cols=174  Identities=14%  Similarity=0.117  Sum_probs=89.6

Q ss_pred             HCCCCCCCEEEEECCC-HHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCC-CCCCCCCCCC
Q ss_conf             3899855789995878-4389999998679988999988989999889999980664522253020044-4235310000
Q gi|255764482|r    6 LVNATGSFHLADLGAG-AGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVD-VTLVGENRNL   83 (225)
Q Consensus         6 ~~~~~~~~~VLDlGcG-~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D-~~~~~~~~~~   83 (225)
                      ..++++|.+||=+|+| .|..++..|+-+...+|+.+|.++.-++.|++ +   +......   ....+ ...... ...
T Consensus       164 ~~~vk~Gs~vLV~GAGPIGl~t~l~Aka~GA~~VVi~d~~~~Rle~Ak~-~---Ga~~~~~---~~~~~~~~~~~~-~v~  235 (354)
T KOG0024         164 RAGVKKGSKVLVLGAGPIGLLTGLVAKAMGASDVVITDLVANRLELAKK-F---GATVTDP---SSHKSSPQELAE-LVE  235 (354)
T ss_pred             HCCCCCCCEEEEECCCHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHH-H---CCEEEEC---CCCCCCHHHHHH-HHH
T ss_conf             2476668868997676899999999987498728996067779999998-2---9757730---445565899999-998


Q ss_pred             CCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECC-HHHHHHHHHHHHCCCC
Q ss_conf             123576520577226544644654788545565205668989999999986246983787028-8889999998521788
Q gi|255764482|r   84 AGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIAR-PQSLIQIVNACARRIG  162 (225)
Q Consensus        84 ~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~-~~~l~~~l~~~~~~~~  162 (225)
                      .......+|..+.                        -...+.-++.+...++.||+..++-- ++..+  |-.+.--..
T Consensus       236 ~~~g~~~~d~~~d------------------------CsG~~~~~~aai~a~r~gGt~vlvg~g~~~~~--fpi~~v~~k  289 (354)
T KOG0024         236 KALGKKQPDVTFD------------------------CSGAEVTIRAAIKATRSGGTVVLVGMGAEEIQ--FPIIDVALK  289 (354)
T ss_pred             HHCCCCCCCEEEE------------------------CCCCHHHHHHHHHHHCCCCEEEEECCCCCCCC--CCHHHHHHH
T ss_conf             6416667986898------------------------66604668989987512878999654787653--573352233


Q ss_pred             CEEEEEECCCCC---CCCEEEEEEEEECCCCCCEEECCEEEECCCCCHHHHHHHHHHCCCC
Q ss_conf             469998145896---9830999999977888747707568983887400189999973876
Q gi|255764482|r  163 SLEITPLHPREG---ECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKR  220 (225)
Q Consensus       163 ~~~i~~v~~~~~---~~~~~vlv~~~k~~~~~~~~~~~l~l~~~~g~~yt~~~~~l~~~~~  220 (225)
                      ...++...-...   ..+    ++...+++-.++   ||+.|.-.-+.-.+.++.+.++..
T Consensus       290 E~~~~g~fry~~~~y~~a----i~li~sGki~~k---~lIT~r~~~~~~~eAf~~~~~~~~  343 (354)
T KOG0024         290 EVDLRGSFRYCNGDYPTA----IELVSSGKIDVK---PLITHRYKFDDADEAFETLQHGEE  343 (354)
T ss_pred             EEEEEEEEEECCCCHHHH----HHHHHCCCCCCH---HHEECCCCCCCHHHHHHHHHHCCC
T ss_conf             356464222133648999----999975896711---330012464207999999973768


No 225
>KOG2078 consensus
Probab=97.12  E-value=0.00019  Score=44.29  Aligned_cols=66  Identities=15%  Similarity=0.205  Sum_probs=54.7

Q ss_pred             CCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCC
Q ss_conf             9855789995878438999999867998899998898999988999998066452225302004442353
Q gi|255764482|r    9 ATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVG   78 (225)
Q Consensus         9 ~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~   78 (225)
                      -++|+.|-|+.||.|-+++.++++  ++.|++.|.+|+|++..+.|+..|....  .++++.+.|...+.
T Consensus       247 fk~gevv~D~FaGvGPfa~Pa~kK--~crV~aNDLNpesik~Lk~ni~lNkv~~--~~iei~Nmda~~Fl  312 (495)
T KOG2078         247 FKPGEVVCDVFAGVGPFALPAAKK--GCRVYANDLNPESIKWLKANIKLNKVDP--SAIEIFNMDAKDFL  312 (495)
T ss_pred             CCCCCHHHHHHCCCCCCCCCHHHC--CCEEEECCCCHHHHHHHHHHCCCCCCCH--HHEEEECCCHHHHH
T ss_conf             587413344404767433502225--8589934799789999997565366561--36366446188874


No 226
>pfam04672 DUF574 Protein of unknown function (DUF574). Family of uncharacterized proteins.
Probab=97.11  E-value=0.0065  Score=35.64  Aligned_cols=119  Identities=18%  Similarity=0.174  Sum_probs=71.8

Q ss_pred             CC-CEEEEECCCH---HHHHHHHHHH-CCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCC
Q ss_conf             55-7899958784---3899999986-79988999988989999889999980664522253020044423531000012
Q gi|255764482|r   11 GS-FHLADLGAGA---GAAGLAVASR-LHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAG   85 (225)
Q Consensus        11 ~~-~~VLDlGcG~---G~~~l~la~r-~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~   85 (225)
                      .| ...||+|||-   |.. =-+|++ .|+++|+-||+||..++.+|.-+..    +.+.+..++++|+.+.........
T Consensus        68 ~GIrQFLDlGsGlPT~~nv-HeVAq~~~P~aRVVYVD~DPvvlaHaraLL~~----~~~~~t~~v~aDlrdp~~iL~~p~  142 (268)
T pfam04672        68 AGIRQFLDIGTGLPTEPNV-HQVAQRVAPESRVVYVDNDPIVLTHARALLTS----TPEGATDYIHADVRDPEEILEHPE  142 (268)
T ss_pred             CCCEEEEEECCCCCCCCCC-CHHHHHCCCCCEEEEECCCCHHHHHHHHHHCC----CCCCCEEEEECCCCCHHHHHCCHH
T ss_conf             4950577605699999972-14667329986399988982799999999568----987746999777779899865987


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHC-CCCCCHHHHHHHHHHHCCCCCEEEEECC
Q ss_conf             357652057722654464465478854556520-5668989999999986246983787028
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHV-MLEDSFEKWIRTACAIMRSSGQLSLIAR  146 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~-~~~~~~~~~~~~a~~lLkpgG~~~~i~~  146 (225)
                       ..+.+|+-   -|--        --.....++ ........++......|.||..+++.|-
T Consensus       143 -~~~~lD~~---rPVa--------lll~~vLh~v~D~~~p~~iv~~l~d~l~pGS~L~ish~  192 (268)
T pfam04672       143 -ARRTLDFD---RPVA--------LSLVAILHFVPDDDDPYGIVRRLMDALPAGSYLVLSHG  192 (268)
T ss_pred             -HHHHCCCC---CCCH--------HHHHHHHCCCCCCCCHHHHHHHHHHHCCCCCEEEEEEC
T ss_conf             -88537878---8613--------45334434578610499999999972699765999843


No 227
>pfam07669 Eco57I Eco57I restriction endonuclease. Homologues of the Escherichia coli Eco57I restriction endonuclease are found in several phylogenetically diverse bacteria.
Probab=97.07  E-value=0.00065  Score=41.30  Aligned_cols=78  Identities=15%  Similarity=0.186  Sum_probs=44.3

Q ss_pred             CCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHHHHH--HHHHHHHC-CCCCEEE
Q ss_conf             52057722654464465478854556520566898999999998624698378702888899--99998521-7884699
Q gi|255764482|r   90 FYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLI--QIVNACAR-RIGSLEI  166 (225)
Q Consensus        90 ~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~~l~--~~l~~~~~-~~~~~~i  166 (225)
                      +||+||+||||..........    .........+..|++.|.++++  |.+++|.|+.-+.  .-+..++. .+...++
T Consensus         2 KFDvVIGNPPY~~~~~~~~~~----~~~~~~~~iY~~F~e~a~~l~~--~~l~~I~P~rw~~~gkg~~~fR~~mL~d~~i   75 (106)
T pfam07669         2 KFDVVIGNPPYQESDNDKEGG----GGGNSAAPIYQLFVELALKLAP--KYLGMITPARWLFGGKGLKKFREKMLNDKHL   75 (106)
T ss_pred             CCCEEEECCCCCCCCCCCCCC----CCCCCCCCHHHHHHHHHHHHCC--CCEEEEECCHHHHCCCCHHHHHHHHHCCCCE
T ss_conf             758897089994335775656----7777787689999999998566--8569995461001388699999997568866


Q ss_pred             EEECCCC
Q ss_conf             9814589
Q gi|255764482|r  167 TPLHPRE  173 (225)
Q Consensus       167 ~~v~~~~  173 (225)
                      .-++.+.
T Consensus        76 ~~i~df~   82 (106)
T pfam07669        76 RELIDFP   82 (106)
T ss_pred             EEEEECC
T ss_conf             6999638


No 228
>PRK10083 putative dehydrogenase; Provisional
Probab=97.02  E-value=0.009  Score=34.85  Aligned_cols=104  Identities=13%  Similarity=0.084  Sum_probs=60.0

Q ss_pred             HHCCCCCCCEEEEECCCHHHH-HHHHHHHC-CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCC
Q ss_conf             438998557899958784389-99999867-9988999988989999889999980664522253020044423531000
Q gi|255764482|r    5 SLVNATGSFHLADLGAGAGAA-GLAVASRL-HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRN   82 (225)
Q Consensus         5 ~~~~~~~~~~VLDlGcG~G~~-~l~la~r~-~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~   82 (225)
                      ...++++|++||=+|||.-.+ .+.++++. ....|+++|.++.-++.|++.    +...   .+.....++...     
T Consensus       154 ~~~~~~~g~~VlV~G~G~iGl~~~~~~~~~~ga~~Vi~~d~~~~rl~~A~~~----GAd~---vi~~~~~~~~~~-----  221 (339)
T PRK10083        154 GRTGPTEQDVALIYGAGPVGLTIVQVLKGVYGVKNVIVADRIDERLALAKES----GADW---VINNAQESLAEA-----  221 (339)
T ss_pred             HHHCCCCCCEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHC----CCCE---EECCCCCCHHHH-----
T ss_conf             8618999988999587659999999999856997899937989999999971----9989---984887669999-----


Q ss_pred             CCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             012357652057722654464465478854556520566898999999998624698378702
Q gi|255764482|r   83 LAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIA  145 (225)
Q Consensus        83 ~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~  145 (225)
                      .. .....+|+++-                        .......++.+.+++++||++.++-
T Consensus       222 ~~-~~G~~~dvvid------------------------~~g~~~~~~~a~~~~~~gG~iv~~G  259 (339)
T PRK10083        222 LA-EKGVKPTLIFD------------------------AACHPSILEEAVTLASPAARIVLMG  259 (339)
T ss_pred             HH-HCCCCCCEEEE------------------------CCCCHHHHHHHHHHHHCCEEEEEEE
T ss_conf             98-53999619996------------------------6668899999999851880999992


No 229
>TIGR00417 speE spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase   A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (), spermine synthase () and putrescine N-methyltransferase () .   The Thermotoga maritima spermidine synthase monomer consists of two domains: an N-terminal domain composed of six beta-strands, and a Rossmann-like C- terminal domain . The larger C-terminal catalytic core domain consists of a seven-stranded beta-sheet flanked by nine alpha helices. This domain resembles a topology observed in a number of nucleotide and dinucleotide-binding enzymes, and in S-adenosyl-L-methionine (AdoMet)- dependent methyltransferase (MTases) . ; GO: 0003824 catalytic activity.
Probab=97.01  E-value=0.0016  Score=39.01  Aligned_cols=118  Identities=14%  Similarity=0.082  Sum_probs=85.5

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHC-CCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             5578999587843899999986799889999889899998899999806-645222530200444235310000123576
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPA-NAQISKRISLIEVDVTLVGENRNLAGLKNN   89 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~-~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~   89 (225)
                      .+++||=+|=|-|+...-+++...=-+++-||||...++..|+=++... ..-.+.|+++.-.|=....... ....-.+
T Consensus        75 NPk~VLvIGGGDGG~lREV~KH~sVE~~~lVdID~~VI~~srkyLP~~~~g~~dderv~~~i~DG~~fl~~~-Gasdv~~  153 (284)
T TIGR00417        75 NPKKVLVIGGGDGGVLREVVKHKSVEKATLVDIDEKVIELSRKYLPKLAAGSFDDERVDLAIDDGFKFLRDT-GASDVEK  153 (284)
T ss_pred             CCCEEEEEECCCCCEEEEEEECCCCCEEEEEECCHHHHHHHHHHCHHHHCCCCCCCEEEEEECCCHHHHHHC-CCCCCCC
T ss_conf             885478996388846878875598167999972747899988826121056658880358982517989761-5222212


Q ss_pred             CCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEE
Q ss_conf             520577226544644654788545565205668989999999986246983787
Q gi|255764482|r   90 FYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSL  143 (225)
Q Consensus        90 ~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~  143 (225)
                      +||+||+.-+     +-..         ........+|.+.+.+.|+|+|.+..
T Consensus       154 ~fDVIIvDst-----DPvG---------Pa~~LF~~~Fy~~~~~aL~~~Gv~v~  193 (284)
T TIGR00417       154 KFDVIIVDST-----DPVG---------PAETLFTKEFYELLKKALNEDGVIVA  193 (284)
T ss_pred             CCCEEEEECC-----CCCC---------CCCCHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             1447997277-----8956---------55410217999999985299988998


No 230
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase. This clade of zinc-binding alcohol dehydrogenases (members of pfam00107) are repeatedly associated with genes proposed to be involved with the catabolism of phosphonate compounds.
Probab=97.00  E-value=0.014  Score=33.81  Aligned_cols=103  Identities=17%  Similarity=0.102  Sum_probs=62.3

Q ss_pred             HCCCCCCCEEEEECCCHHHHHHH-HHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC
Q ss_conf             38998557899958784389999-99867998899998898999988999998066452225302004442353100001
Q gi|255764482|r    6 LVNATGSFHLADLGAGAGAAGLA-VASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA   84 (225)
Q Consensus         6 ~~~~~~~~~VLDlGcG~G~~~l~-la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~   84 (225)
                      ....+++++|+=+|+|+..+... +|+.....+|+.+|.++.-++.|++.    +..      .+++.+...   .....
T Consensus       115 ~~~~~~g~~V~V~G~G~iGl~~~~~a~~~Ga~~Vi~~d~~~~rl~~a~~~----Ga~------~~i~~~~~~---~~~~~  181 (280)
T TIGR03366       115 AAGDLKGRRVLVVGAGMLGLTAAAAAAAAGAARVVAADPSPDRRELALSF----GAT------ALAEPEVLA---ERQGG  181 (280)
T ss_pred             HCCCCCCCEEEEEECCHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHC----CCC------EEECCCCHH---HHHHH
T ss_conf             71789999899990786899999999984998799991998999999973----998------983775779---99999


Q ss_pred             CCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             2357652057722654464465478854556520566898999999998624698378702
Q gi|255764482|r   85 GLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIA  145 (225)
Q Consensus        85 ~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~  145 (225)
                      ......+|.++-.                        ......++.+.+++++||++.++-
T Consensus       182 ~~~g~g~D~vie~------------------------~G~~~~~~~a~~~l~~gG~iv~vG  218 (280)
T TIGR03366       182 LQNGRGVDVALEF------------------------SGATAAVRACLESLDVGGTAVLAG  218 (280)
T ss_pred             HHCCCCCCEEEEC------------------------CCCHHHHHHHHHHHHCCCEEEEEC
T ss_conf             7278887099987------------------------898899999999860498999980


No 231
>TIGR01444 fkbM_fam methyltransferase, FkbM family; InterPro: IPR006342   Members of this group are characterised by two well-conserved short regions separated by a variable region in both sequence and length. The first of the two regions is found in a large number of proteins outside this subfamily, a number of which have been characterised as methyltransferases. One member of the present family, FkbM, was shown to be required for a specific methylation in the biosynthesis of the immunosuppressant FK506 in Streptomyces strain MA6548 ..
Probab=96.99  E-value=0.0019  Score=38.68  Aligned_cols=49  Identities=20%  Similarity=0.226  Sum_probs=44.9

Q ss_pred             EEEEECCCHHHHHHHHHHHCCC--CEEEEEECCHHHHHHHHHHHHHHCCCC
Q ss_conf             8999587843899999986799--889999889899998899999806645
Q gi|255764482|r   14 HLADLGAGAGAAGLAVASRLHE--AQILLAERSPLMAHYARKTLALPANAQ   62 (225)
Q Consensus        14 ~VLDlGcG~G~~~l~la~r~~~--~~v~gvD~~~~~~~~A~~n~~~~~~~~   62 (225)
                      .|+|+|+..|..+..++++.+.  ++|+++|=+|..++.+++|+..|...+
T Consensus         1 ~~~D~GAn~G~~~~~~~~~~~~~~~~v~afEP~p~~~~~l~~n~~~n~~~~   51 (142)
T TIGR01444         1 VVIDVGANIGDFSLYFARKGAEGGGRVIAFEPLPDAYEILEENVKLNGLPN   51 (142)
T ss_pred             CEEEECCCHHHHHHHHHHHCCCCCCEEEEECCCHHHHHHHHHHHHCCCCCC
T ss_conf             978701770479999997417887318998689579999998620378787


No 232
>KOG3201 consensus
Probab=96.99  E-value=0.00039  Score=42.54  Aligned_cols=123  Identities=16%  Similarity=0.311  Sum_probs=76.1

Q ss_pred             CCCCEEEEECCC-HHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCC
Q ss_conf             855789995878-4389999998679988999988989999889999980664522253020044423531000012357
Q gi|255764482|r   10 TGSFHLADLGAG-AGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKN   88 (225)
Q Consensus        10 ~~~~~VLDlGcG-~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~   88 (225)
                      -.|.+|||+|.| +|..++++|.+.+...|.-.|-++.++.-.++-+..|..... .++.+..-++.    . .......
T Consensus        28 ~rg~~ilelgggft~laglmia~~a~~~~v~ltdgne~svrnv~ki~~~n~~s~~-tsc~vlrw~~~----~-aqsq~eq  101 (201)
T KOG3201          28 IRGRRILELGGGFTGLAGLMIACKAPDSSVWLTDGNEESVRNVEKIRNSNMASSL-TSCCVLRWLIW----G-AQSQQEQ  101 (201)
T ss_pred             HHHHHHHHHCCCHHHHHHHHEEEECCCCEEEEECCCHHHHHHHHHHHHCCCCCCC-CEEHHHHHHHH----H-HHHHHHH
T ss_conf             7678898726744655455204535873588716978999979999851200256-50003478776----4-4888751


Q ss_pred             CCCCEEEECCC-CCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHHH---HHHHHHHHH
Q ss_conf             65205772265-44644654788545565205668989999999986246983787028888---999999852
Q gi|255764482|r   89 NFYDHVIMNPP-FNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQS---LIQIVNACA  158 (225)
Q Consensus        89 ~~fDlii~nPP-y~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~~---l~~~l~~~~  158 (225)
                      ..||.|++.-= ||.                   ..-..+++...++|+|.|+ ++++.|.|   |+..+....
T Consensus       102 ~tFDiIlaADClFfd-------------------E~h~sLvdtIk~lL~p~g~-Al~fsPRRg~sL~kF~de~~  155 (201)
T KOG3201         102 HTFDIILAADCLFFD-------------------EHHESLVDTIKSLLRPSGR-ALLFSPRRGQSLQKFLDEVG  155 (201)
T ss_pred             CCCCEEEECCCHHHH-------------------HHHHHHHHHHHHHHCCCCC-EEEECCCCCCHHHHHHHHHH
T ss_conf             702279860102588-------------------9999999999998584666-16766755556999999987


No 233
>KOG3178 consensus
Probab=96.99  E-value=0.0064  Score=35.69  Aligned_cols=97  Identities=16%  Similarity=0.130  Sum_probs=64.9

Q ss_pred             CEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             78999587843899999986799889999889899998899999806645222530200444235310000123576520
Q gi|255764482|r   13 FHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFYD   92 (225)
Q Consensus        13 ~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~fD   92 (225)
                      ...+|+|.|.|.++-.+..++|  ++.|++.+..-+-.+..+.. .+       ++.+.+|.+...        +  +-|
T Consensus       179 ~~avDvGgGiG~v~k~ll~~fp--~ik~infdlp~v~~~a~~~~-~g-------V~~v~gdmfq~~--------P--~~d  238 (342)
T KOG3178         179 NVAVDVGGGIGRVLKNLLSKYP--HIKGINFDLPFVLAAAPYLA-PG-------VEHVAGDMFQDT--------P--KGD  238 (342)
T ss_pred             CEEEECCCCHHHHHHHHHHHCC--CCCEEECCHHHHHHHHHHHC-CC-------CCEECCCCCCCC--------C--CCC
T ss_conf             6688758747699999997588--77255147899985223206-78-------651236453458--------8--767


Q ss_pred             EEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             57722654464465478854556520566898999999998624698378702
Q gi|255764482|r   93 HVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIA  145 (225)
Q Consensus        93 lii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~  145 (225)
                      +|+.-                ...++=.+....+|++.+...|+|+|.+.++-
T Consensus       239 aI~mk----------------WiLhdwtDedcvkiLknC~~sL~~~GkIiv~E  275 (342)
T KOG3178         239 AIWMK----------------WILHDWTDEDCVKILKNCKKSLPPGGKIIVVE  275 (342)
T ss_pred             EEEEE----------------EECCCCCHHHHHHHHHHHHHHCCCCCEEEEEE
T ss_conf             59987----------------00056876889999999998589988899983


No 234
>pfam12147 Hydrolase_5 Putative lysophospholipase. This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length. It is found in association with pfam00561. Many members are annotated as being lysophospholipases, and others as alpha-beta hydrolase fold-containing proteins.
Probab=96.98  E-value=0.011  Score=34.37  Aligned_cols=117  Identities=19%  Similarity=0.223  Sum_probs=80.6

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCC--CEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCC
Q ss_conf             85578999587843899999986799--8899998898999988999998066452225302004442353100001235
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRLHE--AQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLK   87 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~~~--~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~   87 (225)
                      ...-+|||+.||.|.-.+-+....+.  .++.-=|.+|.-++..+.-++..+   +++.++|.++|.++......+.+  
T Consensus       134 g~~v~ilDIAaG~GRYvldal~~~~~~~~~illRDys~~NV~~G~~li~erg---l~~ia~Fe~gdAFd~~~la~l~p--  208 (311)
T pfam12147       134 GRPVRILDIAAGHGRYVLDALAKAPQRPDSILLRDYSPLNVEQGRALIAERG---LEDIARFEQGDAFDPASLAALTP--  208 (311)
T ss_pred             CCCEEEEEECCCCCHHHHHHHHHCCCCCCEEEECCCCHHHHHHHHHHHHHCC---CCHHEEEEECCCCCHHHHHCCCC--
T ss_conf             9956999851686162999998579887458851488877999999999749---62000674057679767632699--


Q ss_pred             CCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHH
Q ss_conf             7652057722654464465478854556520566898999999998624698378702888
Q gi|255764482|r   88 NNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQ  148 (225)
Q Consensus        88 ~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~  148 (225)
                        .-++++..-=|     ...+++          .....-+....+.+.|||.+.+...|+
T Consensus       209 --~P~l~IVSGLy-----ELF~dN----------~lv~~sl~Gl~~ai~~gGyLIYTgQPW  252 (311)
T pfam12147       209 --APTLAIVSGLY-----ELFPDN----------DLVRRSLAGLAQAVEPGGYLIYTGQPW  252 (311)
T ss_pred             --CCCEEEEECHH-----HHCCCH----------HHHHHHHHHHHHHCCCCCEEEECCCCC
T ss_conf             --99789970126-----636872----------999999999997508997899829988


No 235
>KOG1269 consensus
Probab=96.98  E-value=0.0028  Score=37.67  Aligned_cols=108  Identities=15%  Similarity=0.221  Sum_probs=70.1

Q ss_pred             CCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCC
Q ss_conf             89985578999587843899999986799889999889899998899999806645222530200444235310000123
Q gi|255764482|r    7 VNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGL   86 (225)
Q Consensus         7 ~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~   86 (225)
                      ...+++.+++|+|||.|..+..++. +..+.++|+++++..+..+..-.....   ...+..+..+|+...       ..
T Consensus       106 ~~~~~~~~~~~~~~g~~~~~~~i~~-f~~~~~~Gl~~n~~e~~~~~~~~~~~~---l~~k~~~~~~~~~~~-------~f  174 (364)
T KOG1269         106 ESCFPGSKVLDVGTGVGGPSRYIAV-FKKAGVVGLDNNAYEAFRANELAKKAY---LDNKCNFVVADFGKM-------PF  174 (364)
T ss_pred             HCCCCCCCCCCCCCCCCCHHHHHHH-HCCCCCCCCCCCHHHHHHHHHHHHHHH---HHHHCCEEHHHHHCC-------CC
T ss_conf             3276541112247676751677888-625775178767999999887778887---642023522555148-------87


Q ss_pred             CCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEE
Q ss_conf             576520577226544644654788545565205668989999999986246983787
Q gi|255764482|r   87 KNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSL  143 (225)
Q Consensus        87 ~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~  143 (225)
                      .++.||.+.+.=-                  ...........+...+.++|||.+..
T Consensus       175 edn~fd~v~~ld~------------------~~~~~~~~~~y~Ei~rv~kpGG~~i~  213 (364)
T KOG1269         175 EDNTFDGVRFLEV------------------VCHAPDLEKVYAEIYRVLKPGGLFIV  213 (364)
T ss_pred             CCCCCCCEEEEEE------------------CCCCCCHHHHHHHHHCCCCCCCEEEE
T ss_conf             7466674898761------------------24478699999988503677716884


No 236
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase. Members of this protein family are 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase, an enzyme in the anaerobic metabolism of aromatic enzymes by way of benzoyl-CoA, as seen in Thauera aromatica, Geobacter metallireducens, and Azoarcus sp. The experimentally characterized form from T. aromatica uses only NAD+, not NADP+. Note that Rhodopseudomonas palustris uses a different pathway to perform a similar degradation of benzoyl-CoA to 3-hydroxpimelyl-CoA.
Probab=96.95  E-value=0.014  Score=33.79  Aligned_cols=46  Identities=15%  Similarity=0.156  Sum_probs=36.0

Q ss_pred             CCCCCCCEEEEECCCH-HHHHHHHHHHCCCCEEEEEECCHHHHHHHHH
Q ss_conf             8998557899958784-3899999986799889999889899998899
Q gi|255764482|r    7 VNATGSFHLADLGAGA-GAAGLAVASRLHEAQILLAERSPLMAHYARK   53 (225)
Q Consensus         7 ~~~~~~~~VLDlGcG~-G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~   53 (225)
                      ..+++|++|+=+|||. |.+.+.+|+. .+++|+++|.++.-++.|++
T Consensus       162 ~~v~~g~~V~V~G~G~iGl~a~~~ak~-~Ga~Vi~vd~~~~rle~a~~  208 (349)
T TIGR03201       162 AGLKKGDLVIVIGAGGVGGYMVQTAKA-MGAAVVAIDIDPEKLEMMKG  208 (349)
T ss_pred             CCCCCCCEEEEECCCHHHHHHHHHHHH-CCCEEEEEECCHHHHHHHHH
T ss_conf             178999889998974899999999998-59979999499999999996


No 237
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only]
Probab=96.89  E-value=0.019  Score=33.02  Aligned_cols=104  Identities=18%  Similarity=0.154  Sum_probs=63.7

Q ss_pred             CCCCCCEEEEECCC-HHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCC
Q ss_conf             99855789995878-43899999986799889999889899998899999806645222530200444235310000123
Q gi|255764482|r    8 NATGSFHLADLGAG-AGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGL   86 (225)
Q Consensus         8 ~~~~~~~VLDlGcG-~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~   86 (225)
                      ..+++++|+=+||| .|.+++.+|+.....+|+.+|.++.-++.|++-...       +.+.....+   ..........
T Consensus       165 ~~~~~~~V~V~GaGpIGLla~~~a~~~Ga~~Viv~d~~~~Rl~~A~~~~g~-------~~~~~~~~~---~~~~~~~~~t  234 (350)
T COG1063         165 AVRPGGTVVVVGAGPIGLLAIALAKLLGASVVIVVDRSPERLELAKEAGGA-------DVVVNPSED---DAGAEILELT  234 (350)
T ss_pred             CCCCCCEEEEECCCHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHCCC-------CEEECCCCH---HHHHHHHHHC
T ss_conf             578899899988889999999999876982799979998999999987797-------187246301---4788999860


Q ss_pred             CCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             57652057722654464465478854556520566898999999998624698378702
Q gi|255764482|r   87 KNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIA  145 (225)
Q Consensus        87 ~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~  145 (225)
                      ....+|.++---.                        ....+..+..++++||++.++-
T Consensus       235 ~g~g~D~vie~~G------------------------~~~~~~~ai~~~r~gG~v~~vG  269 (350)
T COG1063         235 GGRGADVVIEAVG------------------------SPPALDQALEALRPGGTVVVVG  269 (350)
T ss_pred             CCCCCCEEEECCC------------------------CHHHHHHHHHHCCCCCEEEEEE
T ss_conf             8987999999989------------------------9799999999602598999995


No 238
>COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis]
Probab=96.85  E-value=0.0088  Score=34.90  Aligned_cols=100  Identities=14%  Similarity=0.226  Sum_probs=61.5

Q ss_pred             CCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEEC-CCCCCCCCCCCCCCCC
Q ss_conf             985578999587843899999986799889999889899998899999806645222530200-4442353100001235
Q gi|255764482|r    9 ATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIE-VDVTLVGENRNLAGLK   87 (225)
Q Consensus         9 ~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~-~D~~~~~~~~~~~~~~   87 (225)
                      ..++..+||+|+-||+++.++.++ ...+|+|+|..-..++.--+         .++|+...+ .+++.....     ..
T Consensus        77 ~~k~kv~LDiGsSTGGFTd~lLq~-gAk~VyavDVG~~Ql~~kLR---------~d~rV~~~E~tN~r~l~~~-----~~  141 (245)
T COG1189          77 DVKGKVVLDIGSSTGGFTDVLLQR-GAKHVYAVDVGYGQLHWKLR---------NDPRVIVLERTNVRYLTPE-----DF  141 (245)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHC-CCCEEEEEECCCCCCCHHHH---------CCCCEEEEECCCHHHCCHH-----HC
T ss_conf             889978998267876299999875-87479999703774378673---------5984799852783118987-----81


Q ss_pred             CCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             765205772265446446547885455652056689899999999862469837870
Q gi|255764482|r   88 NNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLI  144 (225)
Q Consensus        88 ~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i  144 (225)
                      .+..|++++.--|.                     ++..++-.+..+++++|.+...
T Consensus       142 ~~~~d~~v~DvSFI---------------------SL~~iLp~l~~l~~~~~~~v~L  177 (245)
T COG1189         142 TEKPDLIVIDVSFI---------------------SLKLILPALLLLLKDGGDLVLL  177 (245)
T ss_pred             CCCCCEEEEEEEHH---------------------HHHHHHHHHHHHCCCCCEEEEE
T ss_conf             76778479964233---------------------1998889999742788638997


No 239
>pfam10354 DUF2431 Domain of unknown function (DUF2431). This is the N-terminal domain of a family of proteins found from plants to humans. The function is not known.
Probab=96.83  E-value=0.018  Score=33.19  Aligned_cols=117  Identities=17%  Similarity=0.262  Sum_probs=69.2

Q ss_pred             ECCCHHHHHHHHHHHCC-CCEEEEEECCHHH--HH---HHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             58784389999998679-9889999889899--99---889999980664522253020044423531000012357652
Q gi|255764482|r   18 LGAGAGAAGLAVASRLH-EAQILLAERSPLM--AH---YARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFY   91 (225)
Q Consensus        18 lGcG~G~~~l~la~r~~-~~~v~gvD~~~~~--~~---~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~f   91 (225)
                      +|=|.-.+|++|++... ...+++.-.++..  .+   .+..|++.....+.   .-....|........   .....+|
T Consensus         3 VGeGdFSFS~aL~~~~~~~~~l~ATs~ds~~~l~~kY~~~~~nl~~L~~~g~---~V~~gVDAt~l~~~~---~~~~~~f   76 (166)
T pfam10354         3 VGEGDFSFSLSLATAFGSPTNLTATSLDSREELEEKYGDAEENLEELEELGV---TVLHGVDATKLKKHF---SLKKNRF   76 (166)
T ss_pred             EECCCHHHHHHHHHHCCCCCCEEEEECCCHHHHHHHCCCHHHHHHHHHHCCC---EEEEEEECCCCCCCC---CCCCCCC
T ss_conf             6664328999999962999838997458999998767559999999985899---599857445366684---4347835


Q ss_pred             CEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             057722654464465478854556520566898999999998624698378702
Q gi|255764482|r   92 DHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIA  145 (225)
Q Consensus        92 Dlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~  145 (225)
                      |.|+-|.|.-.. ..  .+......  .....+..|++.|..+|+++|.+.+.+
T Consensus        77 D~IiFNFPH~G~-~~--~~~~~~i~--~nr~Ll~~Ff~sa~~~l~~~G~i~vTl  125 (166)
T pfam10354        77 DRIIFNFPHAGG-KI--KDSDRNIR--LNRELLRGFFKNASELLKPGGEIHVTL  125 (166)
T ss_pred             CEEEECCCCCCC-CC--CCHHHHHH--HHHHHHHHHHHHHHHHHCCCCEEEEEE
T ss_conf             789987998888-77--41255589--999999999999999827998999995


No 240
>COG2384 Predicted SAM-dependent methyltransferase [General function prediction only]
Probab=96.73  E-value=0.0062  Score=35.77  Aligned_cols=117  Identities=16%  Similarity=0.127  Sum_probs=78.8

Q ss_pred             HHHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC
Q ss_conf             24389985578999587843899999986799889999889899998899999806645222530200444235310000
Q gi|255764482|r    4 ASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL   83 (225)
Q Consensus         4 a~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~   83 (225)
                      |+++  +.+.++.|+||--+.+...+.+..+...+++.|+++..+..|.+|+..++   ..+++++..+|-.....    
T Consensus        11 a~~V--~~~~~iaDIGsDHAYLp~~Lv~~~~~~~~va~eV~~gpl~~a~~~v~~~~---l~~~i~vr~~dgl~~l~----   81 (226)
T COG2384          11 ANLV--KQGARIADIGSDHAYLPIYLVKNNPASTAVAGEVVPGPLESAIRNVKKNN---LSERIDVRLGDGLAVLE----   81 (226)
T ss_pred             HHHH--HCCCCEEECCCCHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHHHHCC---CCCEEEEECCCCCCCCC----
T ss_conf             9998--75994553267625768999965983268983106678999999887458---85207775268731257----


Q ss_pred             CCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEEC-CHHHHHHHH
Q ss_conf             12357652057722654464465478854556520566898999999998624698378702-888899999
Q gi|255764482|r   84 AGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIA-RPQSLIQIV  154 (225)
Q Consensus        84 ~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~-~~~~l~~~l  154 (225)
                         ....+|.++--   +                 .+.....++++....-|+.-  ..+|. |..+..++.
T Consensus        82 ---~~d~~d~ivIA---G-----------------MGG~lI~~ILee~~~~l~~~--~rlILQPn~~~~~LR  128 (226)
T COG2384          82 ---LEDEIDVIVIA---G-----------------MGGTLIREILEEGKEKLKGV--ERLILQPNIHTYELR  128 (226)
T ss_pred             ---CCCCCCEEEEE---C-----------------CCHHHHHHHHHHHHHHHCCC--CEEEECCCCCHHHHH
T ss_conf             ---66776879995---7-----------------86789999999866550574--107878887889999


No 241
>COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane]
Probab=96.67  E-value=0.011  Score=34.34  Aligned_cols=70  Identities=20%  Similarity=0.292  Sum_probs=55.1

Q ss_pred             HHCCCCCCCEEEEECCCHHHHHHHHHHHCCC-CEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCC
Q ss_conf             4389985578999587843899999986799-88999988989999889999980664522253020044423531
Q gi|255764482|r    5 SLVNATGSFHLADLGAGAGAAGLAVASRLHE-AQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGE   79 (225)
Q Consensus         5 ~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~-~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~   79 (225)
                      ....+++++..+|---|.|+.|-.+..+.+. .+++|+|.||.+++.|++....     ...++.+++..+.....
T Consensus        17 ~~L~~~~~giyiD~TlG~GGHS~~iL~~l~~~~~li~~DrD~~Ai~~a~~~l~~-----~~~r~~~v~~~F~~l~~   87 (314)
T COG0275          17 ELLAPKPDGIYIDGTLGAGGHSRAILEKLPDLGRLIGIDRDPQAIAIAKERLKE-----FDGRVTLVHGNFANLAE   87 (314)
T ss_pred             HHCCCCCCCEEEEECCCCCHHHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHC-----CCCCEEEEECCHHHHHH
T ss_conf             852648994799823777476899998589887089976898999999998530-----37848999576878998


No 242
>KOG2352 consensus
Probab=96.63  E-value=0.0048  Score=36.40  Aligned_cols=109  Identities=11%  Similarity=0.167  Sum_probs=45.5

Q ss_pred             EEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCE
Q ss_conf             89995878438999999867998899998898999988999998066452225302004442353100001235765205
Q gi|255764482|r   14 HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFYDH   93 (225)
Q Consensus        14 ~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~fDl   93 (225)
                      ++|-+|||.--++.-+-+ ..--.|+-+|+|+..++.....-   ..  ......+...|....       .+.+++||.
T Consensus        51 ~~l~lGCGNS~l~e~ly~-~G~~dI~~iD~S~V~V~~m~~~~---~~--~~~~~~~~~~d~~~l-------~fedESFdi  117 (482)
T KOG2352          51 KILQLGCGNSELSEHLYK-NGFEDITNIDSSSVVVAAMQVRN---AK--ERPEMQMVEMDMDQL-------VFEDESFDI  117 (482)
T ss_pred             EEEEECCCCCHHHHHHHH-CCCCCCEECCCCHHHHHHHHHCC---CC--CCCCEEEEEECCHHC-------CCCCCCEEE
T ss_conf             147615887799999986-58777422005689999987514---56--774248898021103-------578753148


Q ss_pred             EEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEE
Q ss_conf             77226544644654788545565205668989999999986246983787
Q gi|255764482|r   94 VIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSL  143 (225)
Q Consensus        94 ii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~  143 (225)
                      ++.-+-...   ........ ..    ......+.....++|++||+...
T Consensus       118 VIdkGtlDa---l~~de~a~-~~----~~~v~~~~~eVsrvl~~~gk~~s  159 (482)
T KOG2352         118 VIDKGTLDA---LFEDEDAL-LN----TAHVSNMLDEVSRVLAPGGKYIS  159 (482)
T ss_pred             EEECCCCCC---CCCCCHHH-HH----HHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             873276400---14785002-34----67766777667887426987899


No 243
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional
Probab=96.63  E-value=0.045  Score=30.89  Aligned_cols=106  Identities=17%  Similarity=0.217  Sum_probs=60.9

Q ss_pred             HHCCCCCCCEEEEECCCH-HHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC
Q ss_conf             438998557899958784-3899999986799889999889899998899999806645222530200444235310000
Q gi|255764482|r    5 SLVNATGSFHLADLGAGA-GAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL   83 (225)
Q Consensus         5 ~~~~~~~~~~VLDlGcG~-G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~   83 (225)
                      ..++.++|++||=+|+|. |.+++.+|+......|+.+|.++.-++.|++.    +...   -+...+.+.     ....
T Consensus       154 ~~~~~~~g~~vlV~GaG~vGl~aiq~ak~~Ga~~V~~~d~~~~kl~~a~~l----GAd~---~i~~~~~~~-----~~~~  221 (347)
T PRK10309        154 HLAQGCEGKNVIIIGAGTIGLLAIQCAVALGAKSVTAIDINSEKLALAKSL----GAMQ---TFNSREMSA-----PQIQ  221 (347)
T ss_pred             HHCCCCCCCEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHC----CCCE---EECCCCCCH-----HHHH
T ss_conf             650588898699989983899999999985997699992899999999972----9989---986887799-----9999


Q ss_pred             CCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             12357652057722654464465478854556520566898999999998624698378702
Q gi|255764482|r   84 AGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIA  145 (225)
Q Consensus        84 ~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~  145 (225)
                      .......+|.++-+                       .......++.+.++++++|++.++-
T Consensus       222 ~~~~~~~~d~vvid-----------------------~~G~~~~~~~a~~~~~~~G~iv~~G  260 (347)
T PRK10309        222 SVLRELRFDQLILE-----------------------TAGVPQTVELAIEIAGPRAQLALVG  260 (347)
T ss_pred             HHHCCCCCCEEEEE-----------------------CCCCHHHHHHHHHHHCCCEEEEEEE
T ss_conf             98629988869997-----------------------9999899999999618974999980


No 244
>COG4798 Predicted methyltransferase [General function prediction only]
Probab=96.60  E-value=0.006  Score=35.85  Aligned_cols=115  Identities=10%  Similarity=0.098  Sum_probs=66.2

Q ss_pred             HHHCCCCCCCEEEEECCCHHHHHHHHHHHC-CCCEEEEEECCH----------HHHHHHHHHHHHHCCCCCCCCCEEECC
Q ss_conf             243899855789995878438999999867-998899998898----------999988999998066452225302004
Q gi|255764482|r    4 ASLVNATGSFHLADLGAGAGAAGLAVASRL-HEAQILLAERSP----------LMAHYARKTLALPANAQISKRISLIEV   72 (225)
Q Consensus         4 a~~~~~~~~~~VLDlGcG~G~~~l~la~r~-~~~~v~gvD~~~----------~~~~~A~~n~~~~~~~~~~~~~~~~~~   72 (225)
                      .+|...+++..|.|+--|.|..+-.++... +...|+++-=++          .+-..+++-...|        .+.+-.
T Consensus        41 L~FaGlkpg~tVid~~PGgGy~TrI~s~~vgp~G~Vy~~~p~e~~~~~~~~~~r~~~~~~e~~~aN--------~e~~~~  112 (238)
T COG4798          41 LAFAGLKPGATVIDLIPGGGYFTRIFSPAVGPKGKVYAYVPAELTKFAKREGPRLNAAAREPVYAN--------VEVIGK  112 (238)
T ss_pred             EEEECCCCCCEEEEEECCCCCHHHHHCHHCCCCEEEEEECCHHHCCCCCCHHHHHHHHHHHHHHHH--------HHHHCC
T ss_conf             677526899879998348850744411002875059885643432510140366666664222310--------455277


Q ss_pred             CCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             4423531000012357652057722654464465478854556520566898999999998624698378702
Q gi|255764482|r   73 DVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIA  145 (225)
Q Consensus        73 D~~~~~~~~~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~  145 (225)
                      ++....        ..+..|++..|--|+.-..           +........++.....+.|||||.+.++-
T Consensus       113 ~~~A~~--------~pq~~d~~~~~~~yhdmh~-----------k~i~~~~A~~vna~vf~~LKPGGv~~V~d  166 (238)
T COG4798         113 PLVALG--------APQKLDLVPTAQNYHDMHN-----------KNIHPATAAKVNAAVFKALKPGGVYLVED  166 (238)
T ss_pred             CCCCCC--------CCCCCCCCCCCHHHHHHHC-----------CCCCCCHHHHHHHHHHHHCCCCCEEEEEE
T ss_conf             500458--------9976541332111100110-----------45685249999999998538884799874


No 245
>pfam03059 NAS Nicotianamine synthase protein. Nicotianamine synthase EC:2.5.1.43 catalyses the trimerisation of S-adenosylmethionine to yield one molecule of nicotianamine. Nicotianamine has an important role in plant iron uptake mechanisms. Plants adopt two strategies (termed I and II) of iron acquisition. Strategy I is adopted by all higher plants except graminaceous plants, which adopt strategy II. In strategy I plants, the role of nicotianamine is not fully determined: possible roles include the formation of more stable complexes with ferrous than with ferric ion, which might serve as a sensor of the physiological status of iron within a plant, or which might be involved in the transport of iron. In strategy II (graminaceous) plants, nicotianamine is the key intermediate (and nicotianamine synthase the key enzyme) in the synthesis of the mugineic family (the only known family in plants) of phytosiderophores. Phytosiderophores are iron chelators whose secretion by the roots is great
Probab=96.56  E-value=0.05  Score=30.63  Aligned_cols=108  Identities=21%  Similarity=0.154  Sum_probs=74.2

Q ss_pred             CCCEEEEECCCHHHH-HHHHHHHC-CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCC
Q ss_conf             557899958784389-99999867-9988999988989999889999980664522253020044423531000012357
Q gi|255764482|r   11 GSFHLADLGAGAGAA-GLAVASRL-HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKN   88 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~-~l~la~r~-~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~   88 (225)
                      ...+|.=+|||.=-+ ++++++.. +...+.++|+||.+.+.|++-+...+  ..+.++.+..+|+.+....       -
T Consensus       121 ~p~~vAFIGSGPLPLTsivLa~~h~~~~~~~niD~d~~A~~~A~~lv~~~g--~ls~~m~f~t~d~~~~~~~-------l  191 (277)
T pfam03059       121 VPSRIAFIGSGPLPLTSIVLASYHLPDTSFDNYDIDGLANDRASKLVSSDP--DLSSRMSFHTADVLDVTTE-------L  191 (277)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCCEEECCCCCHHHHHHHHHHHHHCC--CHHCCEEEEECCCCCCCCC-------C
T ss_conf             974489963788613899998850887314331278899999999998655--3004728995264444444-------4


Q ss_pred             CCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             65205772265446446547885455652056689899999999862469837870
Q gi|255764482|r   89 NFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLI  144 (225)
Q Consensus        89 ~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i  144 (225)
                      ..||+|+-..=-                 ......-..++++..+.++||..+.+-
T Consensus       192 ~~~DvV~lAALV-----------------Gm~~e~K~~I~~hL~k~m~~Ga~l~~R  230 (277)
T pfam03059       192 KAYDVVFLAALV-----------------GMDKEEKAKVIDHLGKHMAPGALLVLR  230 (277)
T ss_pred             CCCCEEEEHHHC-----------------CCCHHHHHHHHHHHHHHCCCCCEEEEE
T ss_conf             547689872113-----------------543335999999999745899679996


No 246
>pfam04816 DUF633 Family of unknown function (DUF633). This family of proteins are uncharacterized have no known function.
Probab=96.56  E-value=0.0071  Score=35.43  Aligned_cols=60  Identities=18%  Similarity=0.124  Sum_probs=51.3

Q ss_pred             EEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCC
Q ss_conf             999587843899999986799889999889899998899999806645222530200444235
Q gi|255764482|r   15 LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLV   77 (225)
Q Consensus        15 VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~   77 (225)
                      |.|+||--|.+++.|.+.....++++.|+++.-++.|++|+..++   ..+++++..+|=...
T Consensus         1 vADIGtDHayLpi~L~~~g~~~~aiA~Dv~~gPl~~A~~~i~~~g---l~~~I~~rlgdGL~~   60 (204)
T pfam04816         1 LADIGSDHAYLPIYLVKNNLASFAIAGEVNKGPLQSAVKNVKKSG---LTERIDVRLGDGLAV   60 (204)
T ss_pred             CCEECCCCHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHHCC---CCCEEEEEECCCHHC
T ss_conf             971054508999999977998779996166749999999999759---975389997784220


No 247
>TIGR00692 tdh L-threonine 3-dehydrogenase; InterPro: IPR004627   L-threonine 3-dehydrogenase (1.1.1.103 from EC) is a tetrameric, zinc-binding, NAD-dependent enzyme of threonine catabolism. It catalyses the conversion of L-threonine and NAD+ to L-2-amino-3-oxobutanoate and NADH. In Escherichia coli His-90 modulates substrate specificity and is believed part of the active site. Closely related proteins include sorbitol dehydrogenase, xylitol dehydrogenase, and benzyl alcohol dehydrogenase. Eukaryotic examples of this enzyme have been demonstrated experimentally but are not detected by this HMM. ; GO: 0008270 zinc ion binding, 0008743 L-threonine 3-dehydrogenase activity, 0006567 threonine catabolic process.
Probab=96.41  E-value=0.033  Score=31.65  Aligned_cols=170  Identities=16%  Similarity=0.181  Sum_probs=100.4

Q ss_pred             CCCCCEEEEECCC-HHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCC
Q ss_conf             9855789995878-438999999867998899998898999988999998066452225302004442353100001235
Q gi|255764482|r    9 ATGSFHLADLGAG-AGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLK   87 (225)
Q Consensus         9 ~~~~~~VLDlGcG-~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~   87 (225)
                      .-.|+.||=.||| -|.+++++|+.....+|+.+|.|+.-+++||+    -+   .+-.+++...|+.+.....    ..
T Consensus       159 ~~~G~~vlv~GaGPiGlma~AVAKa~GA~~Vi~~d~neyRleLAkk----~G---at~~vn~~kEd~~k~v~~l----t~  227 (341)
T TIGR00692       159 DLAGEDVLVIGAGPIGLMAVAVAKAAGARNVIVIDKNEYRLELAKK----MG---ATRVVNVAKEDLVKVVAEL----TS  227 (341)
T ss_pred             CCCCCCEEEECCCHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHH----CC---CCEEEECCCCCHHHHHHHH----CC
T ss_conf             7688718998577478999999877278405996586479999987----09---8658701014768988840----38


Q ss_pred             CCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEE-CCHHHH-HHHHHHHHCCCCCEE
Q ss_conf             765205772265446446547885455652056689899999999862469837870-288889-999998521788469
Q gi|255764482|r   88 NNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLI-ARPQSL-IQIVNACARRIGSLE  165 (225)
Q Consensus        88 ~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i-~~~~~l-~~~l~~~~~~~~~~~  165 (225)
                      .+-+|+++--                       .. ...-++.......+|||+.+. .|+... -|    +.++.- .+
T Consensus       228 geG~Dv~lEm-----------------------SG-aP~A~~~gL~~~~~gGR~~~Lglpp~~vtID----~tNkvi-FK  278 (341)
T TIGR00692       228 GEGVDVVLEM-----------------------SG-APKALEQGLDAVANGGRVALLGLPPSDVTID----LTNKVI-FK  278 (341)
T ss_pred             CCCEEEEEEC-----------------------CC-CCHHHHHHHHHHCCCCEEEECCCCCCCEEEE----ECCCEE-EE
T ss_conf             8964799864-----------------------89-9179999999850688089813689761263----037478-86


Q ss_pred             EEEECCCCCCCCEEEEEEEEECC---CCCCEEECCEEEECCC-CCHHHHHHHHHHCCCCCC
Q ss_conf             99814589698309999999778---8874770756898388-740018999997387631
Q gi|255764482|r  166 ITPLHPREGECASRILVTGRKGM---RGQLRFRYPIVLHKPN-GQPYSRFVTDLINGKRSL  222 (225)
Q Consensus       166 i~~v~~~~~~~~~~vlv~~~k~~---~~~~~~~~~l~l~~~~-g~~yt~~~~~l~~~~~~l  222 (225)
                      -..|+.--+++-   +-+|++=+   .++.-=++|++.|+=. -+.|.+.+ +++|-+++.
T Consensus       279 gLtI~GItGR~m---feTWy~vs~LiqS~~ldL~PiITH~f~G~d~fekgF-elMRsGq~G  335 (341)
T TIGR00692       279 GLTIKGITGRKM---FETWYKVSRLIQSNKLDLSPIITHKFKGLDEFEKGF-ELMRSGQSG  335 (341)
T ss_pred             EEEEEEECCCCH---HHHHHHHHHHHCCCCCCCCCEEECCCCCCHHHHHHH-HHHHCCCCC
T ss_conf             427720007504---678999999842688356845540268831467888-876378953


No 248
>pfam07091 FmrO Ribosomal RNA methyltransferase (FmrO). This family consists of several bacterial ribosomal RNA methyltransferase (aminoglycoside-resistance methyltransferase) proteins.
Probab=96.38  E-value=0.005  Score=36.31  Aligned_cols=51  Identities=16%  Similarity=0.132  Sum_probs=41.7

Q ss_pred             CCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHC
Q ss_conf             985578999587843899999986799889999889899998899999806
Q gi|255764482|r    9 ATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPA   59 (225)
Q Consensus         9 ~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~   59 (225)
                      ..+..+|+|+|||-.-+++.-....+++..+|.|||..+++....-+...+
T Consensus       100 ~~~p~sVlDlaCGlNPLa~pwm~~~~~~~Y~a~DId~~~i~fi~~~l~~l~  150 (248)
T pfam07091       100 LPPPRSVLDLACGLNPLAVPWMPLAPDATYHAYDIDRALIEFIRAFLALLG  150 (248)
T ss_pred             CCCCCEEEEECCCCCCCCCCCCCCCCCCEEEEEECCHHHHHHHHHHHHHCC
T ss_conf             899864420002688301423368998679997077789999999998629


No 249
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU; InterPro: IPR014088   Members of this protein family include S-adenosylmethionine-dependent C-20 methyltransferase (BchU), part of the pathway of bacteriochlorophyll c production in photosynthetic green sulphur bacteria. The position modified by this enzyme represents the difference between bacteriochlorophylls c and d; strains lacking this protein can only produce bacteriochlorophyll d..
Probab=96.35  E-value=0.013  Score=33.87  Aligned_cols=113  Identities=21%  Similarity=0.242  Sum_probs=76.2

Q ss_pred             CCHHHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCC
Q ss_conf             66243899855789995878438999999867998899998898999988999998066452225302004442353100
Q gi|255764482|r    2 ILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENR   81 (225)
Q Consensus         2 lLa~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~   81 (225)
                      ||..-++...=++..|+|-|.|-++-++.+.+|.-+++-+ .=|.++.+-++|+...|   ..+|++-+.-|+-..... 
T Consensus       140 LL~~~A~L~~V~~lIDVGGGIGDI~AAl~~~FP~L~~T~~-NLP~A~DLV~EN~A~KG---~ADR~~~~A~D~Y~E~YP-  214 (306)
T TIGR02716       140 LLLKRAKLDDVKKLIDVGGGIGDIAAALLKAFPELDVTLL-NLPSALDLVRENVAEKG---LADRIRGVAVDIYKESYP-  214 (306)
T ss_pred             HHHHHHHHHCCCEEEECCCCHHHHHHHHHHHCCCCCEEEE-CCCCHHHHHHHHHHHCC---CCCCCCCEEEEECCCCCC-
T ss_conf             9998751631325433388877899999973775232312-05405567766554145---100466315650338757-


Q ss_pred             CCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEE
Q ss_conf             00123576520577226544644654788545565205668989999999986246983787
Q gi|255764482|r   82 NLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSL  143 (225)
Q Consensus        82 ~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~  143 (225)
                              ..|-|+     |        ..   .-.......-.-.++.|...|+.||++.+
T Consensus       215 --------~~DAVL-----F--------~R---ILY~~N~Ql~T~l~~KAyDAl~SGGR~LI  252 (306)
T TIGR02716       215 --------EADAVL-----F--------SR---ILYSANEQLSTILLKKAYDALRSGGRLLI  252 (306)
T ss_pred             --------CCHHHH-----H--------HH---HHHHHHHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             --------711656-----7--------78---87644678999999988752257880786


No 250
>PRK13771 putative alcohol dehydrogenase; Provisional
Probab=96.31  E-value=0.072  Score=29.76  Aligned_cols=98  Identities=18%  Similarity=0.151  Sum_probs=58.1

Q ss_pred             HHCCCCCCCEEEEECC-C-HHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCC
Q ss_conf             4389985578999587-8-4389999998679988999988989999889999980664522253020044423531000
Q gi|255764482|r    5 SLVNATGSFHLADLGA-G-AGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRN   82 (225)
Q Consensus         5 ~~~~~~~~~~VLDlGc-G-~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~   82 (225)
                      ..++.++|++||=.|+ | .|..++.+|+. .++++++++.++.-.+.+++-    +     +. .+...++.     ..
T Consensus       156 ~~~~~~~g~~VlI~Ga~G~vG~~aiqlak~-~Ga~vi~v~~~~~k~~~~~~~----~-----~~-~i~~~~~~-----~~  219 (332)
T PRK13771        156 RRAGVSEGETVLVTGAGGGVGIHAVQVAKA-YGAKVIAVTTSESKAKAVGKY----A-----DY-VIVGSKFS-----EE  219 (332)
T ss_pred             HHHCCCCCCEEEEECCCCHHHHHHHHHHHH-CCCEEEEEECCHHHHHHHHHC----C-----CE-EEECCCHH-----HH
T ss_conf             971999999999977877589999999998-699899994999999999856----9-----98-98363057-----88


Q ss_pred             CCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             012357652057722654464465478854556520566898999999998624698378702
Q gi|255764482|r   83 LAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIA  145 (225)
Q Consensus        83 ~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~  145 (225)
                      .  ...+.+|.++-.-.                         ...+..+.+.|+++|++.++-
T Consensus       220 ~--~~~~g~Dvvid~~G-------------------------~~~~~~~~~~l~~~G~iv~~G  255 (332)
T PRK13771        220 V--KKLGGADIVIETVG-------------------------GPTLEESLRSLNWGGKIVLIG  255 (332)
T ss_pred             H--HHCCCCCEEEECCC-------------------------HHHHHHHHHHHCCCCEEEEEE
T ss_conf             8--73468638984576-------------------------688998888625896999993


No 251
>PRK05396 tdh L-threonine 3-dehydrogenase; Validated
Probab=96.29  E-value=0.067  Score=29.93  Aligned_cols=102  Identities=16%  Similarity=0.171  Sum_probs=60.7

Q ss_pred             CCCCCEEEEECCCH-HHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCC
Q ss_conf             98557899958784-38999999867998899998898999988999998066452225302004442353100001235
Q gi|255764482|r    9 ATGSFHLADLGAGA-GAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLK   87 (225)
Q Consensus         9 ~~~~~~VLDlGcG~-G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~   87 (225)
                      ...|++||=+|+|. |.+.+.+|+.....+|+++|.++.-++.|++    .+.   +..+.....|+.....    ....
T Consensus       161 ~~~g~~VlV~GaG~vGl~~~~~ak~~Ga~~Vi~~d~~~~kl~~a~~----lGa---~~~i~~~~~~~~~~~~----~~t~  229 (341)
T PRK05396        161 DLVGEDVLITGAGPIGIMAAAVAKHVGARHVVITDVNEYRLELARK----MGA---TRAVNVAKEDLRDVMA----ELGM  229 (341)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHCCCEEEEEEECCHHHHHHHHH----CCC---CEEEECCCHHHHHHHH----HHHC
T ss_conf             7788869998997543299999998499289999489999998986----499---4999688506899999----9748


Q ss_pred             CCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             7652057722654464465478854556520566898999999998624698378702
Q gi|255764482|r   88 NNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIA  145 (225)
Q Consensus        88 ~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~  145 (225)
                      ...+|+++-.-                        .....++.+.+++++||++.++-
T Consensus       230 ~~G~Dvvid~~------------------------G~~~~~~~~~~~l~~gG~vv~~G  263 (341)
T PRK05396        230 TEGFDVGLEMS------------------------GAPSAFRQMLDAMNHGGRIAMLG  263 (341)
T ss_pred             CCCCEEEEECC------------------------CCHHHHHHHHHHHHCCCEEEEEE
T ss_conf             99976999878------------------------98999999999863598999995


No 252
>COG5459 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis]
Probab=96.25  E-value=0.018  Score=33.21  Aligned_cols=116  Identities=21%  Similarity=0.218  Sum_probs=62.6

Q ss_pred             CCCCCCEEEEECCCHHHHHHHHHHHCCC-CEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCC
Q ss_conf             9985578999587843899999986799-889999889899998899999806645222530200444235310000123
Q gi|255764482|r    8 NATGSFHLADLGAGAGAAGLAVASRLHE-AQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGL   86 (225)
Q Consensus         8 ~~~~~~~VLDlGcG~G~~~l~la~r~~~-~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~   86 (225)
                      +--+.+++||.|.|.|.-..++-.-+|+ -.++-+|.||..=+. -..++.|.....   ......|+....    +.-.
T Consensus       110 ~dfapqsiLDvG~GPgtgl~A~n~i~Pdl~sa~ile~sp~lrkV-~~tl~~nv~t~~---td~r~s~vt~dR----l~lp  181 (484)
T COG5459         110 PDFAPQSILDVGAGPGTGLWALNDIWPDLKSAVILEASPALRKV-GDTLAENVSTEK---TDWRASDVTEDR----LSLP  181 (484)
T ss_pred             CCCCCCHHHCCCCCCCHHHHHHCCCCCCCHHHHHHCCCHHHHHH-HHHHHHHCCCCC---CCCCCCCCCHHC----CCCC
T ss_conf             88686102003778752123320337880221234048999999-999986045334---777788650210----4788


Q ss_pred             CCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECC
Q ss_conf             576520577226544644654788545565205668989999999986246983787028
Q gi|255764482|r   87 KNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIAR  146 (225)
Q Consensus        87 ~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~  146 (225)
                      ....+++++.--               ..............++....++.|||.+.+|-|
T Consensus       182 ~ad~ytl~i~~~---------------eLl~d~~ek~i~~~ie~lw~l~~~gg~lVivEr  226 (484)
T COG5459         182 AADLYTLAIVLD---------------ELLPDGNEKPIQVNIERLWNLLAPGGHLVIVER  226 (484)
T ss_pred             CCCEEEHHHHHH---------------HHCCCCCCCHHHHHHHHHHHHCCCCCEEEEEEC
T ss_conf             322363334354---------------444355743188999999986068974999717


No 253
>COG1568 Predicted methyltransferases [General function prediction only]
Probab=96.20  E-value=0.055  Score=30.39  Aligned_cols=110  Identities=13%  Similarity=0.161  Sum_probs=71.2

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             85578999587843899999986799889999889899998899999806645222530200444235310000123576
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNN   89 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~   89 (225)
                      -.|..|+=+| ---..|+++|-..-.-++.-+|||+..++.-.+-++..+.++    ++....|+++...     ....+
T Consensus       151 L~gK~I~vvG-DDDLtsia~aLt~mpk~iaVvDIDERli~fi~k~aee~g~~~----ie~~~~Dlr~plp-----e~~~~  220 (354)
T COG1568         151 LEGKEIFVVG-DDDLTSIALALTGMPKRIAVVDIDERLIKFIEKVAEELGYNN----IEAFVFDLRNPLP-----EDLKR  220 (354)
T ss_pred             CCCCEEEEEC-CCHHHHHHHHHCCCCCEEEEEECHHHHHHHHHHHHHHHCCCC----HHHEEEHHCCCCH-----HHHHH
T ss_conf             5787689970-750657889863887337998315899999999999848331----5540305104583-----98885


Q ss_pred             CCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCC---CEEEEECCHH
Q ss_conf             5205772265446446547885455652056689899999999862469---8378702888
Q gi|255764482|r   90 FYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSS---GQLSLIARPQ  148 (225)
Q Consensus        90 ~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpg---G~~~~i~~~~  148 (225)
                      +||.+++.||+-..                   .+..|+......||--   |.+.+..+..
T Consensus       221 kFDvfiTDPpeTi~-------------------alk~FlgRGI~tLkg~~~aGyfgiT~res  263 (354)
T COG1568         221 KFDVFITDPPETIK-------------------ALKLFLGRGIATLKGEGCAGYFGITRRES  263 (354)
T ss_pred             HCCEEECCCHHHHH-------------------HHHHHHHCCHHHHCCCCCCCEEEEEECCC
T ss_conf             07764359633579-------------------99999851188735887453686641426


No 254
>COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis]
Probab=96.20  E-value=0.083  Score=29.41  Aligned_cols=136  Identities=18%  Similarity=0.143  Sum_probs=80.6

Q ss_pred             CCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCC
Q ss_conf             89985578999587843899999986799889999889899998899999806645222530200444235310000123
Q gi|255764482|r    7 VNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGL   86 (225)
Q Consensus         7 ~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~   86 (225)
                      .+.++|.+||=+|+-+|+..=-++.-.+...++|||.+|.+....-.-.+      ...++-.+-+|......-..    
T Consensus        72 ~pi~~g~~VLYLGAasGTTvSHVSDIv~~G~iYaVEfs~R~~reLl~~a~------~R~Ni~PIL~DA~~P~~Y~~----  141 (231)
T COG1889          72 FPIKEGSKVLYLGAASGTTVSHVSDIVGEGRIYAVEFSPRPMRELLDVAE------KRPNIIPILEDARKPEKYRH----  141 (231)
T ss_pred             CCCCCCCEEEEEECCCCCCHHHHHHCCCCCCEEEEEECCHHHHHHHHHHH------HCCCCEEEECCCCCCHHHHH----
T ss_conf             77699987899503679857677760478708999964446999999987------47874002013688377653----


Q ss_pred             CCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCH----------HHHHHHH-H
Q ss_conf             5765205772265446446547885455652056689899999999862469837870288----------8899999-9
Q gi|255764482|r   87 KNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARP----------QSLIQIV-N  155 (225)
Q Consensus        87 ~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~----------~~l~~~l-~  155 (225)
                      .-+..|+|...        ..-|+            -.+-+...|...||++|...++.-+          +-+.+.. .
T Consensus       142 ~Ve~VDviy~D--------VAQp~------------Qa~I~~~Na~~FLk~~G~~~i~iKArSIdvT~dp~~vf~~ev~k  201 (231)
T COG1889         142 LVEKVDVIYQD--------VAQPN------------QAEILADNAEFFLKKGGYVVIAIKARSIDVTADPEEVFKDEVEK  201 (231)
T ss_pred             HCCCCCEEEEE--------CCCCH------------HHHHHHHHHHHHCCCCCEEEEEEEEECCCCCCCHHHHHHHHHHH
T ss_conf             12454389983--------68810------------78999988997321697399999851230458989999999999


Q ss_pred             HHHCCCCCEEEEEECCC
Q ss_conf             85217884699981458
Q gi|255764482|r  156 ACARRIGSLEITPLHPR  172 (225)
Q Consensus       156 ~~~~~~~~~~i~~v~~~  172 (225)
                      +....+......-+-|+
T Consensus       202 L~~~~f~i~e~~~LePy  218 (231)
T COG1889         202 LEEGGFEILEVVDLEPY  218 (231)
T ss_pred             HHHCCCEEEEEECCCCC
T ss_conf             98569504677636776


No 255
>KOG2360 consensus
Probab=96.18  E-value=0.016  Score=33.43  Aligned_cols=91  Identities=19%  Similarity=0.192  Sum_probs=68.8

Q ss_pred             CHHHCCCCCCCEEEEECCCHHHHHHHHHHHCC-CCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCC
Q ss_conf             62438998557899958784389999998679-98899998898999988999998066452225302004442353100
Q gi|255764482|r    3 LASLVNATGSFHLADLGAGAGAAGLAVASRLH-EAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENR   81 (225)
Q Consensus         3 La~~~~~~~~~~VLDlGcG~G~~~l~la~r~~-~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~   81 (225)
                      -|..+.+.+|.+|.|.||-.|.-+.-+|.-.. ..+++|+|.+++-++..++-+...+.+.    ++...+|+......+
T Consensus       205 pA~ll~p~~g~~v~d~caapg~KTsH~a~i~~n~gki~afe~d~~r~~tl~~~l~~ag~~~----~~~~~~df~~t~~~~  280 (413)
T KOG2360         205 PAHLLDPRPGSRVIDTCAAPGNKTSHLAAIMRNQGKIYAFERDAKRAATLRKLLKIAGVSI----VESVEGDFLNTATPE  280 (413)
T ss_pred             HHHHCCCCCCCCEEEECCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCCCC----CCCCCCCCCCCCCCC
T ss_conf             3654389998823554146653211299886224872132341688999999998717874----532014444777810


Q ss_pred             CCCCCCCCCCCEEEECCCCCC
Q ss_conf             001235765205772265446
Q gi|255764482|r   82 NLAGLKNNFYDHVIMNPPFNE  102 (225)
Q Consensus        82 ~~~~~~~~~fDlii~nPPy~~  102 (225)
                           .-.....+++.|+...
T Consensus       281 -----~~~~v~~iL~DpscSg  296 (413)
T KOG2360         281 -----KFRDVTYILVDPSCSG  296 (413)
T ss_pred             -----CCCCEEEEEECCCCCC
T ss_conf             -----0265059985798787


No 256
>pfam10237 N6-adenineMlase Probable N6-adenine methyltransferase. This is a protein of approximately 200 residues which is conserved from plants to humans. It contains a highly conserved QFW motif close to the N-terminus and a DPPF motif in the centre. The DPPF motif is characteristic of N-6 adenine-specific DNA methylases, and this family is found in eukaryotes.
Probab=96.09  E-value=0.078  Score=29.54  Aligned_cols=124  Identities=19%  Similarity=0.216  Sum_probs=69.8

Q ss_pred             CCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCC
Q ss_conf             98557899958784389999998679988999988989999889999980664522253020044423531000012357
Q gi|255764482|r    9 ATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKN   88 (225)
Q Consensus         9 ~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~   88 (225)
                      +.++.+|.=+.|=+-...+. ....+..++.-+|.|..--..        +       -+++.-|......   +.....
T Consensus        23 ~~~~~~IA~lS~PSly~~l~-~~~~~~~~v~LfEyD~RF~~~--------~-------~~FvfYDyn~P~~---lp~~l~   83 (161)
T pfam10237        23 ADEGTVIACVSAPSVYAALK-ERPIPTKNVYLLEYDKRFAVY--------G-------GEFVFYDYNKPLE---LPEQLK   83 (161)
T ss_pred             CCCCCEEEEECCCHHHHHHH-HCCCCCCCEEEEEECHHHHHC--------C-------CCEEECCCCCCCC---CHHHHH
T ss_conf             68998799985868999998-434887737996543058767--------9-------9416777898010---879970


Q ss_pred             CCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             65205772265446446547885455652056689899999999862469837870288889999998521788469998
Q gi|255764482|r   89 NFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITP  168 (225)
Q Consensus        89 ~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~~l~~~l~~~~~~~~~~~i~~  168 (225)
                      ++||+|+..|||...                  ..+......+..++||+|++.+.. -++..+++..+. +.......|
T Consensus        84 ~~fD~vi~DPPFLse------------------ec~~K~a~t~~~L~k~~~kli~~T-g~~~~~~~~kll-~~~~~~F~P  143 (161)
T pfam10237        84 GKFDRVIADPPFLSE------------------ECLTKTAITIKLLLKPDSKLLLCT-GERMEDLAAKLL-GLKITDFLP  143 (161)
T ss_pred             CCCCEEEECCCCCCH------------------HHHHHHHHHHHHHHCCCCEEEEEC-HHHHHHHHHHHC-CCEEEEEEE
T ss_conf             867889989999899------------------999999999999808998799934-899999999972-982412570


Q ss_pred             ECC
Q ss_conf             145
Q gi|255764482|r  169 LHP  171 (225)
Q Consensus       169 v~~  171 (225)
                      -|+
T Consensus       144 ~h~  146 (161)
T pfam10237       144 EHE  146 (161)
T ss_pred             CCC
T ss_conf             566


No 257
>pfam01555 N6_N4_Mtase DNA methylase. Members of this family are DNA methylases. The family contains both N-4 cytosine-specific DNA methylases and N-6 Adenine-specific DNA methylases.
Probab=96.09  E-value=0.013  Score=33.94  Aligned_cols=62  Identities=13%  Similarity=0.274  Sum_probs=36.1

Q ss_pred             CCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHHHHHHHH
Q ss_conf             2057722654464465478854556520566898999999998624698378702888899999
Q gi|255764482|r   91 YDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIV  154 (225)
Q Consensus        91 fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~~l~~~l  154 (225)
                      .|+|++.|||+....-...+....  ...-......++..+.++|+++|.+++.........+.
T Consensus         1 IDli~tdPPY~~~~~~~~~~~~~~--~~~y~~~~~~~~~~~~rvLk~~G~~~~~~~~~~~~~~~   62 (221)
T pfam01555         1 VDLIVTDPPYNLGKDYGQWDDKDS--YEEYLEWLEEWLKEVRRVLKPGGSIFINIGDKYIKSLK   62 (221)
T ss_pred             CEEEEECCCCCCCCCCCCCCCCCC--HHHHHHHHHHHHHHHHHHCCCCCEEEEECCCHHHHHHH
T ss_conf             919998999977775662678889--99999999999999999826886599976717579999


No 258
>KOG1227 consensus
Probab=95.97  E-value=0.011  Score=34.42  Aligned_cols=73  Identities=19%  Similarity=0.136  Sum_probs=55.6

Q ss_pred             CCCEEEEECCCHHHHHH-HHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             55789995878438999-99986799889999889899998899999806645222530200444235310000123576
Q gi|255764482|r   11 GSFHLADLGAGAGAAGL-AVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNN   89 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l-~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~   89 (225)
                      .++.|.|+-+|.|.+++ .+.. .....|+++|.+|.+++..|+|++.|+   ..++..+.++|-+...        ++.
T Consensus       194 ~~eviVDLYAGIGYFTlpflV~-agAk~V~A~EwNp~svEaLrR~~~~N~---V~~r~~i~~gd~R~~~--------~~~  261 (351)
T KOG1227         194 DGEVIVDLYAGIGYFTLPFLVT-AGAKTVFACEWNPWSVEALRRNAEANN---VMDRCRITEGDNRNPK--------PRL  261 (351)
T ss_pred             CCCHHHHHHCCCCEEEEEHHHC-CCCCEEEEEECCHHHHHHHHHHHHHCC---HHHHHHHHHCCCCCCC--------CCC
T ss_conf             6530122342654487402300-574579999458799999998777411---5788786651023667--------553


Q ss_pred             CCCEEE
Q ss_conf             520577
Q gi|255764482|r   90 FYDHVI   95 (225)
Q Consensus        90 ~fDlii   95 (225)
                      ..|.|.
T Consensus       262 ~AdrVn  267 (351)
T KOG1227         262 RADRVN  267 (351)
T ss_pred             CCHHEE
T ss_conf             202036


No 259
>KOG1331 consensus
Probab=95.96  E-value=0.009  Score=34.86  Aligned_cols=98  Identities=12%  Similarity=0.101  Sum_probs=62.5

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             85578999587843899999986799889999889899998899999806645222530200444235310000123576
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNN   89 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~   89 (225)
                      ..+..++|.|||.|--.    .-.|...++|.|+....+..|++-       +.   .....+|.....       ....
T Consensus        44 ~~gsv~~d~gCGngky~----~~~p~~~~ig~D~c~~l~~~ak~~-------~~---~~~~~ad~l~~p-------~~~~  102 (293)
T KOG1331          44 PTGSVGLDVGCGNGKYL----GVNPLCLIIGCDLCTGLLGGAKRS-------GG---DNVCRADALKLP-------FREE  102 (293)
T ss_pred             CCCCEEEECCCCCCCCC----CCCCCCEEEECCHHHHHCCCCCCC-------CC---CEEEHHHHHCCC-------CCCC
T ss_conf             87640454246876557----679863154030223220533347-------98---625612444289-------8787


Q ss_pred             CCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEE
Q ss_conf             520577226544644654788545565205668989999999986246983787
Q gi|255764482|r   90 FYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSL  143 (225)
Q Consensus        90 ~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~  143 (225)
                      +||..++---               ..+......-...++...+.|+|||...+
T Consensus       103 s~d~~lsiav---------------ihhlsT~~RR~~~l~e~~r~lrpgg~~lv  141 (293)
T KOG1331         103 SFDAALSIAV---------------IHHLSTRERRERALEELLRVLRPGGNALV  141 (293)
T ss_pred             CCCCCHHHHH---------------HHHHHHHHHHHHHHHHHHHHHCCCCCEEE
T ss_conf             6000323354---------------44443677899999999987267885689


No 260
>KOG2798 consensus
Probab=95.92  E-value=0.085  Score=29.34  Aligned_cols=42  Identities=19%  Similarity=0.072  Sum_probs=32.7

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHH
Q ss_conf             85578999587843899999986799889999889899998899
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARK   53 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~   53 (225)
                      +..-+||=+|||.|.++.-+|..  +-.+-|-|.+--|+=+...
T Consensus       149 r~ki~iLvPGaGlGRLa~dla~~--G~~~qGNEfSy~Mli~S~F  190 (369)
T KOG2798         149 RTKIRILVPGAGLGRLAYDLACL--GFKCQGNEFSYFMLICSSF  190 (369)
T ss_pred             CCCCEEEECCCCCHHHHHHHHHH--CCCCCCCHHHHHHHHHHHH
T ss_conf             55862881488711678998874--3333430789999999999


No 261
>TIGR00006 TIGR00006 S-adenosyl-methyltransferase MraW; InterPro: IPR002903 This is a family of methyltransferases. Methyltransferases are responsible for the transfer of methyl groups between two molecules.; GO: 0008168 methyltransferase activity.
Probab=95.91  E-value=0.025  Score=32.36  Aligned_cols=88  Identities=18%  Similarity=0.147  Sum_probs=61.0

Q ss_pred             CCCCCCCEEEEECCCHHHHHHHHHHHCCC-CEEEEEECCHHHHHHHHHHHHHHCCCCCCC-CCEEECCCCCCCCCCCCCC
Q ss_conf             89985578999587843899999986799-889999889899998899999806645222-5302004442353100001
Q gi|255764482|r    7 VNATGSFHLADLGAGAGAAGLAVASRLHE-AQILLAERSPLMAHYARKTLALPANAQISK-RISLIEVDVTLVGENRNLA   84 (225)
Q Consensus         7 ~~~~~~~~VLDlGcG~G~~~l~la~r~~~-~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~-~~~~~~~D~~~~~~~~~~~   84 (225)
                      .++++.+.-+|.=-|.|+.|-.+-.+.+. ..++|+|.|+.+++.|++-.....     . ++...+..+.+........
T Consensus        23 L~ik~~G~YiD~T~G~GGHS~~iL~ql~~~g~L~~iD~D~~ai~~A~~~l~~~~-----~~~~~~~~~~F~~~~~~~~~~   97 (323)
T TIGR00006        23 LNIKPDGIYIDCTLGRGGHSKAILEQLSEKGRLIGIDRDKQAIAFAKELLKDFE-----GRRVVLIHDNFANFFEYLKEL   97 (323)
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHHHC-----CCEEEEECCCCHHHHHHHHCC
T ss_conf             654888736540258517899998523999507887479899999999853210-----675788507603420032115


Q ss_pred             CCCCCC-----CCEEEECCCC
Q ss_conf             235765-----2057722654
Q gi|255764482|r   85 GLKNNF-----YDHVIMNPPF  100 (225)
Q Consensus        85 ~~~~~~-----fDlii~nPPy  100 (225)
                      . ...+     +||=||.|-+
T Consensus        98 ~-~~~k~dGIL~DLGVSS~QL  117 (323)
T TIGR00006        98 D-LVTKIDGILVDLGVSSPQL  117 (323)
T ss_pred             C-CEEEEEEEEECCCCCCHHC
T ss_conf             8-8157745886157760311


No 262
>TIGR00675 dcm DNA-cytosine methyltransferase; InterPro: IPR001525 C-5 cytosine-specific DNA methylases (2.1.1.73 from EC) (C5 Mtase) are enzymes that specifically methylate the C-5 carbon of cytosines in DNA to produce C5-methylcytosine , , . In mammalian cells, cytosine-specific methyltransferases methylate certain CpG sequences, which are believed to modulate gene expression and cell differentiation. In bacteria, these enzymes are a component of restriction-modification systems and serve as valuable tools for the manipulation of DNA , . The structure of HhaI methyltransferase (M.HhaI) has been resolved to 2.5 A : the molecule folds into 2 domains - a larger catalytic domain containing catalytic and cofactor binding sites, and a smaller DNA recognition domain.; GO: 0003677 DNA binding, 0006306 DNA methylation.
Probab=95.76  E-value=0.038  Score=31.32  Aligned_cols=79  Identities=15%  Similarity=0.082  Sum_probs=57.9

Q ss_pred             EEEECCCHHHHHHHHHHHC-----CCCEEEEEEC--CHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCC
Q ss_conf             9995878438999999867-----9988999988--98999988999998066452225302004442353100001235
Q gi|255764482|r   15 LADLGAGAGAAGLAVASRL-----HEAQILLAER--SPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLK   87 (225)
Q Consensus        15 VLDlGcG~G~~~l~la~r~-----~~~~v~gvD~--~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~   87 (225)
                      +.|+.||.|++-+-+-+-.     .--.|.+.|+  ++.+...=+.|...        ...+..+||..+.....+....
T Consensus         1 ~idLFaGiGG~rlGfe~~g~~l~~~~~~V~~sE~PRdk~A~~tY~~Nf~~--------~~~~~~~DI~~i~~~~~~~~~~   72 (425)
T TIGR00675         1 VIDLFAGIGGIRLGFEQAGKELTVAFKCVFASEIPRDKYAQKTYEANFGN--------DEKVPFGDITKISPSDLLRHIA   72 (425)
T ss_pred             CEEEECCCCHHHHHHHHHHHCCCCCEEEEEEECCCCCHHHHHHHHHHCCC--------CCEECCCCCCCCCCCCCCCCCC
T ss_conf             94542551357899997410141113788720166877899999976478--------8420677633366011500124


Q ss_pred             CCCCCEEEECCCCC
Q ss_conf             76520577226544
Q gi|255764482|r   88 NNFYDHVIMNPPFN  101 (225)
Q Consensus        88 ~~~fDlii~nPPy~  101 (225)
                      ...||+.++-+|+-
T Consensus        73 ~Pd~D~L~gGFPCQ   86 (425)
T TIGR00675        73 IPDFDILLGGFPCQ   86 (425)
T ss_pred             CCCEEEEECCCCCC
T ss_conf             88678996389971


No 263
>COG4889 Predicted helicase [General function prediction only]
Probab=95.44  E-value=0.024  Score=32.47  Aligned_cols=136  Identities=18%  Similarity=0.205  Sum_probs=68.1

Q ss_pred             CCCCEEEEECCCHHHHHHHHHH----------HCCCCEEEEEECCHHHHHHHHHHHHHHCCCC-----------CCCCCE
Q ss_conf             8557899958784389999998----------6799889999889899998899999806645-----------222530
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVAS----------RLHEAQILLAERSPLMAHYARKTLALPANAQ-----------ISKRIS   68 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~----------r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~-----------~~~~~~   68 (225)
                      .++-+|||+.+|+|.+-.-+.+          ++ .-++.+.||-=-++-+|--|++....+.           +.+.+.
T Consensus       844 d~~vhilDpFtGTGtFi~RlL~alIs~edl~rKf-~~eLhA~eIvLLsYYIAaiNIe~t~~~~~gd~~~F~giaLtDtf~  922 (1518)
T COG4889         844 DQSVHILDPFTGTGTFIVRLLSALISDEDLKRKF-QKELHAFEIVLLSYYIAAINIEQTAQNRDGDLKNFKGIALTDTFD  922 (1518)
T ss_pred             CCCEEEECCCCCCCHHHHHHHHHHCCHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCEECCHHH
T ss_conf             5770663477874078999999865889999999-855307787999999998627987654148711378715402354


Q ss_pred             EECCCCCCCCC----CCCCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHH-----HH----------HCCCCCC----HH
Q ss_conf             20044423531----00001235765205772265446446547885455-----65----------2056689----89
Q gi|255764482|r   69 LIEVDVTLVGE----NRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKE-----EA----------HVMLEDS----FE  125 (225)
Q Consensus        69 ~~~~D~~~~~~----~~~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~-----~a----------~~~~~~~----~~  125 (225)
                      ..+.|-.+...    ...+.....-...+|++||||..+.....-++...     ..          .....+.    +.
T Consensus       923 ~~Eed~~d~~~f~~n~erlkrq~~ipI~VIiGNPPYS~gqks~ndnn~nl~ypkLd~rv~~sy~k~STA~nknsl~Dsyi 1002 (1518)
T COG4889         923 YLEEDTLDGDIFGYNNERLKRQKEIPIRVIIGNPPYSAGQKSENDNNQNLSYPKLDKRVYESYGKNSTATNKNSLRDSYI 1002 (1518)
T ss_pred             HHCCCCCCCCCCCCCHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCHHHCCCCHHHHHH
T ss_conf             42235455654575378998613785499917998765656767655455662278899998720221202342589999


Q ss_pred             HHHHHHHHHCCCCCEEEEECC
Q ss_conf             999999986246983787028
Q gi|255764482|r  126 KWIRTACAIMRSSGQLSLIAR  146 (225)
Q Consensus       126 ~~~~~a~~lLkpgG~~~~i~~  146 (225)
                      .-++.|...++..|.+.||..
T Consensus      1003 ra~RwasDri~d~GVigFV~N 1023 (1518)
T COG4889        1003 RAIRWASDRIKDNGVIGFVVN 1023 (1518)
T ss_pred             HHHHHHHHHCCCCCEEEEEEC
T ss_conf             999987653156855999956


No 264
>TIGR00308 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase; InterPro: IPR002905 This enzyme 2.1.1.32 from EC uses S-adenosyl-L-methionine to methylate tRNA:  S-AdoMet + tRNA = S-adenosyl-L-homocysteine + tRNA containing N2-methylguanine The TRM1 gene of Saccharomyces cerevisiae is necessary for the N2,N2-dimethylguanosine modification of both mitochondrial and cytoplasmic tRNAs . The enzyme is found in both eukaryotes and archaea .; GO: 0003723 RNA binding, 0004809 tRNA (guanine-N2-)-methyltransferase activity, 0008033 tRNA processing.
Probab=95.39  E-value=0.029  Score=31.96  Aligned_cols=80  Identities=16%  Similarity=0.272  Sum_probs=60.5

Q ss_pred             CEEEEECCCHHHHHHHHHHHCC--C-CEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             7899958784389999998679--9-889999889899998899999806645222530200444235310000123576
Q gi|255764482|r   13 FHLADLGAGAGAAGLAVASRLH--E-AQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNN   89 (225)
Q Consensus        13 ~~VLDlGcG~G~~~l~la~r~~--~-~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~   89 (225)
                      -.|+|-=+|+|.=++-.|...+  + .+++.-|++|.+++.-+.|++.|+..|    +++.+.|.-.......  ....+
T Consensus        96 i~~~dALSasGiRaiRya~E~~fngv~~v~~ND~~P~Ave~I~~N~~~N~v~N----~~v~n~Da~~~L~~~n--kat~~  169 (462)
T TIGR00308        96 IEIADALSASGIRAIRYALEVEFNGVKKVFANDINPKAVESIKNNVKLNSVEN----IEVINEDAAAVLRKRN--KATFR  169 (462)
T ss_pred             HHHHHHHHCCCHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHHCCCCC----CCCCCCHHHHHHHHHC--HHHCC
T ss_conf             89998751040889999874465761067753477378899884123244227----6545503799987512--11236


Q ss_pred             CCCEEEECC
Q ss_conf             520577226
Q gi|255764482|r   90 FYDHVIMNP   98 (225)
Q Consensus        90 ~fDlii~nP   98 (225)
                      .||+|=-.|
T Consensus       170 ~F~viDiDP  178 (462)
T TIGR00308       170 KFEVIDIDP  178 (462)
T ss_pred             CCCEEEECC
T ss_conf             764376478


No 265
>KOG4058 consensus
Probab=95.35  E-value=0.021  Score=32.74  Aligned_cols=68  Identities=25%  Similarity=0.233  Sum_probs=48.5

Q ss_pred             HHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCC
Q ss_conf             438998557899958784389999998679988999988989999889999980664522253020044423
Q gi|255764482|r    5 SLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL   76 (225)
Q Consensus         5 ~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~   76 (225)
                      ++++-.+.++.+|+|+|-|.+-++.|+. .-..-+|+|++|-.++.+|-.....+.   .....+...|+..
T Consensus        66 Sll~~n~~GklvDlGSGDGRiVlaaar~-g~~~a~GvELNpwLVaysrl~a~R~g~---~k~trf~RkdlwK  133 (199)
T KOG4058          66 SLLRGNPKGKLVDLGSGDGRIVLAAARC-GLRPAVGVELNPWLVAYSRLHAWRAGC---AKSTRFRRKDLWK  133 (199)
T ss_pred             HHCCCCCCCCEEECCCCCCEEEHHHHHH-CCCCCCCEECCHHHHHHHHHHHHHHHC---CCCHHHHHHHHHH
T ss_conf             8714899881785258985244666650-777677433038999999999998742---5331022321100


No 266
>pfam00107 ADH_zinc_N Zinc-binding dehydrogenase.
Probab=95.01  E-value=0.24  Score=26.81  Aligned_cols=90  Identities=19%  Similarity=0.191  Sum_probs=54.2

Q ss_pred             CHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCEEEECCCC
Q ss_conf             84389999998679988999988989999889999980664522253020044423531000012357652057722654
Q gi|255764482|r   21 GAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF  100 (225)
Q Consensus        21 G~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~fDlii~nPPy  100 (225)
                      |.|.+.+.+|+.....+|+++|.++.-.+.|++.    +...   -+.....|+...    .........+|.++-..+ 
T Consensus         1 giG~~~iq~ak~~Ga~~Vi~~~~~~~r~~~a~~l----Ga~~---~i~~~~~~~~~~----i~~~~~~~g~d~vid~~g-   68 (131)
T pfam00107         1 GVGLAAVQLAKALGAARVIAVDRSEEKLELAKEL----GADH---VINYRDEDFVER----VRELTGGRGVDVVIDCVG-   68 (131)
T ss_pred             CHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHC----CCCC---CCCCCCCCHHHH----HHHCCCCCCCEEEEECCC-
T ss_conf             9589999999984998799996988999999975----9973---235332212455----654049977649886688-


Q ss_pred             CCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             464465478854556520566898999999998624698378702
Q gi|255764482|r  101 NERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIA  145 (225)
Q Consensus       101 ~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~  145 (225)
                                             ....++.+.++++++|++.++-
T Consensus        69 -----------------------~~~~~~~~~~~~~~~G~iv~~G   90 (131)
T pfam00107        69 -----------------------APATLEQALELLRPGGRVVVVG   90 (131)
T ss_pred             -----------------------CHHHHHHHHHHHCCCCEEEEEE
T ss_conf             -----------------------6667999987535997899994


No 267
>COG0863 DNA modification methylase [DNA replication, recombination, and repair]
Probab=94.68  E-value=0.074  Score=29.67  Aligned_cols=74  Identities=18%  Similarity=0.292  Sum_probs=44.0

Q ss_pred             CCCCCCCEEEECCCCCCCCCC--CCCCHHHHH------HHCCCCCC-HHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHH
Q ss_conf             357652057722654464465--478854556------52056689-899999999862469837870288889999998
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIGT--MTPDKIKEE------AHVMLEDS-FEKWIRTACAIMRSSGQLSLIARPQSLIQIVNA  156 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~~--~~~~~~~~~------a~~~~~~~-~~~~~~~a~~lLkpgG~~~~i~~~~~l~~~l~~  156 (225)
                      .+..++|++++.|||......  .........      ....-... ...|+..+.+.++++|.+++..+......+...
T Consensus        31 ~~~~svDli~tdppy~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~rvl~~~~~~~v~~~~~~~~~~~~~  110 (302)
T COG0863          31 LPENSVDLIFTDPPYNNVKAGRKLGFLKRWLDAWDGWDSRGIYLKFILLQWLAEQKRVLKPGGSLYVIDPFSNLARIEDI  110 (302)
T ss_pred             CCCCCCCEEECCCCCHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEECCCCEEEEECCCCCCHHHHHH
T ss_conf             72225876765997344332233220122456653257788887555689998755315257707995387553489999


Q ss_pred             HHC
Q ss_conf             521
Q gi|255764482|r  157 CAR  159 (225)
Q Consensus       157 ~~~  159 (225)
                      +..
T Consensus       111 ~~~  113 (302)
T COG0863         111 AKK  113 (302)
T ss_pred             HHH
T ss_conf             997


No 268
>pfam04989 CmcI Cephalosporin hydroxylase. Members of this family are about 220 amino acids long. The CmcI protein is presumed to represent the cephalosporin-7--hydroxylase. However this has not been experimentally verified.
Probab=94.63  E-value=0.11  Score=28.67  Aligned_cols=62  Identities=18%  Similarity=0.119  Sum_probs=43.5

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHC----CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCC
Q ss_conf             855789995878438999999867----99889999889899998899999806645222530200444235310
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRL----HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGEN   80 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~----~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~   80 (225)
                      -+++.|.|+|...|+.++..|...    ..++|+|||++........  +       ...+++++++|-.+....
T Consensus        31 ~kPd~IIE~G~a~GGS~l~~A~~l~~~~~~~~VigiDi~i~~~~~~~--i-------~~~~I~lieg~s~d~~~~   96 (202)
T pfam04989        31 LKPDLIIETGIAHGGSALFFASMLELLGSDGKVLGIDIDIREHNRPA--I-------EAPRITFIQGSSTDPEII   96 (202)
T ss_pred             HCCCEEEEECCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCHHH--H-------CCCCEEEEECCCCCHHHH
T ss_conf             59998999616766289999999997389987999957644335435--3-------168769997685678899


No 269
>TIGR02817 adh_fam_1 zinc-binding alcohol dehydrogenase family protein; InterPro: IPR014182   Members of this entry form a distinct subset of the larger family of oxidoreductases that includes zinc-binding alcohol dehydrogenases and NADPH:quinone reductases. Some current members of this entry carry designations as putative alginate lyase, however none have been characterised as such..
Probab=94.50  E-value=0.13  Score=28.38  Aligned_cols=105  Identities=15%  Similarity=0.184  Sum_probs=66.8

Q ss_pred             CCCCEEEEECCC--HHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCC-CCCCCCC
Q ss_conf             855789995878--4389999998679988999988989999889999980664522253020044423531-0000123
Q gi|255764482|r   10 TGSFHLADLGAG--AGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGE-NRNLAGL   86 (225)
Q Consensus        10 ~~~~~VLDlGcG--~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~-~~~~~~~   86 (225)
                      ..+..+|=+|.+  .|.+.+-||++..+..|+|.=.=|+..+-.+++=....              |.|... ...+...
T Consensus       149 ~~~~~lLIiGgAGGVGSI~iQLAR~LT~ltVIaTASRpEs~~Wv~~LGAH~V--------------IDHskPL~~ql~~L  214 (338)
T TIGR02817       149 GAKRALLIIGGAGGVGSILIQLARQLTGLTVIATASRPESQEWVLELGAHHV--------------IDHSKPLKAQLEKL  214 (338)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHCCCCEE--------------ECCCCCHHHHHHHH
T ss_conf             8887478973885178999999998549649997285789999997399188--------------65884368999982


Q ss_pred             CCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHHHHHH
Q ss_conf             576520577226544644654788545565205668989999999986246983787028888999
Q gi|255764482|r   87 KNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQ  152 (225)
Q Consensus        87 ~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~~l~~  152 (225)
                      .-..-++|+|                        .+.-+.-++...++|+|.|+|.+|-.|..|+-
T Consensus       215 ~l~~v~~V~S------------------------lT~TDqH~~~ive~laPQGrlaLIDDP~~LD~  256 (338)
T TIGR02817       215 GLEAVSYVFS------------------------LTHTDQHFKEIVELLAPQGRLALIDDPAELDV  256 (338)
T ss_pred             CCCCCCEEEC------------------------CCHHHHHHHHHHHHHCCCCCEECCCCCCCCCH
T ss_conf             8899855751------------------------66078999999998567874000028700163


No 270
>smart00829 PKS_ER Enoylreductase. Enoylreductase in Polyketide synthases.
Probab=94.33  E-value=0.35  Score=25.84  Aligned_cols=106  Identities=16%  Similarity=0.175  Sum_probs=58.9

Q ss_pred             HHCCCCCCCEEEE-ECCC-HHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCC
Q ss_conf             4389985578999-5878-4389999998679988999988989999889999980664522253020044423531000
Q gi|255764482|r    5 SLVNATGSFHLAD-LGAG-AGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRN   82 (225)
Q Consensus         5 ~~~~~~~~~~VLD-lGcG-~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~   82 (225)
                      ...+.++|++||= -||| .|...+.+|+.. +++|+++..++.-.+.+++    .+... ..-+.....|+...    .
T Consensus        98 ~~~~i~~g~~VlI~gg~G~vG~~aiqlak~~-Ga~Vi~t~~s~~k~~~~~~----lG~~~-~~v~~~~~~~~~~~----v  167 (288)
T smart00829       98 DLARLRPGESVLIHAAAGGVGQAAIQLAQHL-GAEVFATAGSPEKRDFLRE----LGIPD-DHIFSSRDLSFADE----I  167 (288)
T ss_pred             HHCCCCCCCEEEEECCCCHHHHHHHHHHHHC-CCCEEEEECCHHHHHHHHH----CCCCC-CEEEECCCCCHHHH----H
T ss_conf             7508899999999789867779999999973-9830034088899999997----69996-07621799509999----9


Q ss_pred             CCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             012357652057722654464465478854556520566898999999998624698378702
Q gi|255764482|r   83 LAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIA  145 (225)
Q Consensus        83 ~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~  145 (225)
                      ........+|+|+-..                         -.+.+..+.++|+++|++..+-
T Consensus       168 ~~~t~g~gvDvv~d~v-------------------------gg~~~~~~~~~l~~~G~~v~ig  205 (288)
T smart00829      168 LRATGGRGVDVVLNSL-------------------------AGEFLDASLRCLAPGGRFVEIG  205 (288)
T ss_pred             HHHHCCCCCEEEEECC-------------------------CHHHHHHHHHHHCCCCEEEEEC
T ss_conf             9870898827999898-------------------------6899999999753698899975


No 271
>KOG1596 consensus
Probab=94.14  E-value=0.39  Score=25.61  Aligned_cols=135  Identities=19%  Similarity=0.199  Sum_probs=74.8

Q ss_pred             CCCCCCCEEEEECCCHHHHHHHHHHH-CCCCEEEEEECCHHH----HHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCC
Q ss_conf             89985578999587843899999986-799889999889899----9988999998066452225302004442353100
Q gi|255764482|r    7 VNATGSFHLADLGAGAGAAGLAVASR-LHEAQILLAERSPLM----AHYARKTLALPANAQISKRISLIEVDVTLVGENR   81 (225)
Q Consensus         7 ~~~~~~~~VLDlGcG~G~~~l~la~r-~~~~~v~gvD~~~~~----~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~   81 (225)
                      +-.++|.+||=+|+++|..---++.- -|..-|++||.++..    +++|++.          .++-.+-.|.++.....
T Consensus       152 ihikpGsKVLYLGAasGttVSHvSDiVGpeG~VYAVEfs~rsGRdL~nmAkkR----------tNiiPIiEDArhP~KYR  221 (317)
T KOG1596         152 IHIKPGSKVLYLGAASGTTVSHVSDIVGPEGCVYAVEFSHRSGRDLINMAKKR----------TNIIPIIEDARHPAKYR  221 (317)
T ss_pred             EEECCCCEEEEEECCCCCEEEHHHCCCCCCCEEEEEEECCCCHHHHHHHHHCC----------CCCEEEEECCCCCHHEE
T ss_conf             25358866999633678433300003077743999984355328899876426----------87002450477850035


Q ss_pred             CCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCH---------HH-HH
Q ss_conf             001235765205772265446446547885455652056689899999999862469837870288---------88-99
Q gi|255764482|r   82 NLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARP---------QS-LI  151 (225)
Q Consensus        82 ~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~---------~~-l~  151 (225)
                      .+    -+..|.|++.-+        .|++.+            .+.-.|...||+||.+.+-..+         +. ++
T Consensus       222 ml----VgmVDvIFaDva--------qpdq~R------------ivaLNA~~FLk~gGhfvisikancidstv~ae~vFa  277 (317)
T KOG1596         222 ML----VGMVDVIFADVA--------QPDQAR------------IVALNAQYFLKNGGHFVISIKANCIDSTVFAEAVFA  277 (317)
T ss_pred             EE----EEEEEEEECCCC--------CCHHHH------------HHHHHHHHHHCCCCEEEEEEECCCCCCCCCHHHHHH
T ss_conf             66----105778962689--------703445------------453346665026871899985465444454788899


Q ss_pred             HHH-HHHHCCCCCEEEEEECCCCCC
Q ss_conf             999-985217884699981458969
Q gi|255764482|r  152 QIV-NACARRIGSLEITPLHPREGE  175 (225)
Q Consensus       152 ~~l-~~~~~~~~~~~i~~v~~~~~~  175 (225)
                      ... .+-...+.|.+..-+-|++..
T Consensus       278 ~Ev~klqee~lkP~EqvtLEP~erd  302 (317)
T KOG1596         278 AEVKKLQEEQLKPKEQVTLEPFERD  302 (317)
T ss_pred             HHHHHHHHHCCCCHHEECCCCCCCC
T ss_conf             9999988752680232302532478


No 272
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed
Probab=94.11  E-value=0.4  Score=25.57  Aligned_cols=117  Identities=13%  Similarity=0.036  Sum_probs=72.3

Q ss_pred             HHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC
Q ss_conf             43899855789995878438999999867998899998898999988999998066452225302004442353100001
Q gi|255764482|r    5 SLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA   84 (225)
Q Consensus         5 ~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~   84 (225)
                      ..++.+..++||++|+++|-.++-.....|.+-|+..=-++.-.+.....+....   -..+-.++.++.......    
T Consensus       486 ~~~~~qr~~~vl~l~~~sll~~~~~l~~~peggv~~~~~~~~~~~rL~aQl~lLd---pL~RP~Ll~~~~~~l~~L----  558 (726)
T PRK13341        486 SGITWQRHDRVLNLANRSLLWALEPLRAVPEGGVTVLCESSDDIVRLEAQLDLLD---PLGRPVLLDAGLLALKYL----  558 (726)
T ss_pred             CCCCCCCCCEEEEECCCCHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHCC---HHCCCCEEECCCHHHHHC----
T ss_conf             3366563435998338512652677861899866998378889999999987468---111971121671146537----


Q ss_pred             CCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             2357652057722654464465478854556520566898999999998624698378702
Q gi|255764482|r   85 GLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIA  145 (225)
Q Consensus        85 ~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~  145 (225)
                       .++..||.|++--++-.                .....+.+|......++.|+|++.+..
T Consensus       559 -~~~~~FE~IgGR~~~~~----------------l~~~~~~~~~q~L~~~l~p~g~l~Ll~  602 (726)
T PRK13341        559 -PANLQFEWIGGRNGLDD----------------LLYKADEELWQQLTEKLTPNGGLRLLI  602 (726)
T ss_pred             -CCCCCEEEEECCCCCCC----------------CCHHHHHHHHHHHHHHCCCCCEEEEEE
T ss_conf             -98764247833320023----------------422569999999998659986699863


No 273
>KOG0022 consensus
Probab=93.93  E-value=0.21  Score=27.12  Aligned_cols=49  Identities=14%  Similarity=0.184  Sum_probs=39.4

Q ss_pred             HHCCCCCCCEEEEECCCHHHHHHHHHHH-CCCCEEEEEECCHHHHHHHHH
Q ss_conf             4389985578999587843899999986-799889999889899998899
Q gi|255764482|r    5 SLVNATGSFHLADLGAGAGAAGLAVASR-LHEAQILLAERSPLMAHYARK   53 (225)
Q Consensus         5 ~~~~~~~~~~VLDlGcG~G~~~l~la~r-~~~~~v~gvD~~~~~~~~A~~   53 (225)
                      +.+++++|..|.=.|+|.=.++.+...| ...++++|||++++-.+.|++
T Consensus       186 ~~Akv~~GstvAVfGLG~VGLav~~Gaka~GAsrIIgvDiN~~Kf~~ak~  235 (375)
T KOG0022         186 NTAKVEPGSTVAVFGLGGVGLAVAMGAKAAGASRIIGVDINPDKFEKAKE  235 (375)
T ss_pred             HHCCCCCCCEEEEEECCHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHH
T ss_conf             21346779879999054578899876776186517998558789899876


No 274
>TIGR00478 tly hemolysin A; InterPro: IPR004538 Hemolysins are exotoxins that attack blood cell membranes and cause cell rupture. The mechanism of action is not well defined. Hemolysin A is induced by sodium ribonucleate, and is produced by pathogenic bacterial strains. Hemolysin A from Treponema hyodysenteriae causes swine dysentry.; GO: 0003723 RNA binding, 0019836 hemolysis by symbiont of host red blood cells.
Probab=93.89  E-value=0.094  Score=29.11  Aligned_cols=52  Identities=10%  Similarity=0.105  Sum_probs=39.3

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEEC
Q ss_conf             85578999587843899999986799889999889899998899999806645222530200
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIE   71 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~   71 (225)
                      -++.-|||+|+=+|+++.++.++ ..-+|+|||.....++.--+         .++|+.+.+
T Consensus        76 vk~ki~lD~GsS~GGFtd~aL~~-GAk~VY~vDVG~~ql~~kLR---------~D~Rv~~~e  127 (240)
T TIGR00478        76 VKNKIVLDVGSSTGGFTDCALQK-GAKEVYGVDVGYNQLAEKLR---------QDERVKVLE  127 (240)
T ss_pred             ECCEEEEEECCCCCHHHHHHHHC-CCCEEEEEEECCHHHHHHCC---------CCCEEEEEE
T ss_conf             37868997056730489999870-58467778603213343236---------366268964


No 275
>KOG0822 consensus
Probab=93.88  E-value=0.21  Score=27.15  Aligned_cols=104  Identities=14%  Similarity=0.115  Sum_probs=68.4

Q ss_pred             CCCEEEEECCCHHHHHHH---HHHHC-CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCC
Q ss_conf             557899958784389999---99867-99889999889899998899999806645222530200444235310000123
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLA---VASRL-HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGL   86 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~---la~r~-~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~   86 (225)
                      ...+|.=+|+|-|-+.-+   .|... ...++++||.+|.++-..+. .   .....+.+++++..|.+.+..       
T Consensus       367 ~~tVimvlGaGRGPLv~~~lkaa~~~~RkVklyavEKNPNAivtL~~-~---n~~~W~~~Vtii~~DMR~w~a-------  435 (649)
T KOG0822         367 TTTVIMVLGAGRGPLVDASLKAAEETDRKVKLYAVEKNPNAIVTLQN-R---NFECWDNRVTIISSDMRKWNA-------  435 (649)
T ss_pred             CEEEEEEECCCCCCHHHHHHHHHHHHCCCEEEEEEECCCCHHHHHHH-H---CHHHHCCEEEEEECCCCCCCC-------
T ss_conf             32899996388760788999999872471579999338544042454-2---436546816999343124688-------


Q ss_pred             CCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEE
Q ss_conf             5765205772265446446547885455652056689899999999862469837
Q gi|255764482|r   87 KNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQL  141 (225)
Q Consensus        87 ~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~  141 (225)
                      +.++.|++++.-=-.                ++....-.+-+..+.+.|||.|..
T Consensus       436 p~eq~DI~VSELLGS----------------FGDNELSPECLDG~q~fLkpdgIs  474 (649)
T KOG0822         436 PREQADIIVSELLGS----------------FGDNELSPECLDGAQKFLKPDGIS  474 (649)
T ss_pred             CHHHCCCHHHHHHCC----------------CCCCCCCHHHHHHHHHHCCCCCEE
T ss_conf             444212039976422----------------467667977877788515888557


No 276
>KOG1098 consensus
Probab=93.82  E-value=0.06  Score=30.19  Aligned_cols=119  Identities=15%  Similarity=0.082  Sum_probs=62.9

Q ss_pred             CCCCCEEEEECCCHHHHHHHHHHHCC-CCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC-CC
Q ss_conf             98557899958784389999998679-98899998898999988999998066452225302004442353100001-23
Q gi|255764482|r    9 ATGSFHLADLGAGAGAAGLAVASRLH-EAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA-GL   86 (225)
Q Consensus         9 ~~~~~~VLDlGcG~G~~~l~la~r~~-~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~-~~   86 (225)
                      .+++..|||+||-+|+.....++..| ++-|+|||+-|.-.               -..+.-...||........+. ..
T Consensus        42 l~~a~~vlDLcaAPG~W~QVA~q~~pv~slivGvDl~pikp---------------~~~c~t~v~dIttd~cr~~l~k~l  106 (780)
T KOG1098          42 LEKAHVVLDLCAAPGGWLQVASQSMPVGSLIVGVDLVPIKP---------------IPNCDTLVEDITTDECRSKLRKIL  106 (780)
T ss_pred             CCCCCHHEECCCCCCHHHHHHHHHCCCCCEEEEEEEEECCC---------------CCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             03441110002587479999997678873488752011246---------------876321454642888888999998


Q ss_pred             CCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEE-ECCHHH
Q ss_conf             576520577226544644654788545565205668989999999986246983787-028888
Q gi|255764482|r   87 KNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSL-IARPQS  149 (225)
Q Consensus        87 ~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~-i~~~~~  149 (225)
                      ..-..|+|+..---+.++.      ....|....... -.-+..|...|.-||++.- ++|++-
T Consensus       107 ~t~~advVLhDgapnVg~~------w~~DA~~q~~L~-l~al~LA~~~l~~~g~fvtkvfrs~d  163 (780)
T KOG1098         107 KTWKADVVLHDGAPNVGGN------WVQDAFQQACLT-LRALKLATEFLAKGGTFVTKVFRSED  163 (780)
T ss_pred             HHCCCCEEEECCCCCCCHH------HHHHHHHHHHHH-HHHHHHHHHHHHHCCCCCCCCCCCCC
T ss_conf             7277767840588864316------789999867889-99999999999746843044556776


No 277
>PRK11760 putative RNA 2'-O-ribose methyltransferase; Provisional
Probab=93.75  E-value=0.18  Score=27.54  Aligned_cols=71  Identities=13%  Similarity=0.172  Sum_probs=50.5

Q ss_pred             CCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCC
Q ss_conf             98557899958784389999998679988999988989999889999980664522253020044423531000012357
Q gi|255764482|r    9 ATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKN   88 (225)
Q Consensus         9 ~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~   88 (225)
                      ..+|.+.+|+|+-.|+.+-.|.+|  +..|++||.-+-.-.+.           .+.+++....|-+.+..       ..
T Consensus       208 l~~Gm~aVDLGAaPGGWT~qLv~r--g~~V~AVDnG~m~~~L~-----------~~~~V~H~~~dgf~f~P-------~~  267 (356)
T PRK11760        208 LASGMRAVDLGACPGGWTYQLVRR--GMFVTAVDNGPMAESLM-----------DTGQVEHLRADGFKFRP-------TR  267 (356)
T ss_pred             CCCCCEEEECCCCCCHHHHHHHHC--CCEEEEECCCCCCHHHH-----------CCCCEEEEECCCEEECC-------CC
T ss_conf             169975875586997058999977--98899865876787575-----------28875788146705636-------99


Q ss_pred             CCCCEEEECCC
Q ss_conf             65205772265
Q gi|255764482|r   89 NFYDHVIMNPP   99 (225)
Q Consensus        89 ~~fDlii~nPP   99 (225)
                      ..+|.++|..-
T Consensus       268 ~~vdwlVCDmv  278 (356)
T PRK11760        268 KNVDWLVCDMV  278 (356)
T ss_pred             CCEEEEEEECC
T ss_conf             85208997053


No 278
>KOG3987 consensus
Probab=93.68  E-value=0.0085  Score=34.98  Aligned_cols=42  Identities=31%  Similarity=0.393  Sum_probs=35.0

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHH
Q ss_conf             85578999587843899999986799889999889899998899
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARK   53 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~   53 (225)
                      +...++||+|+|.|-++..++-.+.  +|++.|.|..|....++
T Consensus       111 ~~~~~lLDlGAGdGeit~~m~p~fe--evyATElS~tMr~rL~k  152 (288)
T KOG3987         111 QEPVTLLDLGAGDGEITLRMAPTFE--EVYATELSWTMRDRLKK  152 (288)
T ss_pred             CCCEEEEECCCCCCCHHHHHCCHHH--HHHHHHHHHHHHHHHHH
T ss_conf             9870688616788610012142189--99998766999999865


No 279
>PRK07102 short chain dehydrogenase; Provisional
Probab=93.63  E-value=0.49  Score=25.06  Aligned_cols=85  Identities=16%  Similarity=0.118  Sum_probs=56.6

Q ss_pred             CEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             789995878438999999867--998899998898999988999998066452225302004442353100001235765
Q gi|255764482|r   13 FHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNF   90 (225)
Q Consensus        13 ~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~   90 (225)
                      .+||=.|+++| ++..+|+++  .+++|+.++.+++.++...+.+...+    ...+.....|+.+............+.
T Consensus         2 K~vlITGassG-IG~a~A~~la~~G~~v~l~~R~~~~l~~~~~~l~~~~----~~~~~~~~~D~~~~~~~~~~~~~~~~~   76 (243)
T PRK07102          2 KKILIIGATSD-IARACARRYAAAGARLYLAARDTERLERIAADLEARG----AVAVATHELDILDTARHAAFLDNLPAL   76 (243)
T ss_pred             CEEEEECCCHH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC----CCEEEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             97999157459-9999999999879989999898899999999998535----862899843403699999999998753


Q ss_pred             CCEEEECCCCCC
Q ss_conf             205772265446
Q gi|255764482|r   91 YDHVIMNPPFNE  102 (225)
Q Consensus        91 fDlii~nPPy~~  102 (225)
                      +|.++.|.-+..
T Consensus        77 ~d~~v~~aG~~~   88 (243)
T PRK07102         77 PDTVLIAVGTLG   88 (243)
T ss_pred             CCEEEEEEECCC
T ss_conf             797999730367


No 280
>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion]
Probab=93.48  E-value=0.36  Score=25.84  Aligned_cols=49  Identities=20%  Similarity=0.253  Sum_probs=38.7

Q ss_pred             HHCCCCCCCEEEEECCCH-HHHHHHHHHHCCCCEEEEEECCHHHHHHHHH
Q ss_conf             438998557899958784-3899999986799889999889899998899
Q gi|255764482|r    5 SLVNATGSFHLADLGAGA-GAAGLAVASRLHEAQILLAERSPLMAHYARK   53 (225)
Q Consensus         5 ~~~~~~~~~~VLDlGcG~-G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~   53 (225)
                      +.+++++|+.|.=+|||. |...+.-|......+++++|+++.-.+.|++
T Consensus       179 nta~v~~G~tvaV~GlGgVGlaaI~gA~~agA~~IiAvD~~~~Kl~~A~~  228 (366)
T COG1062         179 NTAKVEPGDTVAVFGLGGVGLAAIQGAKAAGAGRIIAVDINPEKLELAKK  228 (366)
T ss_pred             HCCCCCCCCEEEEEECCHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHH
T ss_conf             10468999848999042766999998987488549999377789999986


No 281
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=93.35  E-value=0.54  Score=24.79  Aligned_cols=124  Identities=15%  Similarity=0.081  Sum_probs=71.9

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---C
Q ss_conf             55789995878438999999867--998899998898999988999998066452225302004442353100001---2
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---G   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---~   85 (225)
                      +|.++|=-|++.| ++..+|+++  .+++|+.++.+++.++.+.+.+...      .++.....|+.+........   .
T Consensus         4 ~gK~~lVTGas~G-IG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~~l~~~------g~~~~~~~Dvs~~~~v~~~~~~~~   76 (238)
T PRK05786          4 KGKNVLIVGVSPG-LGYAVAYFALREGASVYAFARSEEKLKEIKKTLAKY------GNVIYVVGDVSKLEGAREAAEKAA   76 (238)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHCC------CCEEEEECCCCCHHHHHHHHHHHH
T ss_conf             9988999289878-999999999987999999969889999999987435------977999757899999999999999


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCC--CHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             3576520577226544644654788545565205668--9899999999862469837870
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLED--SFEKWIRTACAIMRSSGQLSLI  144 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~--~~~~~~~~a~~lLkpgG~~~~i  144 (225)
                      ...+..|.++.|.-.+..........   .......+  ......+.+..++++||...++
T Consensus        77 ~~~g~iD~lv~naG~~~~~~~~~~~~---~~~~~~~nl~~~~~~~~~~~~~m~~g~~ii~i  134 (238)
T PRK05786         77 KVFGALHGLVVTAGGYIEDTVEELAG---LEDMLNNHLKAPLYAVNASLPLLREGSSIVLV  134 (238)
T ss_pred             HHHCCCCEEEEECCCCCCCCHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEE
T ss_conf             98399887998057567885231899---99999998589999999999974216779999


No 282
>pfam03492 Methyltransf_7 SAM dependent carboxyl methyltransferase. This family of plant methyltransferases contains enzymes that act on a variety of substrates including salicylic acid, jasmonic acid and 7-Methylxanthine. Caffeine is synthesized through sequential three-step methylation of xanthine derivatives at positions 7-N, 3-N, and 1-N. The protein 7-methylxanthine methyltransferase (designated as CaMXMT) catalyses the second step to produce theobromine.
Probab=92.87  E-value=0.65  Score=24.37  Aligned_cols=23  Identities=30%  Similarity=0.520  Sum_probs=18.7

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHH
Q ss_conf             85578999587843899999986
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASR   32 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r   32 (225)
                      .+.-+|.|+||-+|..++.+...
T Consensus        15 p~~~~IADlGCSsGpNtl~~vs~   37 (331)
T pfam03492        15 PNSIKIADLGCSSGPNTFLAVSN   37 (331)
T ss_pred             CCCEEEEEECCCCCHHHHHHHHH
T ss_conf             98559998179997528999999


No 283
>KOG2651 consensus
Probab=92.81  E-value=0.12  Score=28.53  Aligned_cols=41  Identities=20%  Similarity=0.219  Sum_probs=34.7

Q ss_pred             CCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHH
Q ss_conf             578999587843899999986799889999889899998899
Q gi|255764482|r   12 SFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARK   53 (225)
Q Consensus        12 ~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~   53 (225)
                      -..|.|+|+|.|.++-+++-.+ +..|+|||-|....+.|++
T Consensus       154 i~~vvD~GaG~G~LSr~lSl~y-~lsV~aIegsq~~~~ra~r  194 (476)
T KOG2651         154 IDQVVDVGAGQGHLSRFLSLGY-GLSVKAIEGSQRLVERAQR  194 (476)
T ss_pred             CCHHHCCCCCCCHHHHHHHHCC-CCEEEEECCCHHHHHHHHH
T ss_conf             7114115777328999986426-8169996463688999998


No 284
>PRK10754 quinone oxidoreductase, NADPH-dependent; Provisional
Probab=92.46  E-value=0.73  Score=24.06  Aligned_cols=104  Identities=13%  Similarity=0.040  Sum_probs=60.8

Q ss_pred             HHHCCCCCCCEEEEE-CC-CHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCC
Q ss_conf             243899855789995-87-8438999999867998899998898999988999998066452225302004442353100
Q gi|255764482|r    4 ASLVNATGSFHLADL-GA-GAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENR   81 (225)
Q Consensus         4 a~~~~~~~~~~VLDl-Gc-G~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~   81 (225)
                      ....+.+++++||=. |+ |.|...+.+|+.. +++|++++.+++-.+.+++    .+..   .-+.....|+..     
T Consensus       133 ~~~~~~~~g~~vLi~gaaGgVG~~avQlAk~~-Ga~Vi~t~~s~~k~e~~~~----lGA~---~vi~~~~~~~~~-----  199 (327)
T PRK10754        133 RKTYEIKPDEQFLFHAAAGGVGLIACQWAKAL-GAKLIGTVGSAQKAQRALK----AGAW---QVINYREENIVE-----  199 (327)
T ss_pred             HHCCCCCCCCEEEEECCCCCCCHHHHHHHHHC-CCEEEEEECCHHHHHHHHH----CCCC---EEEECCCCCHHH-----
T ss_conf             53137899999999817761126899999986-9999999898999999996----6999---999899999999-----


Q ss_pred             CCCCCC-CCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             001235-7652057722654464465478854556520566898999999998624698378702
Q gi|255764482|r   82 NLAGLK-NNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIA  145 (225)
Q Consensus        82 ~~~~~~-~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~  145 (225)
                      ...... ...+|.++-.-                         -...+..+.+.|+++|++..+-
T Consensus       200 ~i~~~t~g~gvdvv~D~v-------------------------G~~~~~~~~~~l~~~G~iv~~G  239 (327)
T PRK10754        200 RVKEITGGKKVRVVYDSV-------------------------GKDTWEASLDCLQRRGLMVSFG  239 (327)
T ss_pred             HHHHHHCCCCCEEEEECC-------------------------CHHHHHHHHHHHHCCCEEEEEE
T ss_conf             999986899836999898-------------------------8899999999863498999980


No 285
>PRK06125 short chain dehydrogenase; Provisional
Probab=92.08  E-value=0.82  Score=23.79  Aligned_cols=126  Identities=15%  Similarity=0.111  Sum_probs=73.7

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCC
Q ss_conf             55789995878438999999867--9988999988989999889999980664522253020044423531000012357
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKN   88 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~   88 (225)
                      +|.++|=-|.+.| ++..+|+++  .+++|+.++.+.+.++.+.+.+....    ..++.....|+........... ..
T Consensus         6 ~gK~alITG~s~G-IG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~~l~~~~----~~~~~~~~~D~~~~~~~~~~~~-~~   79 (259)
T PRK06125          6 AGKRVLITGASKG-IGAAAAEAFAAEGCHLVLAARDADALAALAADLRAAH----GVDVAVHALDLSSPEAREQLAA-EA   79 (259)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHC----CCCEEEEECCCCCHHHHHHHHH-HH
T ss_conf             9998999687768-9999999999879989999798899999999998700----9866999888999999999999-85


Q ss_pred             CCCCEEEECCCCCCCCCCCCCCHH--HHHHHCCCCCCHHHHHHHHHHHCCCC--CEEEE
Q ss_conf             652057722654464465478854--55652056689899999999862469--83787
Q gi|255764482|r   89 NFYDHVIMNPPFNERIGTMTPDKI--KEEAHVMLEDSFEKWIRTACAIMRSS--GQLSL  143 (225)
Q Consensus        89 ~~fDlii~nPPy~~~~~~~~~~~~--~~~a~~~~~~~~~~~~~~a~~lLkpg--G~~~~  143 (225)
                      +..|.++.|-.....+.....+..  ....... ......+.+.+...++..  |++..
T Consensus        80 g~iDiLVnnAG~~~~~~~~~~~~~~w~~~~~vn-l~~~~~l~~~~~p~m~~~~~G~Iin  137 (259)
T PRK06125         80 GDIDILVNNAGAIPGGSLDDVDDAAWRAGWELK-VFGYINLTRLFYPRMKARGSGVIVN  137 (259)
T ss_pred             CCCCEEEECCCCCCCCCCCCCCHHHHHHHHHHH-HHHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             899899976877899864549999999999986-3437889999999765349819999


No 286
>pfam11899 DUF3419 Protein of unknown function (DUF3419). This family of proteins are functionally uncharacterized. This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 398 to 802 amino acids in length.
Probab=91.84  E-value=0.61  Score=24.53  Aligned_cols=47  Identities=11%  Similarity=0.089  Sum_probs=35.4

Q ss_pred             HCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHH
Q ss_conf             3899855789995878438999999867998899998898999988999
Q gi|255764482|r    6 LVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKT   54 (225)
Q Consensus         6 ~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n   54 (225)
                      ..+..++++||=|++| |+..+.+....| .+|++||+||..+++.+--
T Consensus        30 ~L~~~~~d~vl~I~s~-G~n~l~yl~~~p-~~i~aVDlN~~q~~Ll~LK   76 (376)
T pfam11899        30 ALNLGPDDTVLAITSA-GCNALSYLTAGP-ARVHAVDLNPAQNALLELK   76 (376)
T ss_pred             HHCCCCCCEEEEEECC-CHHHHHHHHCCC-CEEEEEECCHHHHHHHHHH
T ss_conf             8489999979998377-435999762697-7689984899999999999


No 287
>pfam07757 AdoMet_MTase Predicted AdoMet-dependent methyltransferase. Proteins in this family have been predicted to function as AdoMet-dependent methyltransferases.
Probab=91.79  E-value=0.12  Score=28.54  Aligned_cols=32  Identities=19%  Similarity=0.153  Sum_probs=24.0

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECC
Q ss_conf             5578999587843899999986799889999889
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRLHEAQILLAERS   44 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~   44 (225)
                      +.....|+|||+|.+.-.|...  +..-.|+|.-
T Consensus        58 ~~~~FvDlGCGNGlLV~IL~~E--Gy~G~GiD~R   89 (112)
T pfam07757        58 SLQSFVDIGCGNGLLVYILASE--GYRGYGIDLR   89 (112)
T ss_pred             CCCCEEEECCCCHHHHHHHHHC--CCCCCCCCCC
T ss_conf             7885377147722899989867--8877331410


No 288
>KOG4174 consensus
Probab=91.35  E-value=0.99  Score=23.33  Aligned_cols=129  Identities=16%  Similarity=0.175  Sum_probs=77.4

Q ss_pred             CCCCCCEEEEECCCHHHHHHHHHHHCC--CCEEEEEECCHHHHH------HHHHHHHHHCCCCCCCCCEEECCCCCCCCC
Q ss_conf             998557899958784389999998679--988999988989999------889999980664522253020044423531
Q gi|255764482|r    8 NATGSFHLADLGAGAGAAGLAVASRLH--EAQILLAERSPLMAH------YARKTLALPANAQISKRISLIEVDVTLVGE   79 (225)
Q Consensus         8 ~~~~~~~VLDlGcG~G~~~l~la~r~~--~~~v~gvD~~~~~~~------~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~   79 (225)
                      +-.+..+||.+|=|-=.++..++..+.  ...+++..+|..-.+      -++.|+......+.   .-+...|+.....
T Consensus        53 ~~s~~~~ill~gEgdFSfs~sl~~~~g~sa~ni~atSlDsk~~dl~~KY~~~~~nv~~Lk~lG~---~I~h~Vdv~sl~~  129 (282)
T KOG4174          53 PYSKKQKILLVGEGDFSFSLSLAPHFGRSAGNITATSLDSKEFDLKQKYPDAKENVEALKRLGG---TILHGVDVTSLKF  129 (282)
T ss_pred             ECCCCCCEEEECCCCHHHHHHHHHHHCCCCCCEEEEECCCHHHHHHHCCCCHHHHHHHHHHCCC---CEEECCCCEEEEE
T ss_conf             0466353799626632567888987474444245420010233420226664889999998199---2572013425773


Q ss_pred             CCCCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCC-CCCEEEEEC
Q ss_conf             000012357652057722654464465478854556520566898999999998624-698378702
Q gi|255764482|r   80 NRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMR-SSGQLSLIA  145 (225)
Q Consensus        80 ~~~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLk-pgG~~~~i~  145 (225)
                      ..   ....+.||-|+-|.|+...+- . .+.... ...........|++.|..+|+ ..|.+.+.+
T Consensus       130 ~~---~~~~~~~d~IiFNFPH~G~g~-~-~e~d~~-~i~~~qkL~rgFle~akemL~~edGeI~itl  190 (282)
T KOG4174         130 HA---DLRLQRYDNIIFNFPHSGKGI-K-FEQDRN-IIPLHQKLFRGFLESAKEMLKDEDGEIHITL  190 (282)
T ss_pred             CC---CCCCCCCCEEEECCCCCCCCC-C-CCCCHH-HHHHHHHHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             32---013451015898178788775-4-211137-7899999999999999998773278289986


No 289
>PRK05876 short chain dehydrogenase; Provisional
Probab=91.33  E-value=0.99  Score=23.31  Aligned_cols=90  Identities=19%  Similarity=0.080  Sum_probs=60.0

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC---CC
Q ss_conf             55789995878438999999867--99889999889899998899999806645222530200444235310000---12
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL---AG   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~---~~   85 (225)
                      +|..++=-|+++|. +..+|+++  .+++|+-.|++++.++.+.+.+...+.     .+..+..|+.+......+   ..
T Consensus         5 ~gKvavITGaasGI-G~a~A~~la~~Ga~Vvi~d~~~~~l~~~~~~l~~~g~-----~~~~~~~Dvt~~~~v~~l~~~~~   78 (275)
T PRK05876          5 PGRGAVITGGASGI-GLATGTEFARRGARVVLGDVDKPGLRQAVNHLRAEGF-----DVHGVMCDVRHREEVTHLADEAF   78 (275)
T ss_pred             CCCEEEEECCCCHH-HHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCC-----CEEEEECCCCCHHHHHHHHHHHH
T ss_conf             99879992826699-9999999998799899997988999999999982698-----47999788899999999999999


Q ss_pred             CCCCCCCEEEECCCCCCCCCC
Q ss_conf             357652057722654464465
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIGT  106 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~~  106 (225)
                      ..-+..|+++.|.-....+..
T Consensus        79 ~~~G~iDilvnNAGi~~~~~~   99 (275)
T PRK05876         79 RLLGHVDVVFSNAGIVVGGPI   99 (275)
T ss_pred             HHHCCCCEEECCCCCCCCCCC
T ss_conf             984898851215744689872


No 290
>KOG2782 consensus
Probab=91.24  E-value=0.17  Score=27.58  Aligned_cols=89  Identities=13%  Similarity=0.176  Sum_probs=58.0

Q ss_pred             HHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC
Q ss_conf             43899855789995878438999999867998899998898999988999998066452225302004442353100001
Q gi|255764482|r    5 SLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA   84 (225)
Q Consensus         5 ~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~   84 (225)
                      .+..+.+|...+|.--|+|..+-.+.++.+...+++.|.||-+.++|+......    ...++...-+.+-.......-.
T Consensus        37 ~~lspv~g~sf~DmTfGagGHt~~ilqk~se~k~yalDrDP~A~~La~~~s~el----~~~~l~a~Lg~Fs~~~~l~~~~  112 (303)
T KOG2782          37 DILSPVRGRSFVDMTFGAGGHTSSILQKHSELKNYALDRDPVARKLAHFHSDEL----MHPTLKAVLGNFSYIKSLIADT  112 (303)
T ss_pred             HHCCCCCCCEEEEEECCCCCCHHHHHHHCCHHHHHHHCCCHHHHHHHHHHHHHH----CCHHHHHHHHHHHHHHHHHHHH
T ss_conf             872777886478875057742078887472766400045868999998755755----1466999985167779999981


Q ss_pred             CCCCCCCCEEEEC
Q ss_conf             2357652057722
Q gi|255764482|r   85 GLKNNFYDHVIMN   97 (225)
Q Consensus        85 ~~~~~~fDlii~n   97 (225)
                      ...+..+|-|+..
T Consensus       113 gl~~~~vDGiLmD  125 (303)
T KOG2782         113 GLLDVGVDGILMD  125 (303)
T ss_pred             CCCCCCCCEEEEE
T ss_conf             8775775548760


No 291
>KOG2920 consensus
Probab=91.22  E-value=0.16  Score=27.74  Aligned_cols=39  Identities=13%  Similarity=0.201  Sum_probs=30.7

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHH
Q ss_conf             8557899958784389999998679988999988989999
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAH   49 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~   49 (225)
                      -.+.+|||+|||+|.-.+.+.... ...+...|.+.+.+.
T Consensus       115 ~~~k~vLELgCg~~Lp~i~~~~~~-~~~~~fqD~na~vl~  153 (282)
T KOG2920         115 FSGKRVLELGCGAALPGIFAFVKG-AVSVHFQDFNAEVLR  153 (282)
T ss_pred             ECCCEEEECCCCCCCCCHHHHHHC-CCEEEEEECCHHHEE
T ss_conf             447556863786456416666403-532334733511246


No 292
>PRK08507 prephenate dehydrogenase; Validated
Probab=91.17  E-value=1  Score=23.22  Aligned_cols=40  Identities=13%  Similarity=0.064  Sum_probs=28.0

Q ss_pred             EEEEECCCHHHHHHHHH--HHCCCCEEEEEECCHHHHHHHHH
Q ss_conf             89995878438999999--86799889999889899998899
Q gi|255764482|r   14 HLADLGAGAGAAGLAVA--SRLHEAQILLAERSPLMAHYARK   53 (225)
Q Consensus        14 ~VLDlGcG~G~~~l~la--~r~~~~~v~gvD~~~~~~~~A~~   53 (225)
                      +|.=+|+|-=+-|+++|  ++....+|+|+|.|+..++.|.+
T Consensus         2 ~I~IiGlGLiGgSla~alk~~~~~~~V~g~d~~~~~~~~A~~   43 (275)
T PRK08507          2 KIGIIGLGLMGGSLGLALKENKLISCVYGYDHNEEHEKDALD   43 (275)
T ss_pred             EEEEEECCHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHH
T ss_conf             899990087899999999950998679999599999999998


No 293
>PRK06139 short chain dehydrogenase; Provisional
Probab=90.96  E-value=1.1  Score=23.10  Aligned_cols=161  Identities=14%  Similarity=0.085  Sum_probs=86.5

Q ss_pred             CCCCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC---
Q ss_conf             9855789995878438999999867--99889999889899998899999806645222530200444235310000---
Q gi|255764482|r    9 ATGSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL---   83 (225)
Q Consensus         9 ~~~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~---   83 (225)
                      .-+|+.|+=-|+++|. +..+|+++  .+++|+.++.+++.++.+.+.++..+     .++..+..|+.+.......   
T Consensus         3 ~L~gKvvlITGASsGI-G~aiA~~~A~~Ga~Vvl~~R~~~~L~~~a~e~~~~G-----~~~~~v~~DVsd~~~v~~~~~~   76 (324)
T PRK06139          3 PLHGAVVVITGASSGI-GRATAEAFARRGARLVLAARDEEALFEVAEECRALG-----AEVLVVPTDVTHADQVQALATQ   76 (324)
T ss_pred             CCCCCEEEEECHHHHH-HHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC-----CCEEEEECCCCCHHHHHHHHHH
T ss_conf             8599779993825499-999999999879989999899999999999999549-----9489997667885789999999


Q ss_pred             CCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCH--HHHHHHHHHHCCCC--CEEEEEC--------C-----
Q ss_conf             12357652057722654464465478854556520566898--99999999862469--8378702--------8-----
Q gi|255764482|r   84 AGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSF--EKWIRTACAIMRSS--GQLSLIA--------R-----  146 (225)
Q Consensus        84 ~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~--~~~~~~a~~lLkpg--G~~~~i~--------~-----  146 (225)
                      .....+..|+++.|.-....+.....+.... .+....+..  ....+.+...++..  |.+..+-        |     
T Consensus        77 ~~~~~G~IDiLVNNAGi~~~g~~~e~~~e~~-~~vi~vNl~G~~~~~~aalp~M~~~g~G~IINisS~ag~~~~P~~saY  155 (324)
T PRK06139         77 AASFLGRIDVWFNNVGVGAVGRFEETPLEAH-EQVIQTNLIGYLRDAHAALPIFKAQGHGIFINMISLGGFAAQPYAAAY  155 (324)
T ss_pred             HHHHCCCCCEEEECCCCCCCCCCCCCCHHHH-HHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHHCCCCCCCHH
T ss_conf             9997499878864575577775355999999-999999869999999999999986599189997363241369998419


Q ss_pred             -H-----HHHHHHHHHHHCCCCCEEEEEECC-CCCCC
Q ss_conf             -8-----889999998521788469998145-89698
Q gi|255764482|r  147 -P-----QSLIQIVNACARRIGSLEITPLHP-REGEC  176 (225)
Q Consensus       147 -~-----~~l~~~l~~~~~~~~~~~i~~v~~-~~~~~  176 (225)
                       +     ..+.+-+..--.....++++-|+| ..+.|
T Consensus       156 ~ASK~Av~gftesLr~EL~~~~gI~Vt~V~Pg~v~TP  192 (324)
T PRK06139        156 SASKFGLRGFSEALRAELTDFPDIHVCDVYPAFVDTP  192 (324)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCC
T ss_conf             8999999999999999837998918999857995885


No 294
>PRK09186 flagellin modification protein A; Provisional
Probab=90.53  E-value=1.2  Score=22.87  Aligned_cols=83  Identities=14%  Similarity=0.135  Sum_probs=56.6

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---C
Q ss_conf             55789995878438999999867--998899998898999988999998066452225302004442353100001---2
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---G   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---~   85 (225)
                      +|..+|=-|++.| ++..+|+++  .+++|+..|++.+..+.+.+.+....    ..++.++++|+.+......+.   .
T Consensus         3 ~gK~~lVTGgs~G-IG~aia~~la~~Ga~V~~~~~~~~~~~~~~~~l~~~~----~~~v~~~~~Dvt~~~~v~~~~~~~~   77 (255)
T PRK09186          3 EGKTILITGAGGL-IGSALVKAILEAGGIVIAADINKEALNKLLESLGTIE----KTKLTLVELDITDQESLEEFLSKSQ   77 (255)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHC----CCEEEEEECCCCCHHHHHHHHHHHH
T ss_conf             9598999795868-9999999999879999999698899999999998705----9807999846899999999999999


Q ss_pred             CCCCCCCEEEECC
Q ss_conf             3576520577226
Q gi|255764482|r   86 LKNNFYDHVIMNP   98 (225)
Q Consensus        86 ~~~~~fDlii~nP   98 (225)
                      ...+..|.++.|.
T Consensus        78 ~~~g~id~lVnnA   90 (255)
T PRK09186         78 ERYGKIDGAVNCA   90 (255)
T ss_pred             HHHCCCCEEEECC
T ss_conf             9819977899757


No 295
>PRK06101 short chain dehydrogenase; Provisional
Probab=90.39  E-value=1.2  Score=22.81  Aligned_cols=120  Identities=16%  Similarity=0.102  Sum_probs=62.6

Q ss_pred             EEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             89995878438999999867--9988999988989999889999980664522253020044423531000012357652
Q gi|255764482|r   14 HLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFY   91 (225)
Q Consensus        14 ~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~f   91 (225)
                      .||=-|+++|. +..+|+++  .+++|+.++.+++.++.....         ...+.....|+.+...............
T Consensus         3 tvlITGassGI-G~a~A~~la~~G~~Vi~~~R~~~~l~~~~~~---------~~~~~~~~~Dvtd~~~~~~~~~~~~~~~   72 (241)
T PRK06101          3 SVLITGATSGI-GKQLALDYAKAGWKVIACGRNEAVLDELHDQ---------SSNIFTLAFDVTDYEETKAALSQLPFIP   72 (241)
T ss_pred             EEEEECCCHHH-HHHHHHHHHHCCCEEEEEECCHHHHHHHHHH---------CCCEEEEEEECCCHHHHHHHHHHHCCCC
T ss_conf             89992240499-9999999998799899998999999999973---------2880489852267999999999718777


Q ss_pred             CEEEECCCCCCCCCCCCCCHHHHHHHCCCCCC--HHHHHHHHHHHCCCCCEEEEE
Q ss_conf             05772265446446547885455652056689--899999999862469837870
Q gi|255764482|r   92 DHVIMNPPFNERIGTMTPDKIKEEAHVMLEDS--FEKWIRTACAIMRSSGQLSLI  144 (225)
Q Consensus        92 Dlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~--~~~~~~~a~~lLkpgG~~~~i  144 (225)
                      |.++.|............+... ..+....+.  ....++.+...++.||+..++
T Consensus        73 d~~i~naG~~~~~~~~~~~~~~-~~~~~~vN~~g~~~~~~~~~p~m~~~~~iv~i  126 (241)
T PRK06101         73 ELWIFNAGDCEYMDDGIVDAQL-MARVFNVNVVGVANCIEACQPHFQRGHRVVIV  126 (241)
T ss_pred             CEEEECCCCCCCCCCCCCCHHH-HHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEE
T ss_conf             7899988666768734489999-99999998899999999999998738950577


No 296
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated
Probab=90.30  E-value=1.2  Score=22.76  Aligned_cols=128  Identities=19%  Similarity=0.067  Sum_probs=72.1

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCC---
Q ss_conf             55789995878438999999867--9988999988989999889999980664522253020044423531000012---
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAG---   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~---   85 (225)
                      +|..+|=-|++.| ++..+|..+  .+++|+-.+.+.+.++.+.+.+...+     .++...++|+.+......+..   
T Consensus        10 ~gKvalVTGas~G-IG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~l~~~g-----~~~~~~~~Dv~~~~~~~~~v~~~~   83 (255)
T PRK06113         10 DGKCAIITGAGAG-IGKEIAITFATAGASVVVSDINADAANHVVDEIQQLG-----GQAFACRCDITSEQELSALADFAV   83 (255)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC-----CEEEEEECCCCCHHHHHHHHHHHH
T ss_conf             9998999588778-9999999999879999999698899999999999659-----908999836899999999999999


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCC--CCEEEEE
Q ss_conf             3576520577226544644654788545565205668989999999986246--9837870
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRS--SGQLSLI  144 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkp--gG~~~~i  144 (225)
                      ...+..|.++.|.-...........................+.+.+...++.  +|++..+
T Consensus        84 ~~~G~iDilVnNAG~~~~~~~d~~~~~~~~~~~~Nl~~~~~~~~~~~p~m~~~~~G~IIni  144 (255)
T PRK06113         84 SKLGKVDILVNNAGGGGPKPFDMPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTI  144 (255)
T ss_pred             HHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             9819988999878878998775999999999999649999999999998887189679998


No 297
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed
Probab=89.57  E-value=1.4  Score=22.42  Aligned_cols=128  Identities=16%  Similarity=0.083  Sum_probs=72.3

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---C
Q ss_conf             55789995878438999999867--998899998898999988999998066452225302004442353100001---2
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---G   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---~   85 (225)
                      +|..+|=.|.+.| ++..+|+++  .+++|+.++.++..++.+.+.++..+     .++....+|+.+........   .
T Consensus         5 ~gK~alITGgs~G-IG~aia~~la~~G~~V~~~~r~~~~~~~~~~~l~~~g-----~~~~~~~~Dl~~~~~~~~~~~~~~   78 (253)
T PRK12826          5 MGRVALVTGAARG-IGRAIAVRFAADGADVIVVDICGQAAAATAELVAAAG-----GKARAYQVDVRDRAALKALVAAGV   78 (253)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHC-----CCEEEEEEECCCHHHHHHHHHHHH
T ss_conf             9988999489778-9999999999879989999898899999999998509-----958999951799999999999999


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCC-CCCCHHHHHHHHHHHCCC--CCEEEEE
Q ss_conf             3576520577226544644654788545565205-668989999999986246--9837870
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVM-LEDSFEKWIRTACAIMRS--SGQLSLI  144 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~-~~~~~~~~~~~a~~lLkp--gG~~~~i  144 (225)
                      ...+..|.++.|............+......... .......+.+.+...++.  +|++..+
T Consensus        79 ~~~g~iD~lvnnAg~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m~~~~~G~II~i  140 (253)
T PRK12826         79 ERFGRLDILVANAGIFPLTPFAELDDEDWDRVIDVNLTGTFLLTQAALPALKRAGGGRIVLT  140 (253)
T ss_pred             HHHCCCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             98399878998998899998155999999999998756664337874699997699769999


No 298
>PRK07024 short chain dehydrogenase; Provisional
Probab=89.56  E-value=1.4  Score=22.42  Aligned_cols=83  Identities=23%  Similarity=0.183  Sum_probs=55.1

Q ss_pred             CCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---CC
Q ss_conf             5789995878438999999867--998899998898999988999998066452225302004442353100001---23
Q gi|255764482|r   12 SFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---GL   86 (225)
Q Consensus        12 ~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---~~   86 (225)
                      .++||=.|+.+|. +..+|+++  .+++|+.++.+.+.++...+.+.       ..++.....|+.+........   ..
T Consensus         2 ~~~VlITGassGI-G~a~A~~la~~G~~v~l~~R~~~~L~~~~~~~~-------~~~~~~~~~Dv~d~~~~~~~~~~~~~   73 (256)
T PRK07024          2 PLKVFITGASSGI-GQALAREYARQGATLGLVARRTDALQAFAARLP-------KARVSVYAADVRDADALAAAAADFIA   73 (256)
T ss_pred             CCEEEEECCCHHH-HHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCC-------CCCEEEEEECCCCHHHHHHHHHHHHH
T ss_conf             9989998460299-999999999889989999898899999999767-------99769998117999999999999999


Q ss_pred             CCCCCCEEEECCCCCC
Q ss_conf             5765205772265446
Q gi|255764482|r   87 KNNFYDHVIMNPPFNE  102 (225)
Q Consensus        87 ~~~~fDlii~nPPy~~  102 (225)
                      ..+..|+++.|.-+..
T Consensus        74 ~~g~iDilinNAGi~~   89 (256)
T PRK07024         74 AHGCPDVVIANAGISV   89 (256)
T ss_pred             HHCCCCEEEECCCCCC
T ss_conf             8399879998885567


No 299
>PRK05866 short chain dehydrogenase; Provisional
Probab=89.54  E-value=1.4  Score=22.41  Aligned_cols=85  Identities=16%  Similarity=0.135  Sum_probs=58.0

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---C
Q ss_conf             55789995878438999999867--998899998898999988999998066452225302004442353100001---2
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---G   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---~   85 (225)
                      +|..||=-|+++|. +..+|+++  .+++|+.++.+++.++...+.+...+     ..+..+..|+.+......+.   .
T Consensus        39 ~GKvaLITGassGI-G~aiA~~la~~Ga~Vvl~~R~~~~l~~~~~~i~~~g-----~~~~~~~~Dvtd~~~v~~~v~~~~  112 (290)
T PRK05866         39 TGKRILLTGASSGI-GEAAAEKFARRGATVVAVARRKDLLDAVADRITAAG-----GDAMAIPCDLSDLDAVDALVADVE  112 (290)
T ss_pred             CCCEEEECCCCCHH-HHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC-----CEEEEEECCCCCHHHHHHHHHHHH
T ss_conf             99989990813099-999999999869989999899999999999999649-----908999778898999999999999


Q ss_pred             CCCCCCCEEEECCCCC
Q ss_conf             3576520577226544
Q gi|255764482|r   86 LKNNFYDHVIMNPPFN  101 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~  101 (225)
                      ...+..|..+.|--..
T Consensus       113 ~~~G~iDiLVNNAG~~  128 (290)
T PRK05866        113 ERIGGVDILINNAGRS  128 (290)
T ss_pred             HHHCCCCEEEECCCCC
T ss_conf             9859988899757666


No 300
>pfam05869 Dam DNA N-6-adenine-methyltransferase (Dam). This family consists of several bacterial and phage DNA N-6-adenine-methyltransferase (Dam) like sequences.
Probab=89.31  E-value=0.99  Score=23.32  Aligned_cols=61  Identities=20%  Similarity=0.312  Sum_probs=35.3

Q ss_pred             EEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEE-EECCHHHHHHHHHHHH-----CCCCCEEE
Q ss_conf             57722654464465478854556520566898999999998624698378-7028888999999852-----17884699
Q gi|255764482|r   93 HVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLS-LIARPQSLIQIVNACA-----RRIGSLEI  166 (225)
Q Consensus        93 lii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~-~i~~~~~l~~~l~~~~-----~~~~~~~i  166 (225)
                      -|.+||||...                    ...|++.|.+....|++.. ++.++..-...+....     -.+.--++
T Consensus        64 ~vf~NPPYsr~--------------------i~~~v~kA~e~~~~g~~~VvmL~~a~~st~Wf~~~~~~A~eI~fI~GRi  123 (179)
T pfam05869        64 AAFMNPPYSRE--------------------IRPWVKKAIEQREKGNQTVVLLLAATSSTWWFEDALENADEIRFIRGRI  123 (179)
T ss_pred             CEEECCCCCCC--------------------HHHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHCCCCEEEEECCCE
T ss_conf             58967998666--------------------6999999999998399589999745898707888852698899805734


Q ss_pred             EEECCCC
Q ss_conf             9814589
Q gi|255764482|r  167 TPLHPRE  173 (225)
Q Consensus       167 ~~v~~~~  173 (225)
                      .++.|.-
T Consensus       124 ~Fi~p~t  130 (179)
T pfam05869       124 AFISPET  130 (179)
T ss_pred             EEECCCC
T ss_conf             4326888


No 301
>PRK07576 short chain dehydrogenase; Provisional
Probab=89.24  E-value=1.5  Score=22.28  Aligned_cols=127  Identities=14%  Similarity=0.070  Sum_probs=71.6

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC---CC
Q ss_conf             55789995878438999999867--99889999889899998899999806645222530200444235310000---12
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL---AG   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~---~~   85 (225)
                      +|+.+|=-|.+. .++..+|+++  .+++|.-.+.+++.++.+.+.+...+     .+...+..|+.+.......   ..
T Consensus         7 ~gK~alVTGgs~-GIG~aia~~la~~Ga~V~i~~r~~~~~~~~~~~l~~~~-----~~~~~~~~Dv~~~~~~~~~~~~~~   80 (260)
T PRK07576          7 AGKNVFVVGGTS-GINLGIAQAFARAGANVAVASRSQEKVDAAVAQLQQAG-----PEALGVSADVRDYAAVEAAFAAIA   80 (260)
T ss_pred             CCCEEEEECCCC-HHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC-----CCEEEEEECCCCHHHHHHHHHHHH
T ss_conf             899899958961-99999999999879999999798899999999999539-----948999931899999999999999


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCC--HHHHHHHCCCCCCHHHHHHHHHHHCCC-CCEEEEE
Q ss_conf             3576520577226544644654788--545565205668989999999986246-9837870
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIGTMTPD--KIKEEAHVMLEDSFEKWIRTACAIMRS-SGQLSLI  144 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~~~~~~--~~~~~a~~~~~~~~~~~~~~a~~lLkp-gG~~~~i  144 (225)
                      ..-+..|.++.|--...........  .....-.... .....+++.+..+++. +|.+..+
T Consensus        81 ~~~G~iDiLVnnAg~~~~~~~~~~~~~~~~~~~~vnl-~~~~~~~~~~~p~m~~~~G~IIni  141 (260)
T PRK07576         81 DEFGPIDVLVSGAAGNFPAPAAGMSANGFKTVVDIDL-LGTFNVLKAAYPLLRRPGASIIQI  141 (260)
T ss_pred             HHHCCCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHH-HHHHHHHHHHHHHHHHCCCEEEEE
T ss_conf             9849998999898678998915599999999999864-638999999999987179779999


No 302
>KOG0821 consensus
Probab=89.09  E-value=0.69  Score=24.22  Aligned_cols=91  Identities=14%  Similarity=0.161  Sum_probs=58.2

Q ss_pred             HCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC-
Q ss_conf             3899855789995878438999999867998899998898999988999998066452225302004442353100001-
Q gi|255764482|r    6 LVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA-   84 (225)
Q Consensus         6 ~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~-   84 (225)
                      -+..-...-|.++|-|.|+++-.+... .-+++.-||+|+.-+.-.+.-.+.     ...++.+.++|+........+. 
T Consensus        45 ~A~~~~~~~v~eIgPgpggitR~il~a-~~~RL~vVE~D~RFip~LQ~L~EA-----a~~~~~IHh~D~LR~~I~~~~~~  118 (326)
T KOG0821          45 KAGNLTNAYVYEIGPGPGGITRSILNA-DVARLLVVEKDTRFIPGLQMLSEA-----APGKLRIHHGDVLRFKIEKAFSE  118 (326)
T ss_pred             HCCCCCCCCEEEECCCCCCHHHHHHHC-CHHHEEEEEECCCCCHHHHHHHHC-----CCCEEEEECCHHHHHHHHHHCCH
T ss_conf             616555240588469987204898862-523526663156647478888753-----87505752005777669876622


Q ss_pred             -----CCCCCCCCEEEECCCCCC
Q ss_conf             -----235765205772265446
Q gi|255764482|r   85 -----GLKNNFYDHVIMNPPFNE  102 (225)
Q Consensus        85 -----~~~~~~fDlii~nPPy~~  102 (225)
                           |..+-..-++++|-||..
T Consensus       119 ~~~Rpw~d~~p~~H~IGNLPf~i  141 (326)
T KOG0821         119 SLKRPWEDDPPNVHIIGNLPFSV  141 (326)
T ss_pred             HHCCCCCCCCCCEEEECCCCCCC
T ss_conf             21286546887357864677444


No 303
>PRK06194 hypothetical protein; Provisional
Probab=88.94  E-value=1.6  Score=22.16  Aligned_cols=89  Identities=16%  Similarity=0.014  Sum_probs=59.7

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---C
Q ss_conf             55789995878438999999867--998899998898999988999998066452225302004442353100001---2
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---G   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---~   85 (225)
                      +|..++=-|+++|. +..+|+++  .+++|+.+|++++.++.+.+.+...+     .++.....|+.+......+.   .
T Consensus         5 ~gKvavITGassGI-G~a~A~~la~~Ga~Vvl~d~~~~~l~~~~~~l~~~g-----~~v~~~~~DVsd~~~v~~l~~~~~   78 (301)
T PRK06194          5 AGKVAVITGAASGF-GREFARIGARLGMKLVLADVQQDALDRAVAELRAQG-----AEVLGVRTDVSDAAQVEALADAAL   78 (301)
T ss_pred             CCCEEEEECCCCHH-HHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC-----CEEEEEECCCCCHHHHHHHHHHHH
T ss_conf             99989992737799-999999999879989999798899999999998459-----849999656899999999999999


Q ss_pred             CCCCCCCEEEECCCCCCCCC
Q ss_conf             35765205772265446446
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIG  105 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~  105 (225)
                      ...+..|+++.|--....+.
T Consensus        79 ~~fG~iDiLVNNAGi~~~~~   98 (301)
T PRK06194         79 ERFGAVHLLFNNAGVGAGGL   98 (301)
T ss_pred             HHHCCEEEEEECCCCCCCCC
T ss_conf             98399379995576678887


No 304
>pfam02636 DUF185 Uncharacterized ACR, COG1565. This family contains several uncharacterized proteins. One member has been described as an ATP synthase beta subunit transcription termination factor rho protein.
Probab=88.52  E-value=1.7  Score=21.99  Aligned_cols=47  Identities=26%  Similarity=0.392  Sum_probs=34.8

Q ss_pred             CCEEEEECCCHHHHHHHHHHH---C-C----CCEEEEEECCHHHHHHHHHHHHHH
Q ss_conf             578999587843899999986---7-9----988999988989999889999980
Q gi|255764482|r   12 SFHLADLGAGAGAAGLAVASR---L-H----EAQILLAERSPLMAHYARKTLALP   58 (225)
Q Consensus        12 ~~~VLDlGcG~G~~~l~la~r---~-~----~~~v~gvD~~~~~~~~A~~n~~~~   58 (225)
                      .-+|+|+|+|.|.+..-+...   + |    ..+++-+|.||.+.+..++++...
T Consensus        18 ~~~ivE~G~G~G~L~~dil~~l~~~~p~~~~~~~y~lvE~s~~L~~~Q~~~L~~~   72 (240)
T pfam02636        18 PLRLVEIGAGRGTLAADILRALRKLLPEFYEALEYHLVEISPALRERQKERLAGS   72 (240)
T ss_pred             CEEEEEECCCCHHHHHHHHHHHHHHCHHHHHCCEEEEEECCHHHHHHHHHHHHHC
T ss_conf             7089997997189999999999875946575346999808999999999975214


No 305
>PRK07109 short chain dehydrogenase; Provisional
Probab=88.51  E-value=1.7  Score=21.98  Aligned_cols=163  Identities=14%  Similarity=0.047  Sum_probs=90.8

Q ss_pred             CCCCCCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC
Q ss_conf             899855789995878438999999867--998899998898999988999998066452225302004442353100001
Q gi|255764482|r    7 VNATGSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA   84 (225)
Q Consensus         7 ~~~~~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~   84 (225)
                      .++-+++.|+=-||.+|. +..+|+++  .+++|+.++.+++.++.+.+.++..+     .++..+..|+.+........
T Consensus         3 ~k~l~~KvVvITGASsGI-Gra~A~~fA~~Ga~Vvl~aR~~~~L~~~a~e~~~~G-----~~~~~~~~DVsd~~~v~~~~   76 (338)
T PRK07109          3 LKPLGRQVVVITGASAGV-GRATARAFARRGAKVVLLARGEEGLEGLAAEIRAAG-----GEALAVVADVADAEAVQAAA   76 (338)
T ss_pred             CCCCCCCEEEEECCCCHH-HHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC-----CEEEEEEEECCCHHHHHHHH
T ss_conf             960698989994843499-999999999879989999899999999999999639-----81899980179999999999


Q ss_pred             ---CCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCH--HHHHHHHHHHCCC--CCEEEEECCH----------
Q ss_conf             ---2357652057722654464465478854556520566898--9999999986246--9837870288----------
Q gi|255764482|r   85 ---GLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSF--EKWIRTACAIMRS--SGQLSLIARP----------  147 (225)
Q Consensus        85 ---~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~--~~~~~~a~~lLkp--gG~~~~i~~~----------  147 (225)
                         ....+..|+++.|--....+.....+... ..+....+.+  ......+...+++  +|.+..+-..          
T Consensus        77 ~~~~~~~G~IDvlVNNAGi~~~g~~~~~~~e~-~~~vi~vNl~G~v~~t~aaLp~m~~~~~G~IInvsSvag~~~~P~~s  155 (338)
T PRK07109         77 DRAEEELGPIDTWVNNAMVTVFGPFEDVTPEE-FRRVTDVTYLGVVHGTLAALRHMRPRDRGAIIQVGSALAYRSIPLQS  155 (338)
T ss_pred             HHHHHHHCCCCEEEECCCCCCCCCHHHCCHHH-HHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCC
T ss_conf             99999849988886546667787632299999-99998775189999999999999867997899988955545789981


Q ss_pred             ---------HHHHHHHH-HHHCCCCCEEEEEECC-CCCCC
Q ss_conf             ---------88999999-8521788469998145-89698
Q gi|255764482|r  148 ---------QSLIQIVN-ACARRIGSLEITPLHP-REGEC  176 (225)
Q Consensus       148 ---------~~l~~~l~-~~~~~~~~~~i~~v~~-~~~~~  176 (225)
                               ..+.+-+. .+......++++-|+| ..+.|
T Consensus       156 aY~ASK~Av~GftesLr~EL~~~~s~I~Vt~V~Pg~VdTP  195 (338)
T PRK07109        156 AYCAAKHAIRGFTDSLRCELLHDGSPVSVTMVQPPAVNTP  195 (338)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCC
T ss_conf             7999999999999999999986799818999757987797


No 306
>KOG1562 consensus
Probab=88.11  E-value=1  Score=23.27  Aligned_cols=118  Identities=19%  Similarity=0.211  Sum_probs=78.8

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             85578999587843899999986799889999889899998899999806645222530200444235310000123576
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNN   89 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~   89 (225)
                      ...++||=+|=|-|...-..+..-.-.++.-+|+|...++..++-.+.....-...++.+.-+|-..+     +.....+
T Consensus       120 ~npkkvlVVgggDggvlrevikH~~ve~i~~~eiD~~Vie~sk~y~p~la~gy~~~~v~l~iGDG~~f-----l~~~~~~  194 (337)
T KOG1562         120 PNPKKVLVVGGGDGGVLREVIKHKSVENILLCEIDENVIESSKQYLPTLACGYEGKKVKLLIGDGFLF-----LEDLKEN  194 (337)
T ss_pred             CCCCEEEEEECCCCCCEEEEECCCCCCCEEEEHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCHHHH-----HHHHCCC
T ss_conf             89874799944884130113103460106754336789999998738875367897148995568999-----9870369


Q ss_pred             CCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECC
Q ss_conf             520577226544644654788545565205668989999999986246983787028
Q gi|255764482|r   90 FYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIAR  146 (225)
Q Consensus        90 ~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~  146 (225)
                      .||.|+..--     ....+         ........+++...+.||++|..+.+-.
T Consensus       195 ~~dVii~dss-----dpvgp---------a~~lf~~~~~~~v~~aLk~dgv~~~q~e  237 (337)
T KOG1562         195 PFDVIITDSS-----DPVGP---------ACALFQKPYFGLVLDALKGDGVVCTQGE  237 (337)
T ss_pred             CCEEEEEECC-----CCCCH---------HHHHHHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             7418997167-----76755---------8898888899999985179927997323


No 307
>PRK05872 short chain dehydrogenase; Provisional
Probab=88.10  E-value=1.8  Score=21.83  Aligned_cols=125  Identities=18%  Similarity=0.148  Sum_probs=71.1

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC---C
Q ss_conf             855789995878438999999867--99889999889899998899999806645222530200444235310000---1
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL---A   84 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~---~   84 (225)
                      -+|+.+|=-|+++| ++..+|+++  .+++|+.+|.+++.++.+.+.+        ..+...+..|+.+.......   .
T Consensus         7 L~gKvalITGassG-IG~aiA~~la~~Ga~Vvl~dr~~~~l~~~~~~l--------g~~~~~~~~DVtd~~~v~~~v~~i   77 (296)
T PRK05872          7 LDGKVVFVTGAARG-VGAELARRLHARGAKVALVDLEEAELAALAAEL--------GDRVLTVVADVTDLAAMQAAAEEA   77 (296)
T ss_pred             CCCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHH--------CCCEEEEEEECCCHHHHHHHHHHH
T ss_conf             59987999271058-999999999987998999989999999999983--------887389998279999999999999


Q ss_pred             CCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHH--HHHHHHHH-HCCCCCEEEEE
Q ss_conf             23576520577226544644654788545565205668989--99999998-62469837870
Q gi|255764482|r   85 GLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFE--KWIRTACA-IMRSSGQLSLI  144 (225)
Q Consensus        85 ~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~--~~~~~a~~-lLkpgG~~~~i  144 (225)
                      ....+..|.++.|--....+.....+... ..+....+..-  ...+.+.. +.+.+|.+..|
T Consensus        78 ~~~~G~iDiLVnNAGi~~~~~~~~~~~e~-~~~v~dVNl~G~~~~~ra~lp~m~~~~G~IVni  139 (296)
T PRK05872         78 VERFGGIDVVVANAGIASYGSVLQVDPAA-FRRVIDVNLLGVFHTVRATLPAVIERRGYVLQV  139 (296)
T ss_pred             HHHHCCCCEEEECCCCCCCCCHHHCCHHH-HHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEE
T ss_conf             99719987876556257997642199899-725842445999999999999999779989999


No 308
>pfam02086 MethyltransfD12 D12 class N6 adenine-specific DNA methyltransferase.
Probab=88.09  E-value=1.8  Score=21.83  Aligned_cols=47  Identities=15%  Similarity=0.200  Sum_probs=34.9

Q ss_pred             HHHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHH
Q ss_conf             2438998557899958784389999998679988999988989999889
Q gi|255764482|r    4 ASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYAR   52 (225)
Q Consensus         4 a~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~   52 (225)
                      ...++.....+..|+.+|+|++++.+...  ..+++.-|+++..+..-+
T Consensus        13 ~~~~p~~~~~~yvEPF~GggsV~~~~~~~--~~~~~iNDin~~l~~~~~   59 (254)
T pfam02086        13 KEHIPKGGDRRFVEPFAGGGAVFFEAKKR--GKKVLINDINYDLINLYK   59 (254)
T ss_pred             HHHCCCCCCCEEEEECCCHHHHHHHHHCC--CCEEEEEECCHHHHHHHH
T ss_conf             98568578999998368777999976416--886999968889999999


No 309
>PRK07890 short chain dehydrogenase; Provisional
Probab=88.09  E-value=1.8  Score=21.83  Aligned_cols=128  Identities=16%  Similarity=0.082  Sum_probs=71.5

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---C
Q ss_conf             55789995878438999999867--998899998898999988999998066452225302004442353100001---2
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---G   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---~   85 (225)
                      +|..+|=-|.+.| ++..+|+++  .+++|+-.+.+++.++.+.+.+...+     .+...+..|+.+......+.   .
T Consensus         4 ~gK~alVTG~s~G-IG~aia~~la~~Ga~V~i~~r~~~~l~~~~~~i~~~g-----~~~~~~~~Dv~~~~~~~~~v~~~~   77 (258)
T PRK07890          4 KDKVVVVSGVGPG-LGTTLAVRAAREGADVVLAARTAERLDEVAKQIDDLG-----RRALAVVTDITDEAQVANLVDAAL   77 (258)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC-----CCEEEEECCCCCHHHHHHHHHHHH
T ss_conf             9988999685658-9999999999879989999798999999999999649-----958999816999999999999999


Q ss_pred             CCCCCCCEEEECCCCCCC-CCCCCCCH-HHHHHHCCCCCCHHHHHHHHHHHCCC-CCEEEEE
Q ss_conf             357652057722654464-46547885-45565205668989999999986246-9837870
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNER-IGTMTPDK-IKEEAHVMLEDSFEKWIRTACAIMRS-SGQLSLI  144 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~-~~~~~~~~-~~~~a~~~~~~~~~~~~~~a~~lLkp-gG~~~~i  144 (225)
                      ..-+..|.++.|.-.... ......+. ...............+.+.+...+++ +|++..+
T Consensus        78 ~~fG~iDiLVnnAg~~~~~~~~~~~~~e~~~~~~~~nl~~~~~~~k~~~p~m~~~~G~IVni  139 (258)
T PRK07890         78 ERFGRVDVLVNNAFRVPSMKPLAGADFDHWRDVIETNVLGTLRLTQAFTPALAESGGSVVMI  139 (258)
T ss_pred             HHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEE
T ss_conf             98499989998686678999800299999999999875999999998899999769859998


No 310
>COG1743 Adenine-specific DNA methylase containing a Zn-ribbon [DNA replication, recombination, and repair]
Probab=88.03  E-value=0.65  Score=24.35  Aligned_cols=68  Identities=18%  Similarity=0.267  Sum_probs=37.4

Q ss_pred             CHHHHHHHHHHHCCCCCEEEEECC---HHHHHHHHHH-HHC-CCCCEEEEEECCCCCC-------C--CEEEEEEEEECC
Q ss_conf             989999999986246983787028---8889999998-521-7884699981458969-------8--309999999778
Q gi|255764482|r  123 SFEKWIRTACAIMRSSGQLSLIAR---PQSLIQIVNA-CAR-RIGSLEITPLHPREGE-------C--ASRILVTGRKGM  188 (225)
Q Consensus       123 ~~~~~~~~a~~lLkpgG~~~~i~~---~~~l~~~l~~-~~~-~~~~~~i~~v~~~~~~-------~--~~~vlv~~~k~~  188 (225)
                      .+.+.++.+..+|+++|.+..-++   ++.-..++++ +.. ++...+..|+++....       .  ...+++-+||-.
T Consensus       566 l~~~a~~~~rEll~ddg~lv~y~ahk~~eaW~tlveA~~Rragl~iTr~~p~~TEs~~~v~~rgk~aL~tsiV~v~RpR~  645 (875)
T COG1743         566 LFREAFQAVRELLKDDGRLVTYYAHKAPEAWITLVEAGWRRAGLQITRAWPVRTESLASVRARGKAALETSIVVVWRPRK  645 (875)
T ss_pred             HHHHHHHHHHHHCCCCCEEEEEEECCCCCCHHHHHHHHHHHCCCEEECCCCCCCCCHHHHHHHHHHHHHCEEEEEECCCC
T ss_conf             99999999998638886179998626875317688888752564033035531221677998766432101589974677


Q ss_pred             CC
Q ss_conf             88
Q gi|255764482|r  189 RG  190 (225)
Q Consensus       189 ~~  190 (225)
                      +.
T Consensus       646 ~~  647 (875)
T COG1743         646 EE  647 (875)
T ss_pred             CC
T ss_conf             62


No 311
>PRK07062 short chain dehydrogenase; Provisional
Probab=87.91  E-value=1.9  Score=21.77  Aligned_cols=129  Identities=14%  Similarity=0.049  Sum_probs=74.8

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCC---
Q ss_conf             55789995878438999999867--9988999988989999889999980664522253020044423531000012---
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAG---   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~---   85 (225)
                      +|+.+|=-|.+.| ++..+|+++  .+++|+..+.+++-++.+.+.+....   ...++.....|+.+......+..   
T Consensus         7 ~gK~alITG~s~G-IG~a~a~~la~~Ga~Vvi~~r~~~~l~~~~~~l~~~~---~~~~~~~~~~Dvt~~~~v~~~v~~~~   82 (265)
T PRK07062          7 EGRVAVVTGGSSG-IGLATVELLLEAGASVAICGRDEERLASAEARLREKF---PGARLLAARCDVLDEADVAAFAAAVE   82 (265)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHC---CCCEEEEEECCCCCHHHHHHHHHHHH
T ss_conf             9998999575779-9999999999879999999798899999999998736---99659999757999999999999999


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCC--HHHHHHHHHHHCC--CCCEEEEE
Q ss_conf             35765205772265446446547885455652056689--8999999998624--69837870
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDS--FEKWIRTACAIMR--SSGQLSLI  144 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~--~~~~~~~a~~lLk--pgG~~~~i  144 (225)
                      ..-+..|..+.|............+... +.+....+.  ....++.+...++  .+|++..+
T Consensus        83 ~~~G~iDiLVnNAg~~~~~~~~~~~~e~-w~~~~~~nl~~~~~~~~~~~p~m~~~~~G~IIni  144 (265)
T PRK07062         83 ARFGGVDMLVNNAGQGRVSTFADTTDDA-WRDELELKYFSVIRPTRAFLPLLRASAAPSITCV  144 (265)
T ss_pred             HHHCCCCEEEECCCCCCCCCHHHCCHHH-HHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             9839988899778888988848799999-9999987214589999999999996299629999


No 312
>PRK07677 short chain dehydrogenase; Provisional
Probab=87.33  E-value=2  Score=21.56  Aligned_cols=84  Identities=18%  Similarity=0.183  Sum_probs=57.5

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---C
Q ss_conf             55789995878438999999867--998899998898999988999998066452225302004442353100001---2
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---G   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---~   85 (225)
                      +|..+|=-| |++.++..+|+++  .+++|+..+.+.+.++.+.+.++..+     .++..+++|+.+......+.   .
T Consensus         2 ~gK~alVTG-gs~GIG~aia~~la~~Ga~V~i~~r~~~~l~~~~~~i~~~g-----~~~~~~~~Dv~~~~~v~~~v~~~~   75 (254)
T PRK07677          2 KEKVVIITG-GSSGMGKAMAKRFAEEGANVVITGRTKEKLEEAKLEIEQFP-----GQVLTVQMDVRNPDDVQKMIEQID   75 (254)
T ss_pred             CCCEEEEEC-CCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC-----CCEEEEECCCCCHHHHHHHHHHHH
T ss_conf             529899958-76789999999999879999999699999999999998569-----909999803899999999999999


Q ss_pred             CCCCCCCEEEECCCC
Q ss_conf             357652057722654
Q gi|255764482|r   86 LKNNFYDHVIMNPPF  100 (225)
Q Consensus        86 ~~~~~fDlii~nPPy  100 (225)
                      ...+..|..+.|...
T Consensus        76 ~~~g~iDiLVnNAg~   90 (254)
T PRK07677         76 EKFGRIDALINNAAG   90 (254)
T ss_pred             HHHCCCCEEEECCCC
T ss_conf             983998889975755


No 313
>PRK07041 short chain dehydrogenase; Provisional
Probab=87.14  E-value=2.1  Score=21.50  Aligned_cols=124  Identities=18%  Similarity=0.225  Sum_probs=68.5

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCC
Q ss_conf             55789995878438999999867--9988999988989999889999980664522253020044423531000012357
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKN   88 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~   88 (225)
                      +|.++|=-|.+.| ++..+|+++  .+++|+.++.+++.++.+.+.+..      ..++.....|+.+......+. ...
T Consensus         6 ~gK~~lITGgs~G-IG~aia~~la~~Ga~V~i~~r~~~~l~~~~~~~~~------~~~~~~~~~Dv~~~~~v~~~~-~~~   77 (240)
T PRK07041          6 NDQKVLVVGGSSG-IGLAAARAFAARGADVTIASRSRERLAAAARALGG------PRPVRTAALDITDEAAVDAFF-AEA   77 (240)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCC------CCCEEEEECCCCCHHHHHHHH-HHH
T ss_conf             9998999577888-99999999998799999995988999999998478------886699984799999999999-970


Q ss_pred             CCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHH-HHHHHHHCCCCCEEEEE
Q ss_conf             652057722654464465478854556520566898999-99999862469837870
Q gi|255764482|r   89 NFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKW-IRTACAIMRSSGQLSLI  144 (225)
Q Consensus        89 ~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~-~~~a~~lLkpgG~~~~i  144 (225)
                      +.+|.++.|......+.....+..... +....+....+ +..+ ...+++|.+.++
T Consensus        78 g~~d~lv~nag~~~~~~~~~~~~~~~~-~~~~~n~~~~~~~~~~-~~~~~~G~Ii~i  132 (240)
T PRK07041         78 GPFDHVVITAADTAGGPVRALPLAAAQ-AAMDSKFWGAYRVARA-ARIAPGGSLTFV  132 (240)
T ss_pred             CCCCEEEECCCCCCCCCHHHCCHHHHH-HHHHHHHHHHHHHHHH-HHHHCCCEEEEE
T ss_conf             987889982344799981029999999-9999888999999999-997169679996


No 314
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional
Probab=87.11  E-value=2.1  Score=21.49  Aligned_cols=128  Identities=13%  Similarity=0.022  Sum_probs=71.8

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---C
Q ss_conf             55789995878438999999867--998899998898999988999998066452225302004442353100001---2
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---G   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---~   85 (225)
                      +|..+|=-|.+.|. +..+|..+  .+++|+-.+++++.++.+...+...+     .++..+.+|+.+........   .
T Consensus         6 ~gKvalVTGgs~GI-G~a~A~~la~~Ga~V~i~~~~~~~~~~~~~~i~~~g-----~~~~~~~~Dvt~~~~v~~~v~~~~   79 (262)
T PRK13394          6 NGKTAVVTGAASGI-GKEIALELARAGAAVAIADLNQDGANAVADEINKAG-----GKAIGVAMDVTNEDAVNAGIDKVA   79 (262)
T ss_pred             CCCEEEEECCCCHH-HHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC-----CEEEEEECCCCCHHHHHHHHHHHH
T ss_conf             99989995857789-999999999879999999798899999999999629-----939999815899999999999999


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCC--CHHHHHHHHHHHC-CC--CCEEEEEC
Q ss_conf             3576520577226544644654788545565205668--9899999999862-46--98378702
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLED--SFEKWIRTACAIM-RS--SGQLSLIA  145 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~--~~~~~~~~a~~lL-kp--gG~~~~i~  145 (225)
                      ..-+..|..+-|.-..........+... +.+....+  ......+.+...+ |+  +|++..+-
T Consensus        80 ~~~G~iDiLVnnAG~~~~~~~~~~~~e~-w~~~~~vNl~g~~~~~~~~~p~M~k~~~~G~IVnis  143 (262)
T PRK13394         80 ERFGSVDILVSNAGIQIVNPIENYSFAD-WKKMQAIHVDGAFLTTKAALKHMYKDDRGGVVIYMG  143 (262)
T ss_pred             HHHCCCCEEEECCCCCCCCCHHHCCHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEC
T ss_conf             9819999999899889999916599999-999999975899999999999999837996899974


No 315
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated
Probab=86.90  E-value=2.2  Score=21.42  Aligned_cols=127  Identities=21%  Similarity=0.133  Sum_probs=71.6

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC---CC
Q ss_conf             55789995878438999999867--99889999889899998899999806645222530200444235310000---12
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL---AG   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~---~~   85 (225)
                      +|..+|=-|++.| ++..+|+.+  .+++|+.++.+++-++.+.+.+...     ..++...+.|+.+.......   ..
T Consensus         4 ~~Kv~lITGgs~G-IG~a~a~~la~~G~~V~~~~r~~~~l~~~~~~~~~~-----~~~~~~~~~Dl~~~~~~~~~~~~~~   77 (246)
T PRK05653          4 QGKTALVTGASRG-IGRAIALRLAADGARVVIYDSNEEAAEALAEELRAA-----GGEAALLVFDVTDEAAVRALIEAAV   77 (246)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHC-----CCCEEEEEEECCCHHHHHHHHHHHH
T ss_conf             9988999389758-999999999987999999979999999999999965-----9948999972899999999999999


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCC--CCHHHHHHHHHHHCCC--CCEEEEE
Q ss_conf             357652057722654464465478854556520566--8989999999986246--9837870
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLE--DSFEKWIRTACAIMRS--SGQLSLI  144 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~--~~~~~~~~~a~~lLkp--gG~~~~i  144 (225)
                      ...+..|.++.|.-.+........+... +.+....  .....+.+.+.+.++.  +|++..+
T Consensus        78 ~~~g~iDilvnnAg~~~~~~~~~~~~~~-~~~~~~vNl~~~~~~~~~~~~~m~~~~~G~II~i  139 (246)
T PRK05653         78 ERFGGLDVLVNNAGITRDALLPRMSEED-WDRVIDTNLTGTFNVCRAALPPMRKARYGRIVNI  139 (246)
T ss_pred             HHCCCCCEEEECCCCCCCCCCHHCCHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             9749986999899999998801399999-9999998608899999999999998469978998


No 316
>PRK04148 hypothetical protein; Provisional
Probab=86.79  E-value=1.3  Score=22.72  Aligned_cols=42  Identities=14%  Similarity=0.147  Sum_probs=30.9

Q ss_pred             CCCCEEEEECCCHHH-HHHHHHHHCCCCEEEEEECCHHHHHHHHH
Q ss_conf             855789995878438-99999986799889999889899998899
Q gi|255764482|r   10 TGSFHLADLGAGAGA-AGLAVASRLHEAQILLAERSPLMAHYARK   53 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~-~~l~la~r~~~~~v~gvD~~~~~~~~A~~   53 (225)
                      .++.+|.|+|-|.=. .+..|.+  .+..|+.+|+++.++..|+.
T Consensus        15 ~~~~kIvEvGIGf~~~vA~~L~e--~g~dv~~~Din~~aV~~a~~   57 (135)
T PRK04148         15 LKNGKIAELGIGFYFKVAKKLKE--SGFDVIVIDINKKAVEKAKK   57 (135)
T ss_pred             CCCCEEEEEECCCCHHHHHHHHH--CCCCEEEEECCHHHHHHHHH
T ss_conf             12873899923666789999987--49988999576554322123


No 317
>PRK05650 short chain dehydrogenase; Provisional
Probab=86.68  E-value=2.2  Score=21.36  Aligned_cols=123  Identities=17%  Similarity=0.046  Sum_probs=69.6

Q ss_pred             EEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---CCCC
Q ss_conf             89995878438999999867--998899998898999988999998066452225302004442353100001---2357
Q gi|255764482|r   14 HLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---GLKN   88 (225)
Q Consensus        14 ~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---~~~~   88 (225)
                      |||=-|+++|. +..+|.++  .+++|..+|.+++.++...+.+...+     .+..++..|+.+......+.   ....
T Consensus         2 rVlITGassGI-G~alA~~la~~G~~V~l~~r~~~~l~~~~~~l~~~g-----~~~~~~~~Dvt~~~~~~~~~~~v~~~~   75 (270)
T PRK05650          2 RVMITGAASGL-GRAIALRWAREGWRLALADVNEEGGEETLKELREAG-----GDGFYQRCDVRDYSQLTALAQACEEKW   75 (270)
T ss_pred             EEEEECCCCHH-HHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC-----CCEEEEECCCCCHHHHHHHHHHHHHHH
T ss_conf             79998876499-999999999889989999798899999999998449-----928999845899999999999999983


Q ss_pred             CCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHH---HHHHHHHHHCC--CCCEEEEE
Q ss_conf             6520577226544644654788545565205668989---99999998624--69837870
Q gi|255764482|r   89 NFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFE---KWIRTACAIMR--SSGQLSLI  144 (225)
Q Consensus        89 ~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~---~~~~~a~~lLk--pgG~~~~i  144 (225)
                      +..|+++.|.-+...+.....+..  ........++.   ...+.....++  .+|.+..|
T Consensus        76 g~iDiLVNNAGi~~~g~~~~~~~e--~~~~~~~vNl~g~~~~~~~~lp~m~~~~~G~Ivni  134 (270)
T PRK05650         76 GGIDVIVNNAGVASGGFFEELSLE--DWDWQIAINLMGVVKGCKAFLPLFKEQGKGRIVNI  134 (270)
T ss_pred             CCCCEEEECCCCCCCCCHHHCCHH--HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             997789624766799862019999--99999999659999999999976755699589998


No 318
>PRK08324 short chain dehydrogenase; Validated
Probab=86.46  E-value=2.3  Score=21.29  Aligned_cols=127  Identities=25%  Similarity=0.139  Sum_probs=72.2

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC---CC
Q ss_conf             55789995878438999999867--99889999889899998899999806645222530200444235310000---12
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL---AG   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~---~~   85 (225)
                      .|..+|=-|.+ |.++.++|+++  .+++|+.+|++++.++.+...+..      ...+..+.+|+.+.......   ..
T Consensus       420 ~GKVALVTGga-~GIG~A~A~~fa~eGA~Vvl~D~~~~~l~~~a~el~~------~~~~~~~~~DVtd~~~v~~~v~~~~  492 (676)
T PRK08324        420 AGKVALVTGAA-GGIGLATAKRLAAEGACVVLADIDEEAAEAAAAELGG------RDRALGVACDVTDEAAVQAAFEEAA  492 (676)
T ss_pred             CCCEEEEECCC-CCHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHC------CCCEEEEEECCCCHHHHHHHHHHHH
T ss_conf             99879994798-8162999999998799899995888999999999707------9947999806899999999999999


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCC--HHHHHHHHHHHCCC---CCEEEEEC
Q ss_conf             35765205772265446446547885455652056689--89999999986246---98378702
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDS--FEKWIRTACAIMRS---SGQLSLIA  145 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~--~~~~~~~a~~lLkp---gG~~~~i~  145 (225)
                      ..-+..|.++.|-.....+.....+.. .+.+....+.  .....+.+.+.++.   ||.+.++-
T Consensus       493 ~~fGgIDiLVnNAGi~~~~~~~e~s~e-~w~~~~~vNl~g~f~~~r~a~p~M~~qg~GG~IV~is  556 (676)
T PRK08324        493 LAFGGVDIVVSNAGIALSGPIGETSDE-LWRRSFEVNFTGHFLVAREAVRIMKAQGTGGNLVFIA  556 (676)
T ss_pred             HHHCCCCEEEECCCCCCCCCHHHCCHH-HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEE
T ss_conf             985998889976777899882659999-9999998860999999999999999769991999982


No 319
>PRK07201 short chain dehydrogenase; Provisional
Probab=85.86  E-value=2.4  Score=21.11  Aligned_cols=88  Identities=15%  Similarity=0.074  Sum_probs=59.3

Q ss_pred             CCCCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC--
Q ss_conf             9855789995878438999999867--998899998898999988999998066452225302004442353100001--
Q gi|255764482|r    9 ATGSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA--   84 (225)
Q Consensus         9 ~~~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~--   84 (225)
                      .-.|+.+|=-|+.+|+ +.++|.++  .+++|+.+..+.+.++...+.++..+     .++...+.|+.+......+.  
T Consensus       373 ~L~GKvalITGASSGI-G~A~A~~LA~~GA~Vvl~AR~~e~Le~v~~ei~~~G-----g~a~~~~~DVtd~~~v~~lv~~  446 (663)
T PRK07201        373 PLEGKHVIITGASSGI-GRATAIKVAEAGATVFALARDGEKLDELVAEIRARG-----GQAHAYTCDLTDSASVEHTVKD  446 (663)
T ss_pred             CCCCCEEEECCCCCHH-HHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC-----CCEEEEEECCCCHHHHHHHHHH
T ss_conf             8799479993887599-999999999879989999899999999999999559-----9189999627999999999999


Q ss_pred             -CCCCCCCCEEEECCCCCC
Q ss_conf             -235765205772265446
Q gi|255764482|r   85 -GLKNNFYDHVIMNPPFNE  102 (225)
Q Consensus        85 -~~~~~~fDlii~nPPy~~  102 (225)
                       ....+..|..+.|.-...
T Consensus       447 i~~~~G~IDVLVNNAG~si  465 (663)
T PRK07201        447 ILGRHGHVDYLVNNAGRSI  465 (663)
T ss_pred             HHHHCCCCCEEEECCCCCC
T ss_conf             9996799888998964467


No 320
>PRK09072 short chain dehydrogenase; Provisional
Probab=85.38  E-value=2.6  Score=20.97  Aligned_cols=125  Identities=17%  Similarity=0.116  Sum_probs=69.6

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC--CC
Q ss_conf             55789995878438999999867--998899998898999988999998066452225302004442353100001--23
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA--GL   86 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~--~~   86 (225)
                      +|.+||=-|+.+|. +.++|+++  .+++|+.++.+++.++...+.+       ...++..+..|+.+........  ..
T Consensus         4 ~~K~vlITGassGI-G~a~A~~la~~G~~vil~~R~~~~L~~~~~~l-------~~~~~~~~~~Dls~~~~~~~~~~~~~   75 (262)
T PRK09072          4 KDKRVLLTGASGGI-GEALAEALCAAGARLLLVGRNAEKLEALAARP-------YPGRVRWVVADLTSEAGREAVLARAR   75 (262)
T ss_pred             CCCEEEEECCCCHH-HHHHHHHHHHCCCEEEEEECCHHHHHHHHHHH-------CCCCEEEEEEECCCHHHHHHHHHHHH
T ss_conf             99889994862399-99999999987998999989899999999984-------58976999971799999999999999


Q ss_pred             CCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCC--HHHHHHHHHHHCC--CCCEEEEE
Q ss_conf             5765205772265446446547885455652056689--8999999998624--69837870
Q gi|255764482|r   87 KNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDS--FEKWIRTACAIMR--SSGQLSLI  144 (225)
Q Consensus        87 ~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~--~~~~~~~a~~lLk--pgG~~~~i  144 (225)
                      ..+..|.++.|--....+.....+...... ....+.  .....+.+...++  .+|.+..+
T Consensus        76 ~~g~iDiLInNAG~~~~~~~~~~~~~~~~~-~~~vN~~g~~~lt~~~lp~m~~~~~G~Ivni  136 (262)
T PRK09072         76 EMGGINVLINNAGVNHFALLDQQDPEAIDR-LLALNLTAPMQLTRALLPLLRAQPSAAVVNV  136 (262)
T ss_pred             HHCCCCEEEECCCCCCCCCHHHCCHHHHHH-HHHHHHHHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             849998999899778898635499999999-9999568999999999999987699489996


No 321
>pfam02153 PDH Prephenate dehydrogenase. Members of this family are prephenate dehydrogenases EC:1.3.1.12 involved in tyrosine biosynthesis.
Probab=84.74  E-value=2.8  Score=20.80  Aligned_cols=28  Identities=14%  Similarity=0.038  Sum_probs=22.2

Q ss_pred             HHHHHHHCCCCEEEEEECCHHHHHHHHH
Q ss_conf             9999986799889999889899998899
Q gi|255764482|r   26 GLAVASRLHEAQILLAERSPLMAHYARK   53 (225)
Q Consensus        26 ~l~la~r~~~~~v~gvD~~~~~~~~A~~   53 (225)
                      ++++-++....+|+|+|.++..++.|.+
T Consensus         2 Alalk~~~~~~~I~g~d~~~~~~~~A~~   29 (258)
T pfam02153         2 ALALRRKGFNVTVIGYDIDEEAAVAAVE   29 (258)
T ss_pred             HHHHHHCCCCCEEEEEECCHHHHHHHHH
T ss_conf             2888616999679998599999999998


No 322
>PRK07502 cyclohexadienyl dehydrogenase; Validated
Probab=84.59  E-value=2.8  Score=20.76  Aligned_cols=42  Identities=29%  Similarity=0.183  Sum_probs=30.2

Q ss_pred             CEEEEECCCHHHHHHHHH--HHCCCCEEEEEECCHHHHHHHHHH
Q ss_conf             789995878438999999--867998899998898999988999
Q gi|255764482|r   13 FHLADLGAGAGAAGLAVA--SRLHEAQILLAERSPLMAHYARKT   54 (225)
Q Consensus        13 ~~VLDlGcG~G~~~l~la--~r~~~~~v~gvD~~~~~~~~A~~n   54 (225)
                      .+|+=+|+|-=+-|++++  ++.+..+|+|+|.+++.++.|++.
T Consensus         7 ~~I~IiGlGLIGgSlA~alk~~~~~~~I~g~d~~~~~l~~A~~~   50 (307)
T PRK07502          7 DRVALIGLGLIGSSLARAIRRQGLAGEIVGAARSAETRARAREL   50 (307)
T ss_pred             CEEEEEEECHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHC
T ss_conf             66899927879999999998549985799984999999999986


No 323
>KOG3924 consensus
Probab=84.49  E-value=0.88  Score=23.62  Aligned_cols=92  Identities=13%  Similarity=-0.030  Sum_probs=59.7

Q ss_pred             HCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCC-----CCCCCCEEECCCCCCCCCC
Q ss_conf             38998557899958784389999998679988999988989999889999980664-----5222530200444235310
Q gi|255764482|r    6 LVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANA-----QISKRISLIEVDVTLVGEN   80 (225)
Q Consensus         6 ~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~-----~~~~~~~~~~~D~~~~~~~   80 (225)
                      ..+..+++.-.|+|+|.|..-.++|....-..-.|+|+....-.+|..|...+...     .....++.+++++......
T Consensus       187 El~~g~~D~F~DLGSGVGqlv~~~aa~a~~k~svG~eim~~pS~~a~~~~~~~kk~~k~fGk~~~~~~~i~gsf~~~~~v  266 (419)
T KOG3924         187 ELKLGPADVFMDLGSGVGQLVCFVAAYAGCKKSVGFEIMDKPSQCAELNKEEFKKLMKHFGKKPNKIETIHGSFLDPKRV  266 (419)
T ss_pred             HHCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCEEECCCCCCCHHHH
T ss_conf             96369887234777651023678887534001034054158478899999999999998477867214036354788889


Q ss_pred             CCCCCCCCCCCCEEEECCCCC
Q ss_conf             000123576520577226544
Q gi|255764482|r   81 RNLAGLKNNFYDHVIMNPPFN  101 (225)
Q Consensus        81 ~~~~~~~~~~fDlii~nPPy~  101 (225)
                      ...    ....++|+.|---|
T Consensus       267 ~eI----~~eatvi~vNN~~F  283 (419)
T KOG3924         267 TEI----QTEATVIFVNNVAF  283 (419)
T ss_pred             HHH----HHCCEEEEEECCCC
T ss_conf             988----63052888703347


No 324
>PRK06500 short chain dehydrogenase; Provisional
Probab=84.15  E-value=2.9  Score=20.65  Aligned_cols=124  Identities=18%  Similarity=0.165  Sum_probs=72.2

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---C
Q ss_conf             55789995878438999999867--998899998898999988999998066452225302004442353100001---2
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---G   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---~   85 (225)
                      +|..++=-|.+.| ++..+|+++  .+++|+-++.+++.++.+.+.+        ..+...+++|+.+......+.   .
T Consensus         5 ~gK~~lITGas~G-IG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~~l--------~~~~~~~~~Dv~~~~~~~~~~~~~~   75 (249)
T PRK06500          5 QGKTALITGGTSG-IGLETARQFAAEGARVAITGRDAATLEAARAEL--------GEDALVIRNDAGSVAAQRALAQALA   75 (249)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHH--------CCCEEEEEEECCCHHHHHHHHHHHH
T ss_conf             9988999376878-999999999987999999969989999999985--------8975999951799999999999999


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCC--HHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             3576520577226544644654788--5455652056689899999999862469837870
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIGTMTPD--KIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLI  144 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~~~~~~--~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i  144 (225)
                      ...++.|..+.|.-..........+  ............ .--..+.+..+++.+|...++
T Consensus        76 ~~~g~iDiLvnnAG~~~~~~~~~~~~e~w~~~~~vNl~~-~f~~~~~~~p~m~~~g~iI~~  135 (249)
T PRK06500         76 EAGGRLDAVFINAGVAKFAPLEDWDEAMFDRSFNTNVKG-PYFLIQALLPLLNNPASIVLN  135 (249)
T ss_pred             HHCCCCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHH-HHHHHHHHHHHHHCCCCEEEE
T ss_conf             976999899989987899991669999999999986456-999999999986229818998


No 325
>pfam02254 TrkA_N TrkA-N domain. This domain is found in a wide variety of proteins. These protein include potassium channels, phosphoesterases, and various other transporters. This domain binds to NAD.
Probab=83.51  E-value=3.1  Score=20.50  Aligned_cols=101  Identities=14%  Similarity=0.140  Sum_probs=56.4

Q ss_pred             CCHHHHHHHHHHHCC-CCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCEEEECC
Q ss_conf             784389999998679-9889999889899998899999806645222530200444235310000123576520577226
Q gi|255764482|r   20 AGAGAAGLAVASRLH-EAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNP   98 (225)
Q Consensus        20 cG~G~~~l~la~r~~-~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~fDlii~nP   98 (225)
                      ||.|.++..+++... ..+++.+|.|++.++.++..           ...++.+|..+....   ....-+..|.+++.-
T Consensus         4 ~G~g~~G~~la~~L~~~~~v~vId~d~~~~~~~~~~-----------~~~vi~GD~~~~~~L---~~a~i~~a~~vi~~~   69 (115)
T pfam02254         4 IGYGRVGRSLAEELREGGPVVVIDKDPERVEELREE-----------GVPVVVGDATDEEVL---EEAGIEDADAVVAAT   69 (115)
T ss_pred             ECCCHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHC-----------CCEEEEEECCCHHHH---HHHCCCCCCEEEEEC
T ss_conf             878889999999998089999999987998778866-----------986999956886678---761920287999962


Q ss_pred             CCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHH
Q ss_conf             544644654788545565205668989999999986246983787028888999999
Q gi|255764482|r   99 PFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVN  155 (225)
Q Consensus        99 Py~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~~l~~~l~  155 (225)
                      +          ++           .....+-...+.+.|..............+.+.
T Consensus        70 ~----------~d-----------~~n~~~~~~~r~~~~~~~iiar~~~~~~~~~l~  105 (115)
T pfam02254        70 G----------DD-----------EANILIVLLARELNPAKKIIARANDPEHAELLR  105 (115)
T ss_pred             C----------CH-----------HHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHH
T ss_conf             9----------84-----------999999999999789980999987899999999


No 326
>COG1565 Uncharacterized conserved protein [Function unknown]
Probab=83.43  E-value=3.2  Score=20.48  Aligned_cols=48  Identities=21%  Similarity=0.365  Sum_probs=35.6

Q ss_pred             CCCEEEEECCCHHHHHHHHHHH--------CCCCEEEEEECCHHHHHHHHHHHHHH
Q ss_conf             5578999587843899999986--------79988999988989999889999980
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASR--------LHEAQILLAERSPLMAHYARKTLALP   58 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r--------~~~~~v~gvD~~~~~~~~A~~n~~~~   58 (225)
                      ..-.++|+|.|.|.+.--+...        +...++.-||.||...+.-+.++...
T Consensus        77 ~~~~lvEiGaG~G~l~~DiL~~l~~L~P~~~~~~~~~iiE~s~~L~~~Qk~~L~~~  132 (370)
T COG1565          77 APLKLVEIGAGRGTLASDILRTLRRLYPELYEALSYYIIEPSPELRARQKETLKAT  132 (370)
T ss_pred             CCCEEEEECCCCCHHHHHHHHHHHHHCHHHHHHCEEEEEECCHHHHHHHHHHHHCC
T ss_conf             98448996799676999999999875978773055999925989999999987433


No 327
>PRK12744 short chain dehydrogenase; Provisional
Probab=83.06  E-value=3.3  Score=20.39  Aligned_cols=130  Identities=15%  Similarity=0.051  Sum_probs=68.9

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHH-HHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---
Q ss_conf             55789995878438999999867--998899998898999-988999998066452225302004442353100001---
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMA-HYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---   84 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~-~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---   84 (225)
                      +|..+|=-|.+.| ++..+|+++  .+++|+.++++.+.. +.+.+.....  .....++..+++|+.+........   
T Consensus         7 ~gKvalVTGgs~G-IG~aiA~~la~~Ga~vv~~~~~~~~~~~~~~~~~~~~--~~~g~~~~~~~~Dv~~~~~v~~~~~~~   83 (257)
T PRK12744          7 KGKVVLIAGGAKN-LGGLIARDLAAQGAKAVAIHYNSAATKADAEETVAAV--KAAGAKAVAFQADLTTAAAVEKLFDDA   83 (257)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHHHHH--HHCCCCEEEEECCCCCHHHHHHHHHHH
T ss_conf             9998999288758-9999999999879989999378743689999999999--973992899976889999999999999


Q ss_pred             CCCCCCCCEEEECCCCCCCCCCCCCCHH--HHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             2357652057722654464465478854--55652056689899999999862469837870
Q gi|255764482|r   85 GLKNNFYDHVIMNPPFNERIGTMTPDKI--KEEAHVMLEDSFEKWIRTACAIMRSSGQLSLI  144 (225)
Q Consensus        85 ~~~~~~fDlii~nPPy~~~~~~~~~~~~--~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i  144 (225)
                      ...-+..|.++.|.-..........+..  ....... ......+++.+.+.++.+|....+
T Consensus        84 ~~~~G~iDilVnnAG~~~~~~~~~~~~~~~~~~~~vN-~~~~~~~~~~~~~~m~~~G~ii~i  144 (257)
T PRK12744         84 KAAFGRPDIAINTVGKVLKKPIVEISEAEYDEMFAVN-SKSAFFFIKEAGRHLNDNGKIVTL  144 (257)
T ss_pred             HHHCCCCCEEEECCCCCCCCCHHHCCHHHHHHHHHHH-HHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             9980998899976644567723332288888898888-766999999999987418949999


No 328
>PRK06940 short chain dehydrogenase; Provisional
Probab=82.81  E-value=3.4  Score=20.34  Aligned_cols=81  Identities=21%  Similarity=0.181  Sum_probs=54.1

Q ss_pred             CEEEEECCCHHHHHHHHHHHCC-CCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCC--CCCC
Q ss_conf             7899958784389999998679-988999988989999889999980664522253020044423531000012--3576
Q gi|255764482|r   13 FHLADLGAGAGAAGLAVASRLH-EAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAG--LKNN   89 (225)
Q Consensus        13 ~~VLDlGcG~G~~~l~la~r~~-~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~--~~~~   89 (225)
                      .+|+=+| |+|.++..+|+++. +++|+..|.+++.++.+.+.+...+     .++.....|+.+......+..  ...+
T Consensus         5 ~kV~v~t-Ga~GIG~aiA~~la~Ga~vvi~~~~~~~l~~~~~~l~~~g-----~~~~~~~~Dvs~~~~v~~l~~~~~~~G   78 (277)
T PRK06940          5 KEVVVVI-GAGGMGQAIARRVGSGKTVLLADYNEENLQAVARTLREAG-----FDVITQQVDVSSRESVKALAQTAATLG   78 (277)
T ss_pred             CCEEEEC-CCCHHHHHHHHHHHHCCEEEEEECCHHHHHHHHHHHHHCC-----CEEEEEECCCCCHHHHHHHHHHHHHHC
T ss_conf             9299997-8169999999999819989999898899999999987228-----829999825799899999999999869


Q ss_pred             CCCEEEECCC
Q ss_conf             5205772265
Q gi|255764482|r   90 FYDHVIMNPP   99 (225)
Q Consensus        90 ~fDlii~nPP   99 (225)
                      ..|.++.|--
T Consensus        79 ~idiLVnnAG   88 (277)
T PRK06940         79 AVTGLVHTAG   88 (277)
T ss_pred             CCCEEEECCC
T ss_conf             9879998886


No 329
>PRK07832 short chain dehydrogenase; Provisional
Probab=82.22  E-value=3.5  Score=20.21  Aligned_cols=125  Identities=15%  Similarity=0.071  Sum_probs=67.0

Q ss_pred             EEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---CCCC
Q ss_conf             89995878438999999867--998899998898999988999998066452225302004442353100001---2357
Q gi|255764482|r   14 HLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---GLKN   88 (225)
Q Consensus        14 ~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---~~~~   88 (225)
                      ++|=-|+++|. +..+|.++  .+++|+.+|.+++.++...+.+...+..    .......|+.+......+.   ....
T Consensus         2 ~alITGassGI-G~a~A~~la~~Ga~v~l~~r~~~~l~~~~~~l~~~g~~----~~~~~~~Dvsd~~~v~~~~~~~~~~~   76 (272)
T PRK07832          2 RCFVTGAASGI-GRATALRLAAQGAELFLTDRDADGLAQTVADARALGGT----VPEHRALDISDYDAVAAFAADIHAAH   76 (272)
T ss_pred             EEEEECCCHHH-HHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCC----EEEEEECCCCCHHHHHHHHHHHHHHC
T ss_conf             79994720199-99999999988998999989889999999999845897----14788566899999999999999972


Q ss_pred             CCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHH--HHHHHHH-HHCC--CCCEEEEE
Q ss_conf             6520577226544644654788545565205668989--9999999-8624--69837870
Q gi|255764482|r   89 NFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFE--KWIRTAC-AIMR--SSGQLSLI  144 (225)
Q Consensus        89 ~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~--~~~~~a~-~lLk--pgG~~~~i  144 (225)
                      +..|+++.|.-....+.....+..... +....+.+.  ...+... .+++  .+|.+..+
T Consensus        77 g~iDiLiNNAGi~~~g~~~~~~~~~~~-~~~~vN~~g~~~~~~~~lp~m~~~~~~G~IVni  136 (272)
T PRK07832         77 PSMDVVMNIAGISAWGTVDRLTHEQWR-RMVDINLMGPIHVIETFVPPMVAAGRGGHLVNV  136 (272)
T ss_pred             CCCCEEEECCCCCCCCCCCCCCHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             998889987876888873458999999-999987289999999999999983899689997


No 330
>PRK06181 short chain dehydrogenase; Provisional
Probab=82.22  E-value=3.5  Score=20.20  Aligned_cols=127  Identities=20%  Similarity=0.130  Sum_probs=70.6

Q ss_pred             CCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---CC
Q ss_conf             5789995878438999999867--998899998898999988999998066452225302004442353100001---23
Q gi|255764482|r   12 SFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---GL   86 (225)
Q Consensus        12 ~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---~~   86 (225)
                      |..+|=-|+++|. +..+|.++  .+++|+.++.+++.++.+.+.+...+     .++..+..|+.+......+.   ..
T Consensus         1 GKv~lITGassGI-G~a~A~~la~~Ga~vvl~~r~~~~l~~~~~~l~~~g-----~~~~~~~~Dvs~~~~~~~~~~~~~~   74 (263)
T PRK06181          1 GKVVIITGASEGI-GRALAVRLARAGARLVLAARNEERLASLAQELANYG-----AEALVVATDVSDAEACERLIEAAVA   74 (263)
T ss_pred             CCEEEEECCCCHH-HHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC-----CCEEEEEECCCCHHHHHHHHHHHHH
T ss_conf             9999995810199-999999999879989999889999999999999549-----9679998079999999999999999


Q ss_pred             CCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHH--HHHHHHHHHC-CCCCEEEEE
Q ss_conf             576520577226544644654788545565205668989--9999999862-469837870
Q gi|255764482|r   87 KNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFE--KWIRTACAIM-RSSGQLSLI  144 (225)
Q Consensus        87 ~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~--~~~~~a~~lL-kpgG~~~~i  144 (225)
                      .-+..|.++.|.-+...+......+.....+....+...  ...+.+...+ +.+|.+..+
T Consensus        75 ~~G~iDiLVNNAGi~~~~~~~~~~~~~~~~~~~~vN~~g~~~~~~~~lp~m~~~~G~Ivni  135 (263)
T PRK06181         75 HFGGIDILVNNAGMTMWSRFDELTDLSVLEDVMRVNYLGAVYCTHAALPHLKASQGQIVVV  135 (263)
T ss_pred             HHCCCCEEEECCCCCCCCCHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEE
T ss_conf             8299648998785678887232686999999999982999999999999986389379999


No 331
>PRK05855 short chain dehydrogenase; Validated
Probab=81.89  E-value=3.6  Score=20.13  Aligned_cols=90  Identities=22%  Similarity=0.226  Sum_probs=58.1

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---
Q ss_conf             855789995878438999999867--998899998898999988999998066452225302004442353100001---
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---   84 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---   84 (225)
                      -+|+.++=-|.|+|+ +..+|.++  .+++|+..|++++.++...+-++..+.     .......|+.+......+.   
T Consensus       313 FsGKvAvVTGA~sGI-GrA~A~~fA~~GA~Vvl~Dr~~~~l~eta~ei~~~G~-----~a~~~~~DVtd~~av~al~~~v  386 (582)
T PRK05855        313 FGGKLVVVTGAGSGI-GRATALAFAREGAEVVASDIDEAAAERTAALIRAAGA-----VAHAYRVDVSDADAMEALAEWV  386 (582)
T ss_pred             CCCCEEEEECCCCHH-HHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHCCC-----EEEEEECCCCCHHHHHHHHHHH
T ss_conf             499589995875789-9999999997799999960799999999999995198-----4899975589999999999999


Q ss_pred             CCCCCCCCEEEECCCCCCCCC
Q ss_conf             235765205772265446446
Q gi|255764482|r   85 GLKNNFYDHVIMNPPFNERIG  105 (225)
Q Consensus        85 ~~~~~~fDlii~nPPy~~~~~  105 (225)
                      ....+..|+++.|.-....+.
T Consensus       387 ~~~~G~iDILVNNAGI~~~g~  407 (582)
T PRK05855        387 GAEHGVPDIVVNNAGIGMAGG  407 (582)
T ss_pred             HHHCCCCCEEEECCCCCCCCC
T ss_conf             997699999998987589978


No 332
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional
Probab=81.78  E-value=3.7  Score=20.11  Aligned_cols=82  Identities=22%  Similarity=0.234  Sum_probs=55.0

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---
Q ss_conf             855789995878438999999867--998899998898999988999998066452225302004442353100001---
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---   84 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---   84 (225)
                      -+|..+|=-|++.| ++..+|+++  .+++|+.++.+++.++.+.+..        ..++..+.+|+.+........   
T Consensus         4 L~gK~alVTGas~G-IG~aia~~l~~~Ga~V~~~~r~~~~l~~~~~~~--------~~~~~~~~~Dv~~~~~~~~~~~~~   74 (263)
T PRK06200          4 LTGQVALITGGGSG-IGRALVERFLAEGARVAVLERSAEKCASLRQRF--------GDDVLVVEGDVTSYADNQRAVAQT   74 (263)
T ss_pred             CCCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHH--------CCCEEEEECCCCCHHHHHHHHHHH
T ss_conf             17288999586679-999999999987999999979999999999981--------886468717999999999999999


Q ss_pred             CCCCCCCCEEEECCCC
Q ss_conf             2357652057722654
Q gi|255764482|r   85 GLKNNFYDHVIMNPPF  100 (225)
Q Consensus        85 ~~~~~~fDlii~nPPy  100 (225)
                      ....+..|.++.|.-.
T Consensus        75 ~~~~G~iDiLVnnAG~   90 (263)
T PRK06200         75 VDRFGKLDCFVGNAGI   90 (263)
T ss_pred             HHHHCCCCEEEECCCC
T ss_conf             9984998889975754


No 333
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=81.54  E-value=3.8  Score=20.06  Aligned_cols=125  Identities=19%  Similarity=0.225  Sum_probs=68.6

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCC---
Q ss_conf             55789995878438999999867--9988999988989999889999980664522253020044423531000012---
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAG---   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~---   85 (225)
                      +|..+|=-|.+.| ++..+|+++  .+++|+..+.+++.++.+.+.+.       ..++...+.|+.+......+..   
T Consensus         5 ~gK~alITGgs~G-IG~aia~~la~~G~~V~i~~r~~~~~~~~~~~~~-------~~~~~~~~~Dv~~~~~~~~~~~~~~   76 (250)
T PRK07231          5 EGKVAIVTGAGSG-FGEGIARRFAAEGARVVVTDRNQEAAERVAAEIR-------GGRAIAVAADVSDEADVRAAVEAAL   76 (250)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHC-------CCCEEEEEEECCCHHHHHHHHHHHH
T ss_conf             9988999388868-9999999999879999999798899999999844-------9967999930799999999999999


Q ss_pred             CCCCCCCEEEECCCCCCC-CCCCCCCHHHHHHHCCCC--CCHHHHHHHHHHHCCC--CCEEEEE
Q ss_conf             357652057722654464-465478854556520566--8989999999986246--9837870
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNER-IGTMTPDKIKEEAHVMLE--DSFEKWIRTACAIMRS--SGQLSLI  144 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~-~~~~~~~~~~~~a~~~~~--~~~~~~~~~a~~lLkp--gG~~~~i  144 (225)
                      ...+..|.++.|--+... +.....+... +.+....  .....+.+.+...++.  +|++..+
T Consensus        77 ~~~g~iD~lInnAG~~~~~~~~~~~~~~~-~~~~~~vNl~~~~~~~~~~~p~m~~~~~G~Iini  139 (250)
T PRK07231         77 ERFGSVDILVNNAGTTHRNGPLLDVDEAE-FDRVYAVNVKSIYLWAQAAVPAWRGEGGGAIVNV  139 (250)
T ss_pred             HHHCCCCEEEECCCCCCCCCCHHHCCHHH-HHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             98199719998883378998927699999-9999999989999999999999998399649999


No 334
>PRK07479 consensus
Probab=81.23  E-value=3.9  Score=20.00  Aligned_cols=127  Identities=18%  Similarity=0.146  Sum_probs=71.2

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---C
Q ss_conf             55789995878438999999867--998899998898999988999998066452225302004442353100001---2
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---G   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---~   85 (225)
                      +|..+|=-|++.| ++..+|+++  .+++|+..+.+++.++.+.+.+...+     .++..+.+|+.+......+.   .
T Consensus         4 ~gK~alITGgs~G-IG~a~a~~la~~G~~V~i~~~~~~~~~~~~~~l~~~g-----~~~~~~~~Dv~~~~~~~~~~~~~~   77 (252)
T PRK07479          4 SGKVAIVTGAGSG-FGEGIAKRFAREGAKVVVADLNAAAAERVASEIADAG-----GNAIAVAADVSRGADVEALVEAAL   77 (252)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC-----CCEEEEECCCCCHHHHHHHHHHHH
T ss_conf             9988999388768-9999999999879999999798999999999998539-----978999925899999999999999


Q ss_pred             CCCCCCCEEEECCCCCCC-CCCCCCC--HHHHHHHCCCCCCHHHHHHHHHHHCCC--CCEEEEE
Q ss_conf             357652057722654464-4654788--545565205668989999999986246--9837870
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNER-IGTMTPD--KIKEEAHVMLEDSFEKWIRTACAIMRS--SGQLSLI  144 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~-~~~~~~~--~~~~~a~~~~~~~~~~~~~~a~~lLkp--gG~~~~i  144 (225)
                      ...+..|.++.|..+... ......+  .....-...... .....+.+...++.  +|++..+
T Consensus        78 ~~~G~iD~lVnnAG~~~~~~~~~~~~~~~~~~~~~vNl~~-~~~~~~~~~p~m~~~~~G~Iv~i  140 (252)
T PRK07479         78 EAFGRVDIVVNNAGTTHRNKPMLDVTEAEFDRVYAVNVKS-IYLSTRHFVPHFRAQGGGVIINI  140 (252)
T ss_pred             HHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHH-HHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             9819985999899766899882769999999999998631-05654440498986799729998


No 335
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated
Probab=81.21  E-value=3.9  Score=19.99  Aligned_cols=120  Identities=13%  Similarity=0.045  Sum_probs=66.2

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---C
Q ss_conf             55789995878438999999867--998899998898999988999998066452225302004442353100001---2
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---G   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---~   85 (225)
                      +|.++|=-|++.| ++..+|+++  .+++|+++|.+.+.+..             ..++.....|+.+........   .
T Consensus         7 ~gK~alITG~s~G-IG~aia~~la~~Ga~V~~~~r~~~~l~~-------------~~~~~~~~~Dv~~~~~v~~~~~~~~   72 (253)
T PRK08220          7 SGKTVWVTGAAQG-IGYAVALAFVEAGAKVIGFDQAFEQLNE-------------QYPFATFVLDVADAAAVAQVCQRLL   72 (253)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHC-------------CCCEEEEEEECCCHHHHHHHHHHHH
T ss_conf             9998999588568-9999999999879999999788778748-------------9977999973799999999999999


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHC-CCCCCHHHHHHHHHHHCCC--CCEEEEE
Q ss_conf             357652057722654464465478854556520-5668989999999986246--9837870
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHV-MLEDSFEKWIRTACAIMRS--SGQLSLI  144 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~-~~~~~~~~~~~~a~~lLkp--gG~~~~i  144 (225)
                      ...+..|.++.|.-....+.....+........ ........+.+.+...++.  +|++..+
T Consensus        73 ~~~g~iDilVnnAG~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~p~m~~~~~G~IV~i  134 (253)
T PRK08220         73 AETGPLDVLVNVAGVLRMGATDSLSDEDWQQTFAVNAGGVFNLSRAVMPQFRRQRGGAIVTV  134 (253)
T ss_pred             HHCCCCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             97399888998998789998044999999999999746389999999987777389659999


No 336
>PRK08267 short chain dehydrogenase; Provisional
Probab=80.64  E-value=4  Score=19.88  Aligned_cols=122  Identities=13%  Similarity=-0.030  Sum_probs=64.8

Q ss_pred             EEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCC-C---CCCC
Q ss_conf             89995878438999999867--9988999988989999889999980664522253020044423531000-0---1235
Q gi|255764482|r   14 HLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRN-L---AGLK   87 (225)
Q Consensus        14 ~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~-~---~~~~   87 (225)
                      .||=-|+++| ++..+|+++  .+++|+.+|.+++.++...+.+.       ..+......|+.+...... +   ....
T Consensus         3 ~vlITGassG-IG~a~A~~~a~~G~~V~~~~r~~~~l~~~~~~l~-------~~~~~~~~~Dvtd~~~v~~~~~~~~~~~   74 (258)
T PRK08267          3 SIFITGAASG-IGRATARLFAARGWRVGAYDINEDGLAALAAELG-------AERAWTGALDVTDRAAWDAALADFCAAT   74 (258)
T ss_pred             EEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHC-------CCCEEEEEECCCCHHHHHHHHHHHHHHH
T ss_conf             8999072268-9999999999879999999888999999999836-------9967999911799999999999999995


Q ss_pred             CCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHH--HHHHHHHHHCCC--CCEEEEE
Q ss_conf             76520577226544644654788545565205668989--999999986246--9837870
Q gi|255764482|r   88 NNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFE--KWIRTACAIMRS--SGQLSLI  144 (225)
Q Consensus        88 ~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~--~~~~~a~~lLkp--gG~~~~i  144 (225)
                      .+..|.++.|.-+...+.....+... ..+....+..-  ..++.+..+++.  +|.+..+
T Consensus        75 ~G~iDiLVNNAGi~~~~~~~~~~~e~-~~~~~~vNl~g~~~~~~~~lp~m~~~~~g~Ivni  134 (258)
T PRK08267         75 GGRLDVLFNNAGILRGGPFEDIPLEA-HDRVIDINVKGVLNGAYAALPYLKATPGARVINT  134 (258)
T ss_pred             CCCCCEEEECCCCCCCCCHHHCCHHH-HHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             89986899888779998824499999-9999999739999999999999997799279999


No 337
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=80.48  E-value=4.1  Score=19.85  Aligned_cols=128  Identities=20%  Similarity=0.099  Sum_probs=71.9

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---
Q ss_conf             855789995878438999999867--998899998898999988999998066452225302004442353100001---
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---   84 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---   84 (225)
                      -+|..+|=-|++.|. +..+|..+  .+++|..++.+++.++.+.+.++..+     .+..+...|+.+........   
T Consensus         4 L~gKvalITGas~GI-G~aiA~~la~~Ga~V~l~~r~~~~l~~~~~~i~~~g-----~~~~~~~~Dvtd~~~v~~~v~~~   77 (238)
T PRK07666          4 LQGKNALITGAGRGI-GRAVAIALAKEGVNVGLLARSEENLKAVAKEVEAEG-----VKAVIATADVSDYEEVTTAIETL   77 (238)
T ss_pred             CCCCEEEEECCCCHH-HHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC-----CCEEEEEEECCCHHHHHHHHHHH
T ss_conf             999989991637789-999999999879989999899999999999999559-----92799993079999999999999


Q ss_pred             CCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCH--HHHHHHHHHHC--CCCCEEEEE
Q ss_conf             2357652057722654464465478854556520566898--99999999862--469837870
Q gi|255764482|r   85 GLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSF--EKWIRTACAIM--RSSGQLSLI  144 (225)
Q Consensus        85 ~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~--~~~~~~a~~lL--kpgG~~~~i  144 (225)
                      ...-+..|..+.|--....+.....+... +.+....+..  ....+.+...+  +.+|.+..+
T Consensus        78 ~~~~G~iDiLVNNAGi~~~~~~~~~~~e~-~~~~~~vNl~g~~~~~~~~lp~M~~~~~G~IIni  140 (238)
T PRK07666         78 KNGLGSIDILINNAGISKFGKFLELDVAE-WEKIIQVNLMGVYYVTRAVLPSMIEQQSGDIINI  140 (238)
T ss_pred             HHHHCCCCEEEECCCCCCCCCHHHCCHHH-HHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             99819987899847457999823399999-9999989629999999999999997499589998


No 338
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only]
Probab=80.43  E-value=4.1  Score=19.84  Aligned_cols=108  Identities=18%  Similarity=0.126  Sum_probs=61.8

Q ss_pred             CHHHCCCCCCCEEEEECC--CHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCC
Q ss_conf             624389985578999587--843899999986799889999889899998899999806645222530200444235310
Q gi|255764482|r    3 LASLVNATGSFHLADLGA--GAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGEN   80 (225)
Q Consensus         3 La~~~~~~~~~~VLDlGc--G~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~   80 (225)
                      |......++|++||=.|.  |.|.+++.+|+.... .++++-.+++-.+.+++    .+   .+..+...+.|+...   
T Consensus       134 l~~~~~l~~g~~VLv~gaaGgVG~~aiQlAk~~G~-~~v~~~~s~~k~~~~~~----lG---Ad~vi~y~~~d~~~~---  202 (326)
T COG0604         134 LFDRAGLKPGETVLVHGAAGGVGSAAIQLAKALGA-TVVAVVSSSEKLELLKE----LG---ADHVINYREEDFVEQ---  202 (326)
T ss_pred             HHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHCCC-CEEEEECCHHHHHHHHH----CC---CCEEEECCCCCHHHH---
T ss_conf             99761769999799977854699999999998499-58999817578899987----39---988970564248999---


Q ss_pred             CCCCCCCC-CCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHH
Q ss_conf             00012357-652057722654464465478854556520566898999999998624698378702888
Q gi|255764482|r   81 RNLAGLKN-NFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQ  148 (225)
Q Consensus        81 ~~~~~~~~-~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~  148 (225)
                        ...... ..+|+|+..                         .-.+.+..+...|+++|+++.+-...
T Consensus       203 --v~~~t~g~gvDvv~D~-------------------------vG~~~~~~~l~~l~~~G~lv~ig~~~  244 (326)
T COG0604         203 --VRELTGGKGVDVVLDT-------------------------VGGDTFAASLAALAPGGRLVSIGALS  244 (326)
T ss_pred             --HHHHHCCCCCCEEEEC-------------------------CCHHHHHHHHHHHCCCCEEEEEECCC
T ss_conf             --9998379987889979-------------------------86799999999742595899980688


No 339
>PRK07814 short chain dehydrogenase; Provisional
Probab=80.37  E-value=4.1  Score=19.83  Aligned_cols=127  Identities=20%  Similarity=0.194  Sum_probs=70.0

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCC---
Q ss_conf             55789995878438999999867--9988999988989999889999980664522253020044423531000012---
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAG---   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~---   85 (225)
                      ++..+|=-|.+.| ++..+|.++  .+++|+-.+.+++.++...+.++..+     .++..+.+|+.+......+..   
T Consensus         9 ~gKvalITGgs~G-IG~aia~~la~~Ga~V~i~~~~~~~l~~~~~~i~~~g-----~~~~~~~~Dv~~~~~v~~~v~~~~   82 (263)
T PRK07814          9 DGQVAVVTGAGRG-LGAAIALAFAEAGADVLIAARTESQLDEVAEQIRAAG-----RRAHVVAADLAHPEATAGLAGQAV   82 (263)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC-----CEEEEEECCCCCHHHHHHHHHHHH
T ss_conf             9998999589668-9999999999879989999698999999999998529-----928999815899999999999999


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCC--HHHHHHHHHHHC-CC--CCEEEEE
Q ss_conf             35765205772265446446547885455652056689--899999999862-46--9837870
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDS--FEKWIRTACAIM-RS--SGQLSLI  144 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~--~~~~~~~a~~lL-kp--gG~~~~i  144 (225)
                      ..-+..|..+.|--+.........+... +.+....+.  .....+.+..++ +.  +|++..+
T Consensus        83 ~~~G~iDiLVnNAg~~~~~~~~~~~~e~-w~~~~~vNl~~~~~~~~~~~~~m~~~~~~G~IIni  145 (263)
T PRK07814         83 EAFGRLDIVVNNVGGTMPNPLLSTSTKD-LADAFTFNVATAHALTRAAVPLMLEHSGGGSIINI  145 (263)
T ss_pred             HHHCCCCEEEECCCCCCCCCHHHCCHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             9829988999898667888445488999-99999997199999999999999984799469998


No 340
>COG2961 ComJ Protein involved in catabolism of external DNA [General function prediction only]
Probab=80.22  E-value=4.2  Score=19.80  Aligned_cols=120  Identities=15%  Similarity=0.231  Sum_probs=72.5

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             85578999587843899999986799889999889899998899999806645222530200444235310000123576
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNN   89 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~   89 (225)
                      .++++ |..-||+=-+.-.+.+  +.-++.++|+.|+-....+.|+.      .+.++.+.++|=....... +  .+.+
T Consensus        88 N~~~~-l~~YpGSP~lA~~llR--~qDRl~l~ELHp~D~~~L~~~f~------~d~~vrv~~~DG~~~l~a~-L--PP~e  155 (279)
T COG2961          88 NPGGG-LRYYPGSPLLARQLLR--EQDRLVLTELHPSDAPLLRNNFA------GDRRVRVLRGDGFLALKAH-L--PPKE  155 (279)
T ss_pred             CCCCC-CCCCCCCHHHHHHHCC--HHCEEEEEECCCCHHHHHHHHHC------CCCCEEEEECCCHHHHHHH-C--CCCC
T ss_conf             87888-0458999899998714--01003320048457999997627------7841478834718888621-8--9977


Q ss_pred             CCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCC--CCCEEEEECCH---HHHHHHHHHHHC
Q ss_conf             52057722654464465478854556520566898999999998624--69837870288---889999998521
Q gi|255764482|r   90 FYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMR--SSGQLSLIARP---QSLIQIVNACAR  159 (225)
Q Consensus        90 ~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLk--pgG~~~~i~~~---~~l~~~l~~~~~  159 (225)
                      +=-+|+-.|||-.                  ...+..+++...+.++  ++|..++=+|-   +++.+++..+..
T Consensus       156 rRglVLIDPPfE~------------------~~eY~rvv~~l~~~~kRf~~g~yaiWYPik~r~~~~~f~~~L~~  212 (279)
T COG2961         156 RRGLVLIDPPFEL------------------KDEYQRVVEALAEAYKRFATGTYAIWYPIKDRRQIRRFLRALEA  212 (279)
T ss_pred             CCEEEEECCCCCC------------------CCHHHHHHHHHHHHHHHHCCCEEEEEEEECCHHHHHHHHHHHHH
T ss_conf             6258995898666------------------21799999999999986248659999760034899999999763


No 341
>PRK07417 arogenate dehydrogenase; Reviewed
Probab=80.01  E-value=4.2  Score=19.76  Aligned_cols=40  Identities=15%  Similarity=0.117  Sum_probs=31.1

Q ss_pred             EEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHH
Q ss_conf             8999587843899999986799889999889899998899
Q gi|255764482|r   14 HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARK   53 (225)
Q Consensus        14 ~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~   53 (225)
                      +|+=+|+|-=+-|++++-+..+.+|+|+|.++..++.|++
T Consensus         3 kI~IiGlGLIGgSla~al~~~~~~V~g~d~~~~~~~~A~~   42 (280)
T PRK07417          3 NIGIVGLGLIGGSLGLDLRSLGHTVYGVSRRESTCERAIE   42 (280)
T ss_pred             EEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH
T ss_conf             8999931857999999999689979999799999999998


No 342
>PRK06720 hypothetical protein; Provisional
Probab=79.99  E-value=4.2  Score=19.76  Aligned_cols=86  Identities=13%  Similarity=0.112  Sum_probs=56.8

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---C
Q ss_conf             55789995878438999999867--998899998898999988999998066452225302004442353100001---2
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---G   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---~   85 (225)
                      +|..++=-|++.|. +..+|.++  .+++|.-.|++++..+...+.+...+     .+..+...|+..........   .
T Consensus        15 ~gKvalITGa~~GI-G~a~A~~la~~Ga~Vvi~d~~~~~~~~~~~~i~~~g-----~~a~~~~~Dvs~~~~v~~~i~~~~   88 (169)
T PRK06720         15 AGKVAIVTGGGIGI-GRNTALLLAKQGAKVIVTDIDQESGQATVEEITNLG-----GEALFVSYDMEKQGDWQRVISITL   88 (169)
T ss_pred             CCCEEEEECCCCHH-HHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHCC-----CCEEEEECCCCCHHHHHHHHHHHH
T ss_conf             99999998975489-999999999869989995276365999999999749-----953789758899999999999999


Q ss_pred             CCCCCCCEEEECCCCCC
Q ss_conf             35765205772265446
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNE  102 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~  102 (225)
                      ..-++.|..+-|.-...
T Consensus        89 ~~~g~iDiLvNNAGI~~  105 (169)
T PRK06720         89 NAFSRIDMLFQNAGLYK  105 (169)
T ss_pred             HHCCCCCEEEECCCCCC
T ss_conf             97598998998942178


No 343
>PRK06172 short chain dehydrogenase; Provisional
Probab=78.81  E-value=4.6  Score=19.54  Aligned_cols=85  Identities=20%  Similarity=0.149  Sum_probs=55.1

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---C
Q ss_conf             55789995878438999999867--998899998898999988999998066452225302004442353100001---2
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---G   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---~   85 (225)
                      +|+.+|=-|.+.| ++..+|+++  .+++|+..|.+++..+.+.+-++..+     .+..+++.|+.+......+.   .
T Consensus         6 ~gKvalVTGas~G-IG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~g-----~~~~~~~~Dvs~~~~v~~~~~~~~   79 (253)
T PRK06172          6 SGQVALVTGGAAG-IGRATAIAFAREGAKVVVADRDAAGGEETVALIREAG-----GEALFIACDVTRDAEVKALVEKTI   79 (253)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC-----CCEEEEECCCCCHHHHHHHHHHHH
T ss_conf             9998999375768-9999999999879989999798899999999999649-----937999818999999999999999


Q ss_pred             CCCCCCCEEEECCCCC
Q ss_conf             3576520577226544
Q gi|255764482|r   86 LKNNFYDHVIMNPPFN  101 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~  101 (225)
                      ...+..|..+.|--..
T Consensus        80 ~~~G~iDiLVNNAGi~   95 (253)
T PRK06172         80 AAYGRLDYAFNNAGIE   95 (253)
T ss_pred             HHCCCCCEEEECCCCC
T ss_conf             9829999999898889


No 344
>PRK05884 short chain dehydrogenase; Provisional
Probab=78.68  E-value=4.7  Score=19.52  Aligned_cols=121  Identities=15%  Similarity=0.132  Sum_probs=58.0

Q ss_pred             EEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             89995878438999999867--9988999988989999889999980664522253020044423531000012357652
Q gi|255764482|r   14 HLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFY   91 (225)
Q Consensus        14 ~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~f   91 (225)
                      +||=-|++.| +...+|+++  .+++|+-++.+++.++.+.+.+.          .+....|+.+..............+
T Consensus         2 ~VlVTGgs~G-IG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~el~----------~~~~~~d~~d~~~~~~~~~~~~~~~   70 (223)
T PRK05884          2 EVLVTGGDTD-LGRTIAEGFRNDGHKVTLVGARRDDLEVAAKELD----------VDAIVCDNTDPASLEEARGLFPHHL   70 (223)
T ss_pred             EEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCC----------CCEEEEECCCHHHHHHHHHHHHHHH
T ss_conf             3999878879-9999999999879999999598789999985348----------7689985278899999999999861


Q ss_pred             CEEEECC--CCCCCCCC--CCCCHHHHHHHCCCCCC--HHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             0577226--54464465--47885455652056689--8999999998624698378702
Q gi|255764482|r   92 DHVIMNP--PFNERIGT--MTPDKIKEEAHVMLEDS--FEKWIRTACAIMRSSGQLSLIA  145 (225)
Q Consensus        92 Dlii~nP--Py~~~~~~--~~~~~~~~~a~~~~~~~--~~~~~~~a~~lLkpgG~~~~i~  145 (225)
                      |.++-+.  .|......  ...+....+.+....+.  .....+.+...++.+|++..+.
T Consensus        71 d~lvn~~~~~~~~~~~~~~~~~d~~~~w~~~~~~nl~~~~~~~~~~~~~m~~~G~Iini~  130 (223)
T PRK05884         71 DTIVNVPAPSWDAGDPRTYSLADTANAWRNALDATVLSAVLTVQSVGDHLRSGGSIINVV  130 (223)
T ss_pred             CCEEEEEEEECCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEE
T ss_conf             947884123024787555621215999999999997999999999998615898799994


No 345
>pfam11968 DUF3321 Protein of unknown function (DUF3321). This family is conserved in fungi and is annotated as being a nucleolar protein.
Probab=78.47  E-value=4.8  Score=19.48  Aligned_cols=105  Identities=14%  Similarity=0.186  Sum_probs=58.7

Q ss_pred             CEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             78999587843899999986799889999889899998899999806645222530200444235310000123576520
Q gi|255764482|r   13 FHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFYD   92 (225)
Q Consensus        13 ~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~fD   92 (225)
                      -|+||+||=+--.   ...+..-..|+.||+++.--                   .+.+.|+....    ++....++||
T Consensus        54 lr~LEVGALst~N---~~S~~~~~dv~rIDLnSq~p-------------------~I~qqDFmerP----lP~~e~e~F~  107 (220)
T pfam11968        54 LRALEVGALSTKN---ACSKSGLFDVTRIDLNSQEP-------------------GILQQDFMERP----LPKDESEKFD  107 (220)
T ss_pred             CEEEEECCCCCCC---HHCCCCEEEEEEEECCCCCC-------------------CCHHHHHHHCC----CCCCCCCCCC
T ss_conf             3177554556421---22256747778852589998-------------------71443244077----8888311413


Q ss_pred             EEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCC-----EEEEECCH-----------HHHHHHHHH
Q ss_conf             57722654464465478854556520566898999999998624698-----37870288-----------889999998
Q gi|255764482|r   93 HVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSG-----QLSLIARP-----------QSLIQIVNA  156 (225)
Q Consensus        93 lii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG-----~~~~i~~~-----------~~l~~~l~~  156 (225)
                      +|.+.---+.-     |++          ..--+-+..+.+.|+|+|     .+.+|.|.           +++.++...
T Consensus       108 iISlSLVLNfV-----P~~----------~~RGeML~r~~~fL~~~~~~~~~~lFlVLPlpCv~NSRY~~~~~l~~im~s  172 (220)
T pfam11968       108 IISLSLVLNFV-----PDP----------ADRGEMLKRTTKFLRPPGPGSPPSLFLVLPLPCVTNSRYMDEERLQAIMSS  172 (220)
T ss_pred             EEEEEEEEECC-----CCH----------HHHHHHHHHHHHHHCCCCCCCCCEEEEEEEHHHHHCCCCCCHHHHHHHHHH
T ss_conf             58887777416-----987----------888699999999717997666632688732456404400199999999996


Q ss_pred             HH
Q ss_conf             52
Q gi|255764482|r  157 CA  158 (225)
Q Consensus       157 ~~  158 (225)
                      +.
T Consensus       173 lG  174 (220)
T pfam11968       173 LG  174 (220)
T ss_pred             CC
T ss_conf             79


No 346
>PRK12937 short chain dehydrogenase; Provisional
Probab=78.40  E-value=4.8  Score=19.47  Aligned_cols=129  Identities=16%  Similarity=0.090  Sum_probs=71.7

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHC--CCCEEEEE-ECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC--
Q ss_conf             855789995878438999999867--99889999-8898999988999998066452225302004442353100001--
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRL--HEAQILLA-ERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA--   84 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gv-D~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~--   84 (225)
                      ..|..+|=-|.+.| ++..+|+++  .+++|.-. ..+.+..+...+.++..     ..++..+++|+.+......+.  
T Consensus         3 ~sgK~alVTGgs~G-IG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~Dv~~~~~~~~~v~~   76 (245)
T PRK12937          3 DSNKVAIVTGASRG-IGAAIARRLAADGFAVAVNYAGSAAMADELVEEIEAA-----GGRAIAVQADVADAAAVDRLFEA   76 (245)
T ss_pred             CCCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHC-----CCCEEEEECCCCCHHHHHHHHHH
T ss_conf             99988999485778-9999999999879999997699868999999999965-----99589998378999999999999


Q ss_pred             -CCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCC--CCHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             -2357652057722654464465478854556520566--898999999998624698378702
Q gi|255764482|r   85 -GLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLE--DSFEKWIRTACAIMRSSGQLSLIA  145 (225)
Q Consensus        85 -~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~--~~~~~~~~~a~~lLkpgG~~~~i~  145 (225)
                       ....+..|..+.|............+... +.+....  .....+++.+...++.+|++..+-
T Consensus        77 ~~~~~g~iDilVnNAg~~~~~~~~~~~~e~-w~~~~~vNl~~~~~~~~~~~~~m~~~G~IInis  139 (245)
T PRK12937         77 AETAFGRIDVLVNSAGIMPLAPIADGDLEG-FDRTIAVNLRGAFNVLGEAARHLRRGGRIINLS  139 (245)
T ss_pred             HHHHHCCCCEEEEECCCCCCCCHHHCCHHH-HHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             999819988999805489998813499999-999999985999999999999997288299997


No 347
>TIGR00571 dam DNA adenine methylase; InterPro: IPR012326   In prokaryotes, the major role of DNA methylation is to protect host DNA against degradation by restriction enzymes. There are 2 major classes of DNA methyltransferase that differ in the nature of the modifications they effect. The members of one class (C-MTases) methylate a ring carbon and form C5-methylcytosine (see IPR001525 from INTERPRO). Members of the second class (N-MTases) methylate exocyclic nitrogens and form either N4-methylcytosine (N4-MTases) or N6-methyladenine (N6-MTases). Both classes of MTase utilise the cofactor S-adenosyl-L-methionine (SAM) as the methyl donor and are active as monomeric enzymes .   N-6 adenine-specific DNA methylases (2.1.1.72 from EC) (A-Mtase) are enzymes that specifically methylate the amino group at the C-6 position of adenines in DNA. Such enzymes are found in the three existing types of bacterial restriction-modification systems (in type I system the A-Mtase is the product of the hsdM gene, and in type III it is the product of the mod gene). All of these enzymes recognize a specific sequence in DNA and methylate an adenine in that sequence. It has been shown , , ,  that A-Mtases contain a conserved motif Asp/Asn-Pro-Pro-Tyr/Phe in their N-terminal section, this conserved region could be involved in substrate binding or in the catalytic activity. The structure of N6-MTase TaqI (M.TaqI) has been resolved to 2.4 A . The molecule folds into 2 domains, an N-terminal catalytic domain, which contains the catalytic and cofactor binding sites, and comprises a central 9-stranded beta-sheet, surrounded by 5 helices; and a C-terminal DNA recognition domain, which is formed by 4 small beta-sheets and 8 alpha-helices. The N- and C-terminal domains form a cleft that accommodates the DNA substrate. A classification of N-MTases has been proposed, based on conserved motif (CM) arrangements . According to this classification, N6-MTases that have a DPPY motif (CM II) occuring after the FxGxG motif (CM I) are designated D12 class N6-adenine MTases.; GO: 0009007 site-specific DNA-methyltransferase (adenine-specific) activity, 0006306 DNA methylation.
Probab=78.34  E-value=2.9  Score=20.66  Aligned_cols=37  Identities=19%  Similarity=0.270  Sum_probs=19.8

Q ss_pred             EEEEECCCHHHHHHHHHHHCCC-CEEEEEECCHHHHHH
Q ss_conf             8999587843899999986799-889999889899998
Q gi|255764482|r   14 HLADLGAGAGAAGLAVASRLHE-AQILLAERSPLMAHY   50 (225)
Q Consensus        14 ~VLDlGcG~G~~~l~la~r~~~-~~v~gvD~~~~~~~~   50 (225)
                      +..||.||+|++++.+....+. -.++--|++++.+++
T Consensus        33 ~~vEPFvGgGAv~~~~~~~~~~lk~~~l~DiN~dLi~~   70 (327)
T TIGR00571        33 CLVEPFVGGGAVFFNLNPKREELKDVLLSDINEDLINL   70 (327)
T ss_pred             EEECCCCCHHHHHHHHCCCCCCCCEEEEECCCHHHHHH
T ss_conf             45347641778876642687113401453288779999


No 348
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated
Probab=78.31  E-value=4.8  Score=19.45  Aligned_cols=73  Identities=16%  Similarity=0.141  Sum_probs=49.3

Q ss_pred             CCCCCEEEEECCCHHHHHHHHHHHC---CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCC
Q ss_conf             9855789995878438999999867---9988999988989999889999980664522253020044423531000012
Q gi|255764482|r    9 ATGSFHLADLGAGAGAAGLAVASRL---HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAG   85 (225)
Q Consensus         9 ~~~~~~VLDlGcG~G~~~l~la~r~---~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~   85 (225)
                      .+...+||=+|.. |.++-.|..|.   .+++|+|+|+..+.++.-.          ...+++|+++|+...   ..|..
T Consensus       312 ~~~~~~vlilgvn-gfig~hl~~~~l~~~~~~v~g~d~~~~~i~~~~----------~~p~~~f~~gdi~~~---~~wie  377 (660)
T PRK08125        312 AKRRTRVLILGVN-GFIGNHLTERLLRDDNYEVYGLDIGSDAISRFL----------GHPRFHFVEGDISIH---SEWIE  377 (660)
T ss_pred             CCCCEEEEEEECC-CHHHHHHHHHHHCCCCEEEEEEECCCCHHHHHH----------CCCCEEEEECCCHHH---HHHHH
T ss_conf             5652279998344-136789999985038858998865753455753----------499548881561466---89999


Q ss_pred             CCCCCCCEEE
Q ss_conf             3576520577
Q gi|255764482|r   86 LKNNFYDHVI   95 (225)
Q Consensus        86 ~~~~~fDlii   95 (225)
                      ....+.|.|+
T Consensus       378 ~~ikkcdvvl  387 (660)
T PRK08125        378 YHIKKCDVVL  387 (660)
T ss_pred             HHHHHCCEEE
T ss_conf             8875457673


No 349
>PRK08340 glucose-1-dehydrogenase; Provisional
Probab=77.96  E-value=4.9  Score=19.39  Aligned_cols=81  Identities=20%  Similarity=0.172  Sum_probs=52.6

Q ss_pred             EEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---CCCC
Q ss_conf             89995878438999999867--998899998898999988999998066452225302004442353100001---2357
Q gi|255764482|r   14 HLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---GLKN   88 (225)
Q Consensus        14 ~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---~~~~   88 (225)
                      +||=-|++.| ++..+|+++  .+++|+..+.+++.++.+.+.+...+      ++..++.|+.+......+.   ....
T Consensus         2 nVlITGas~G-IG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~~l~~~g------~~~~~~~Dv~~~~~v~~~v~~~~~~~   74 (259)
T PRK08340          2 NVLVTASSRG-IGFNVARELLKKGARVVISSRNEENLEKALKELKELG------EVYAIKADLSDKDDLKNLVKEAWELL   74 (259)
T ss_pred             EEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC------CEEEEEEECCCHHHHHHHHHHHHHHH
T ss_conf             8999758778-9999999999879999999799899999999987418------87999963699899999999999985


Q ss_pred             CCCCEEEECCCCC
Q ss_conf             6520577226544
Q gi|255764482|r   89 NFYDHVIMNPPFN  101 (225)
Q Consensus        89 ~~fDlii~nPPy~  101 (225)
                      +..|..+.|.+..
T Consensus        75 G~iD~LVnNAg~~   87 (259)
T PRK08340         75 GGIDALVWNAGNV   87 (259)
T ss_pred             CCCCEEEECCCCC
T ss_conf             9988899857667


No 350
>pfam06859 Bin3 Bicoid-interacting protein 3 (Bin3). This family represents a conserved region of approximately 120 residues within eukaryotic Bicoid-interacting protein 3 (Bin3). Bin3, which shows similarity to a number of protein methyltransferases that modify RNA-binding proteins, interacts with Bicoid, which itself directs pattern formation in the early Drosophila embryo. The interaction might allow Bicoid to switch between its dual roles in transcription and translation. Note that family members contain a conserved HLN motif.
Probab=77.50  E-value=5.1  Score=19.32  Aligned_cols=49  Identities=14%  Similarity=0.379  Sum_probs=29.7

Q ss_pred             CCCCHHHHHHHHHHHCCCCCEEEEECCHHHHHH----HHHHHHCCCCCEEEEE
Q ss_conf             668989999999986246983787028888999----9998521788469998
Q gi|255764482|r  120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQ----IVNACARRIGSLEITP  168 (225)
Q Consensus       120 ~~~~~~~~~~~a~~lLkpgG~~~~i~~~~~l~~----~l~~~~~~~~~~~i~~  168 (225)
                      .+..+..++..+.++|+|||.+.+--.++.-+.    +-+.....+...+++|
T Consensus        19 GD~Gl~~~f~~~~~~l~pgg~lilEpQ~w~sY~k~kkl~~~~~~ny~~I~~rP   71 (110)
T pfam06859        19 GDEGLKRFFRRIYRLLRPGGILILEPQPWDSYKKRKKLSETIYKNYERIKLKP   71 (110)
T ss_pred             CCHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHCCHHHHHHHHHHEECH
T ss_conf             42889999999999618898899967884668877314799985355427787


No 351
>PRK08628 short chain dehydrogenase; Provisional
Probab=77.33  E-value=5.1  Score=19.29  Aligned_cols=125  Identities=18%  Similarity=0.195  Sum_probs=67.7

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC---CC
Q ss_conf             55789995878438999999867--99889999889899998899999806645222530200444235310000---12
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL---AG   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~---~~   85 (225)
                      +|..+|=-|++.| ++..+|+++  .++.++.++.++...+.+.+. ..     ...+..++..|+.+......+   ..
T Consensus         6 ~gKvalVTG~s~G-IG~a~a~~la~~Ga~v~i~~~~~~~~~~~~~~-~~-----~~~~~~~~~~Dvs~~~~v~~~v~~~~   78 (258)
T PRK08628          6 KDKVVIVTGGASG-IGAAISLRLAEEGAIPVVFGRSAPDDEFAEEL-RA-----LQPRAEFVQVDLQDDAQCRDAVAQTV   78 (258)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCCCHHHHHHHH-HH-----CCCCEEEEEEECCCHHHHHHHHHHHH
T ss_conf             9998999277778-99999999998799899980880239999999-95-----39978999952799999999999999


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCC--CHHHHHHHHHHHCCCC-CEEEEE
Q ss_conf             3576520577226544644654788545565205668--9899999999862469-837870
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLED--SFEKWIRTACAIMRSS-GQLSLI  144 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~--~~~~~~~~a~~lLkpg-G~~~~i  144 (225)
                      ...+..|..+.|.-.............  +.+....+  ......+.+..+|+.+ |.+..+
T Consensus        79 ~~~g~iDiLVnnAGi~~~~~~e~~~e~--~~~~~~~Nl~~~~~l~~~~~p~l~~~~GsIIni  138 (258)
T PRK08628         79 AKFGRIDGLVNNAGVNDGVGLDAGRDA--FVASLERNLIHYYVMAHYCLPHLKASRGAIVNI  138 (258)
T ss_pred             HHHCCCCEEEECCCCCCCCCCCCCHHH--HHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEE
T ss_conf             982998899988822788777899999--999999874999999999999888549549998


No 352
>PRK06914 short chain dehydrogenase; Provisional
Probab=76.93  E-value=5.3  Score=19.22  Aligned_cols=128  Identities=16%  Similarity=0.069  Sum_probs=70.3

Q ss_pred             CCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC--CCC
Q ss_conf             5789995878438999999867--998899998898999988999998066452225302004442353100001--235
Q gi|255764482|r   12 SFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA--GLK   87 (225)
Q Consensus        12 ~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~--~~~   87 (225)
                      +..+|=-||++|. +..+|.++  .+++|++...+++..+.....+...+   ....+.+...|+.+........  -..
T Consensus         3 ~K~alITGassGI-G~a~A~~la~~G~~V~~~~r~~~~~~~l~~~~~~~~---~~~~~~~~~~Dvtd~~~v~~~~~~~~~   78 (280)
T PRK06914          3 KKIAIITGASSGF-GLLTTLELAKKDYLVIATMRNLEKQENLISQAAQLN---LSQNIKVQQLDVTDQNSIHNFQLFLKE   78 (280)
T ss_pred             CCEEEEECCCCHH-HHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC---CCCCEEEEECCCCCHHHHHHHHHHHHH
T ss_conf             1989990734499-999999999879989999898899999999999649---997669996889999999999999998


Q ss_pred             CCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCC--HHHHHHHHHHHCC--CCCEEEEE
Q ss_conf             765205772265446446547885455652056689--8999999998624--69837870
Q gi|255764482|r   88 NNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDS--FEKWIRTACAIMR--SSGQLSLI  144 (225)
Q Consensus        88 ~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~--~~~~~~~a~~lLk--pgG~~~~i  144 (225)
                      .+..|+.+.|.-+...+.....+... ..+....+.  .....+.+...++  .+|++..+
T Consensus        79 ~g~iDvLVNNAG~~~~~~~~~~~~~~-~~~~~~vN~~g~~~~~~~~lp~m~~~~~G~Ivni  138 (280)
T PRK06914         79 YGRIDLLVNNAGYANGGFVEEIPVEE-YRKQFETNVFGAISVTQAVLPYMRKQKSGKIINI  138 (280)
T ss_pred             HCCCCEEEECCCCCCCCCHHCCCHHH-HHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             29987899788667787421177999-9999987128999899999787775699589998


No 353
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional
Probab=76.71  E-value=5.4  Score=19.19  Aligned_cols=127  Identities=17%  Similarity=0.089  Sum_probs=71.1

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC---CC
Q ss_conf             55789995878438999999867--99889999889899998899999806645222530200444235310000---12
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL---AG   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~---~~   85 (225)
                      +|..+|=-|++.| ++..+|+++  .+++|+..+.+++.++.+.+.+...+     .++..++.|+.+.......   ..
T Consensus         3 ~gK~alITGas~G-IG~aia~~la~~Ga~V~~~~~~~~~~~~~~~~~~~~g-----~~~~~~~~D~~~~~~v~~~~~~~~   76 (258)
T PRK12429          3 KGKTALVTGAASG-IGLEIALALAKEGAKVVIADLNDEAAAKAAEAIKKAG-----GKAIGVAMDVTDEEAINAGIDKVV   76 (258)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC-----CCEEEEECCCCCHHHHHHHHHHHH
T ss_conf             9598999488758-9999999999879999999798899999999998449-----918999835899999999999999


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCH--HHHHHHCCCCCCHHHHHHHHHHHCC--CCCEEEEE
Q ss_conf             35765205772265446446547885--4556520566898999999998624--69837870
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIGTMTPDK--IKEEAHVMLEDSFEKWIRTACAIMR--SSGQLSLI  144 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~~~~~~~--~~~~a~~~~~~~~~~~~~~a~~lLk--pgG~~~~i  144 (225)
                      ..-+..|.++.|-.+...+.....+.  ....-...... ...+.+.+...++  .+|++..+
T Consensus        77 ~~~g~iDiLVnnAG~~~~~~~~~~~~~~~~~~~~vNl~~-~~~~~~~~~p~m~~~~~G~Iv~i  138 (258)
T PRK12429         77 ETFGGVDILVNNAGIQHVAPIEDFPTEKWKKMIAIMLDG-AFLTTKAALPHMKAQKWGRIINM  138 (258)
T ss_pred             HHHCCCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHH-HEEEHHHHHHHHHHCCCCEEEEE
T ss_conf             982997099989988899881559999999999976232-12200677776643599289998


No 354
>PRK12746 short chain dehydrogenase; Provisional
Probab=76.20  E-value=5.5  Score=19.11  Aligned_cols=129  Identities=17%  Similarity=0.159  Sum_probs=73.6

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEE-EECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCC--
Q ss_conf             55789995878438999999867--9988999-988989999889999980664522253020044423531000012--
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILL-AERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAG--   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~g-vD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~--   85 (225)
                      +|..++=-|+..| ++..+|.++  .+++|+- .+.+++..+.+.+.++..+     .+..++++|+...........  
T Consensus         5 ~gKvalITGga~G-IG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~Dv~~~~~~~~~~~~~   78 (254)
T PRK12746          5 DGKVALVTGASRG-IGRAIAMRLANDGALVAIHYGRNKAAADETIREIESNG-----GKAFLIEADLNSIDGVKKLVEQL   78 (254)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCC-----CCEEEEECCCCCHHHHHHHHHHH
T ss_conf             9988999484768-99999999998799999965999899999999998559-----92899975779999999999999


Q ss_pred             -------CCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCC-CCCHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             -------35765205772265446446547885455652056-6898999999998624698378702
Q gi|255764482|r   86 -------LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-EDSFEKWIRTACAIMRSSGQLSLIA  145 (225)
Q Consensus        86 -------~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~-~~~~~~~~~~a~~lLkpgG~~~~i~  145 (225)
                             ...+..|..+.|.-..........+.......... ......+.+.+..+++.+|++..+-
T Consensus        79 ~~~~~~~~g~g~iDiLVnnAg~~~~~~~~~~~~~~~~~~~~vNl~~~f~~~k~~~p~m~~~G~IVnis  146 (254)
T PRK12746         79 KNELQIRVGTSEIDILVNNAGIGTQGTIENTTEEIFDEIMAVNIKAPFFLIQQTLPLLRAEGRVINIS  146 (254)
T ss_pred             HHHHHHHCCCCCCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEE
T ss_conf             99986641689851899799788999914499999999999853468999999999986169669992


No 355
>PRK07825 short chain dehydrogenase; Provisional
Probab=76.02  E-value=5.6  Score=19.08  Aligned_cols=123  Identities=15%  Similarity=0.088  Sum_probs=66.2

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC---CC
Q ss_conf             55789995878438999999867--99889999889899998899999806645222530200444235310000---12
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL---AG   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~---~~   85 (225)
                      +|+.|+=-|+++|. +..+|+++  .+++|+..|.+++.++.....+         .+......|+.+.......   ..
T Consensus         4 ~gKvvlITGassGI-G~a~A~~la~~Ga~V~i~~r~~~~l~~~~~~~---------~~~~~~~~DVtd~~~v~~~~~~~~   73 (273)
T PRK07825          4 RGKVIAITGGARGI-GLATARALAALGAKVAIGDLDEALAKESAAEL---------GLVVGGPLDVTDPASFAAFLDAVE   73 (273)
T ss_pred             CCCEEEEECCCCHH-HHHHHHHHHHCCCEEEEEECCHHHHHHHHHHC---------CCCEEEECCCCCHHHHHHHHHHHH
T ss_conf             99889992623399-99999999987998999979999999999860---------785599914799999999999999


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHH--HHHHHHHHHCCC--CCEEEEE
Q ss_conf             3576520577226544644654788545565205668989--999999986246--9837870
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFE--KWIRTACAIMRS--SGQLSLI  144 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~--~~~~~a~~lLkp--gG~~~~i  144 (225)
                      ...+..|..+.|.-....+.....+... ..+....+..-  ..++.+...++.  +|.+..+
T Consensus        74 ~~~G~iDiLVNNAGi~~~~~~~e~~~e~-~~~~~~vNl~g~~~~~~~~lp~M~~~~~G~IVni  135 (273)
T PRK07825         74 ADLGPIDVLVNNAGIMPVGPFLDEPDRA-TRRILDVNVYGVILGSKLAAPRMVPRGRGHIVNV  135 (273)
T ss_pred             HHHCCCCEEEECCCCCCCCCHHHCCHHH-HHHHHHHCCHHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             9709977899878778998734399999-9999886039999999999999997399479998


No 356
>PRK05875 short chain dehydrogenase; Provisional
Probab=75.84  E-value=5.7  Score=19.05  Aligned_cols=87  Identities=20%  Similarity=0.127  Sum_probs=56.1

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---C
Q ss_conf             55789995878438999999867--998899998898999988999998066452225302004442353100001---2
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---G   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---~   85 (225)
                      ++..+|=-|++.| ++..+|.++  .+++|+.++.+++.++.+.+.+.....  ....+....+|+.+........   .
T Consensus         6 ~gK~alVTGas~G-IG~aiA~~la~~Ga~Vii~~r~~~~l~~~~~~l~~~~~--~~~~v~~~~~Dvs~~~~v~~~v~~~~   82 (277)
T PRK05875          6 QDRTYLVTGGGSG-IGKGVAAALVAAGAAVMIVGRNPDKLAAAAEEIEALAG--GAGAVRYEPADVTNEDEVARAVDAAT   82 (277)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCC--CCCEEEEEECCCCCHHHHHHHHHHHH
T ss_conf             9998999488749-99999999998799899997988999999999996127--88628999578999999999999999


Q ss_pred             CCCCCCCEEEECCCC
Q ss_conf             357652057722654
Q gi|255764482|r   86 LKNNFYDHVIMNPPF  100 (225)
Q Consensus        86 ~~~~~fDlii~nPPy  100 (225)
                      ...++.|.++.|.-.
T Consensus        83 ~~~g~iD~LVnnAg~   97 (277)
T PRK05875         83 AWHGRLHGVVHCAGG   97 (277)
T ss_pred             HHHCCCEEEEECCCC
T ss_conf             984995399987813


No 357
>PRK06346 consensus
Probab=75.31  E-value=5.9  Score=18.97  Aligned_cols=127  Identities=16%  Similarity=0.109  Sum_probs=71.0

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---C
Q ss_conf             55789995878438999999867--998899998898999988999998066452225302004442353100001---2
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---G   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---~   85 (225)
                      +|..++=-|.+.| ++..+|+++  .+++|+-+|.+++.++.+...+..++     .++..+.+|+.+........   .
T Consensus         4 ~gKv~lITGgs~G-IG~a~a~~la~~Ga~V~i~~r~~e~~~~~~~~l~~~~-----~~~~~~~~Dv~~~~~v~~~i~~~~   77 (251)
T PRK06346          4 KGKVAIVTGAASG-MGKSIAELFAKEGAKVVVADLNLERAQKVVEEITSNG-----GTAIAVVANVTKQEDIENMVDTAV   77 (251)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC-----CEEEEEECCCCCHHHHHHHHHHHH
T ss_conf             9988999475788-9999999999879989999798999999999999639-----908999778898999999999999


Q ss_pred             CCCCCCCEEEECCCCCCCCC-CCCCCHHHHHHHCCCCCC--HHHHHHHHHHHC--CCCCEEEEE
Q ss_conf             35765205772265446446-547885455652056689--899999999862--469837870
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIG-TMTPDKIKEEAHVMLEDS--FEKWIRTACAIM--RSSGQLSLI  144 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~-~~~~~~~~~~a~~~~~~~--~~~~~~~a~~lL--kpgG~~~~i  144 (225)
                      ..-+..|.++.|.-...... ....+... +.+....+.  .....+.+...+  +.+|++..+
T Consensus        78 ~~fg~iDiLVnNAgi~~~~~~~~~~~~e~-w~~~~~vNl~g~~~~~~~~~p~m~~~~~G~IIni  140 (251)
T PRK06346         78 DTYGTLDILVNNAGIMDNFVPVGELTDEL-WDKVFAVNTTGVMRATRKALPIFEEKGSGVIVNI  140 (251)
T ss_pred             HHCCCCCEEEECCCCCCCCCCHHHCCHHH-HHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             98299979998998899998711289999-9999999709999999999999998599549999


No 358
>PRK06227 consensus
Probab=75.16  E-value=5.9  Score=18.95  Aligned_cols=127  Identities=16%  Similarity=0.094  Sum_probs=71.2

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---C
Q ss_conf             55789995878438999999867--998899998898999988999998066452225302004442353100001---2
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---G   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---~   85 (225)
                      +|..+|=-|.+.| ++..+|+++  .+++|+-.|.+++......+.++..+     .++.++++|+.+......+.   .
T Consensus         4 ~gKvalVTGas~G-IG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~g-----~~~~~~~~Dvs~~~~v~~~~~~~~   77 (256)
T PRK06227          4 SGKVAIVTGGGQG-IGAAIAQTFAENGAKVVIADIDEEAGLEREEMLRSNG-----LDALFVKTDVSDEEDVKNMVRKTV   77 (256)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC-----CCEEEEECCCCCHHHHHHHHHHHH
T ss_conf             9988999586688-9999999999879999999698889999999999559-----918999816899999999999999


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCH--HHHHHHHHHHCCC--CCEEEEE
Q ss_conf             357652057722654464465478854556520566898--9999999986246--9837870
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSF--EKWIRTACAIMRS--SGQLSLI  144 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~--~~~~~~a~~lLkp--gG~~~~i  144 (225)
                      ...+..|.++.|.-..........+... +.+....+..  ....+.+.+.++.  +|++..+
T Consensus        78 ~~~G~iDiLVNNAGi~~~~~~~~~~~e~-w~~~~~vNl~g~f~~~~~~~p~m~~~~~G~IVni  139 (256)
T PRK06227         78 ERYGGIDILINNAGIFSGKSIFERTLEE-WERVIRVNLTGPYLCSKYAAEEMIKNGGGVIINI  139 (256)
T ss_pred             HHCCCCCEEEECCCCCCCCCHHHCCHHH-HHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             9829997999899899998903498999-9999999829999999999999998499779996


No 359
>PRK08945 short chain dehydrogenase; Provisional
Probab=75.15  E-value=5.9  Score=18.94  Aligned_cols=128  Identities=16%  Similarity=0.098  Sum_probs=68.8

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCC-----CCC
Q ss_conf             55789995878438999999867--99889999889899998899999806645222530200444235310-----000
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGEN-----RNL   83 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~-----~~~   83 (225)
                      +|..||=-|++.| ++..+|+++  .+++|+.++.+++.++.+.+.+...+.    .+..+...|+......     ...
T Consensus        12 ~gK~~lITGas~G-IG~aiA~~la~~Ga~Vil~~r~~~~l~~~~~el~~~~~----~~~~~~~~d~~~~~~~~~~~~~~~   86 (245)
T PRK08945         12 KDRIILVTGAGDG-IGREAALTYARHGATVILLGRTEEKLEAVYDEIEAAGG----PQPAIIPLDLLGATEQNYQDLADT   86 (245)
T ss_pred             CCCEEEEECCCHH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCC----CCEEEEEEECCCCCHHHHHHHHHH
T ss_conf             9798999488618-99999999998799899996988999999999997479----844899944675999999999999


Q ss_pred             CCCCCCCCCEEEECCCCCCC-CCCCCCCHHHHHHHCCCCCCH--HHHHHHHHHHCC--CCCEEEEE
Q ss_conf             12357652057722654464-465478854556520566898--999999998624--69837870
Q gi|255764482|r   84 AGLKNNFYDHVIMNPPFNER-IGTMTPDKIKEEAHVMLEDSF--EKWIRTACAIMR--SSGQLSLI  144 (225)
Q Consensus        84 ~~~~~~~fDlii~nPPy~~~-~~~~~~~~~~~~a~~~~~~~~--~~~~~~a~~lLk--pgG~~~~i  144 (225)
                      .....+..|.++.|--+... ......+.. .+.+....+..  ....+.+..+++  .+|++.++
T Consensus        87 i~~~~g~iD~lVnNAG~~~~~~~~~~~~~~-~~~~~~~vNl~g~~~l~~~~~p~m~~~~~G~Ii~i  151 (245)
T PRK08945         87 IEEQFGRLDGVLHNAGLLGELGPMEQQDPE-VWQDVMQVNVNATFMLTQALLPLLLKSPAASLVFT  151 (245)
T ss_pred             HHHHHCCCCEEEECCCCCCCCCCHHHCCHH-HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             999809987999888755789882669999-99998756759999999999999987799789997


No 360
>PRK06124 gluconate 5-dehydrogenase; Provisional
Probab=74.42  E-value=6.2  Score=18.84  Aligned_cols=128  Identities=17%  Similarity=0.105  Sum_probs=71.4

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---C
Q ss_conf             55789995878438999999867--998899998898999988999998066452225302004442353100001---2
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---G   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---~   85 (225)
                      +|..+|=-|++.| ++..+|+.+  .+++|+-.+.+++-++.+.+.+...+     .++....+|+.+........   .
T Consensus        13 ~gK~alITGgs~G-IG~~ia~~la~~Ga~V~i~~r~~~~~~~~~~~l~~~g-----~~~~~~~~Dv~~~~~v~~~~~~~~   86 (259)
T PRK06124         13 AGQVALVTGSARG-LGLEIARALAEAGAHVLVNGRNAARVEAAVAALRAAG-----GAAEALVFDISDEEAVAAAFARID   86 (259)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC-----CCEEEEEECCCCHHHHHHHHHHHH
T ss_conf             9998999286748-9999999999879999999698899999999999659-----958999951799999999999999


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCC-CCHHHHHHHHHHHCCCC--CEEEEE
Q ss_conf             357652057722654464465478854556520566-89899999999862469--837870
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLE-DSFEKWIRTACAIMRSS--GQLSLI  144 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~-~~~~~~~~~a~~lLkpg--G~~~~i  144 (225)
                      ...+..|..+-|--...................... .......+.+...++.+  |++..+
T Consensus        87 ~~~g~iDiLVnnAG~~~~~~~~~~~~e~~~~~~~~Nl~g~~~~~q~~~~~M~~~~~G~IIni  148 (259)
T PRK06124         87 AEHGRLDILVNNVGARNRRPLAELDDAEIRALLETDLVAPILLSRLAAQRMVRQGYGRIIAI  148 (259)
T ss_pred             HHCCCCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             97599979998988899999066999999999999849999999999999877699369997


No 361
>PRK07063 short chain dehydrogenase; Provisional
Probab=73.91  E-value=6.4  Score=18.76  Aligned_cols=128  Identities=20%  Similarity=0.143  Sum_probs=71.8

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---C
Q ss_conf             55789995878438999999867--998899998898999988999998066452225302004442353100001---2
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---G   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---~   85 (225)
                      +|..+|=-|.+.| ++..+|+++  .+++|+..|++++.++.+.+.+...    ...++..++.|+.+........   .
T Consensus         6 ~gKvalVTGa~~G-IG~aiA~~~a~~Ga~V~i~~~~~~~~~~~~~~l~~~----~g~~~~~~~~Dvt~~~~v~~~v~~~~   80 (259)
T PRK07063          6 AGKVALVTGAAQG-IGAAIARAFVREGAAVALADLDAALAERAAAAIARQ----TGARVLALPADVTRAASVRAAVARAE   80 (259)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHH----CCCEEEEEECCCCCHHHHHHHHHHHH
T ss_conf             9988999587878-999999999987998999979878999999999885----09918999836899999999999999


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCC--HHHHHHHHHHHCCC--CCEEEEE
Q ss_conf             35765205772265446446547885455652056689--89999999986246--9837870
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDS--FEKWIRTACAIMRS--SGQLSLI  144 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~--~~~~~~~a~~lLkp--gG~~~~i  144 (225)
                      ...+..|..+.|.-............. .+.+....+.  .....+.+...++.  +|.+..+
T Consensus        81 ~~~G~iDiLVNNAG~~~~~~~~~~~~e-~w~~~~~vNl~g~f~~~~~~~p~m~~~~~G~IVni  142 (259)
T PRK07063         81 AAFGPLDVLVNNAGINVFADPLAMTDE-DWRRCFAVDLDGAWNCCRAVLPGMVERGRGSIVNI  142 (259)
T ss_pred             HHHCCCCEEEECCCCCCCCCHHHCCHH-HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             981998899989977899990449999-99999987528899999999999998699669998


No 362
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism]
Probab=73.81  E-value=6.4  Score=18.75  Aligned_cols=75  Identities=23%  Similarity=0.309  Sum_probs=47.3

Q ss_pred             CEEEEECCCHHHHHHHHHHH---CCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             78999587843899999986---799889999889899998899999806645222530200444235310000123576
Q gi|255764482|r   13 FHLADLGAGAGAAGLAVASR---LHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNN   89 (225)
Q Consensus        13 ~~VLDlGcG~G~~~l~la~r---~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~   89 (225)
                      .+||=+|||  .++-.+|+.   ..+.+|+..|.+++..+.+..+.        ..+++..+.|+.+......+.    .
T Consensus         2 ~~ilviGaG--~Vg~~va~~la~~~d~~V~iAdRs~~~~~~i~~~~--------~~~v~~~~vD~~d~~al~~li----~   67 (389)
T COG1748           2 MKILVIGAG--GVGSVVAHKLAQNGDGEVTIADRSKEKCARIAELI--------GGKVEALQVDAADVDALVALI----K   67 (389)
T ss_pred             CCEEEECCC--HHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHC--------CCCCEEEEECCCCHHHHHHHH----H
T ss_conf             728998986--66799999998578962999848888999987533--------466316994256758899987----2


Q ss_pred             CCCEEEECCCCC
Q ss_conf             520577226544
Q gi|255764482|r   90 FYDHVIMNPPFN  101 (225)
Q Consensus        90 ~fDlii~nPPy~  101 (225)
                      .+|+|+.--|++
T Consensus        68 ~~d~VIn~~p~~   79 (389)
T COG1748          68 DFDLVINAAPPF   79 (389)
T ss_pred             CCCEEEEECCCH
T ss_conf             577899928705


No 363
>PRK08277 D-mannonate oxidoreductase; Provisional
Probab=72.82  E-value=6.8  Score=18.61  Aligned_cols=83  Identities=16%  Similarity=0.042  Sum_probs=56.1

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC---CC
Q ss_conf             55789995878438999999867--99889999889899998899999806645222530200444235310000---12
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL---AG   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~---~~   85 (225)
                      +|..+|=-|.+.| ++..+|+++  .+++|+.+|.+++.++.+.+.++..+     .+...++.|+.+.......   ..
T Consensus         9 ~gKvalVTGas~G-IG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~l~~~g-----~~~~~~~~Dvtd~~~v~~~~~~~~   82 (278)
T PRK08277          9 KGKVAVITGGGGV-LGGAMAKELARAGAKVAILDRNQEKAEAVVEEIKANG-----GEAIALKADVLDKESLEQARQQIL   82 (278)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC-----CEEEEEECCCCCHHHHHHHHHHHH
T ss_conf             9998999586748-9999999999879989999798899999999998459-----909999824899999999999999


Q ss_pred             CCCCCCCEEEECCC
Q ss_conf             35765205772265
Q gi|255764482|r   86 LKNNFYDHVIMNPP   99 (225)
Q Consensus        86 ~~~~~fDlii~nPP   99 (225)
                      ..-+..|..+.|--
T Consensus        83 ~~~G~iDiLVNnAG   96 (278)
T PRK08277         83 KDFGRCDILINGAG   96 (278)
T ss_pred             HHHCCCCEEEECCC
T ss_conf             98499888998898


No 364
>PRK08265 short chain dehydrogenase; Provisional
Probab=72.78  E-value=6.8  Score=18.61  Aligned_cols=123  Identities=14%  Similarity=0.012  Sum_probs=65.2

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---C
Q ss_conf             55789995878438999999867--998899998898999988999998066452225302004442353100001---2
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---G   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---~   85 (225)
                      +|..+|=-|.+.| ++..+|+++  .+++|+..|.+.+..+...+.+        ..+..++++|+.+........   .
T Consensus         5 ~gKvalVTGgs~G-IG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~--------~~~~~~~~~Dv~~~~~i~~~~~~~~   75 (261)
T PRK08265          5 AGKVAIVTGGATL-IGAAVARALVAAGACVAILDIDADNGAAVAASL--------GERARFIATDITDDAAIERAVATAV   75 (261)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHH--------CCCEEEEECCCCCHHHHHHHHHHHH
T ss_conf             9998999487768-999999999987998999979889999999981--------9972899813899999999999999


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCC--HHHHHHHHHHHC-CCCCEEEEE
Q ss_conf             35765205772265446446547885455652056689--899999999862-469837870
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDS--FEKWIRTACAIM-RSSGQLSLI  144 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~--~~~~~~~a~~lL-kpgG~~~~i  144 (225)
                      ...++.|.++.|---+........+..  +.+....+.  ...+.+.+...+ +.+|+...+
T Consensus        76 ~~fG~iDiLVNNAg~~~~~~~~~~~e~--w~~~~~vNl~~~~~~~q~~~~~m~~~~G~IIni  135 (261)
T PRK08265         76 ARFGGLDILVNLACTYVDDGLASSRAD--WLAALDVNLVSAAMLAQAAHPHLKRGGGAIVNF  135 (261)
T ss_pred             HHHCCCCEEEECCCCCCCCCCCCCHHH--HHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEE
T ss_conf             981998789985755788734399999--999999983999999999999998769779999


No 365
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=72.24  E-value=7  Score=18.53  Aligned_cols=129  Identities=21%  Similarity=0.160  Sum_probs=72.9

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEE-EECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---
Q ss_conf             55789995878438999999867--9988999-98898999988999998066452225302004442353100001---
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILL-AERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---   84 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~g-vD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---   84 (225)
                      +|..+|=-|.+.| ++..+|.++  .+++|+- .+.+.+..+.+.+.++..+     .+...+.+|+.+........   
T Consensus         2 ~gKvalITGgs~G-IG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g-----~~~~~~~~Dvs~~~~v~~~~~~~   75 (249)
T PRK06077          2 KDKVVVVTGSGRG-IGRAIAVRLAKEGAKVVVNAKKRAEEMNETLRMVKEYG-----GEGIGVLADVSTREGCRTLAKAA   75 (249)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCC-----CCEEEEECCCCCHHHHHHHHHHH
T ss_conf             6198999263678-99999999998799899984887689999999999759-----95899984799999999999999


Q ss_pred             CCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCC-CCCHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             235765205772265446446547885455652056-6898999999998624698378702
Q gi|255764482|r   85 GLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-EDSFEKWIRTACAIMRSSGQLSLIA  145 (225)
Q Consensus        85 ~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~-~~~~~~~~~~a~~lLkpgG~~~~i~  145 (225)
                      ...-+..|..+.|.-..........+.......... ........+.+.+.++.+|.+..+-
T Consensus        76 ~~~~g~iDiLVnNAG~~~~~~~~~~~~~~~~~~~~vN~~~~~~~~~~~~~~m~~~G~IInis  137 (249)
T PRK06077         76 LDNFGVVDILVNNAGLGLFSPFLNADDRLIEKHISTDLKSVIYCSQEAAKVMREGGEIINIA  137 (249)
T ss_pred             HHHHCCCCEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECC
T ss_conf             99819988899857757887501099999999998862189999999999961697899826


No 366
>PRK08251 short chain dehydrogenase; Provisional
Probab=72.22  E-value=7  Score=18.53  Aligned_cols=128  Identities=19%  Similarity=0.133  Sum_probs=69.4

Q ss_pred             CCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC---CCC
Q ss_conf             5789995878438999999867--99889999889899998899999806645222530200444235310000---123
Q gi|255764482|r   12 SFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL---AGL   86 (225)
Q Consensus        12 ~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~---~~~   86 (225)
                      ..+||=.|+++|. +..+|+++  .+++|+.+..+++.++.....+....   ...++.....|+.+.......   ...
T Consensus         2 ~K~vlITGAssGI-G~alA~~la~~G~~v~l~~r~~~~l~~~~~el~~~~---~~~~v~~~~~Dvsd~~~v~~~~~~~~~   77 (248)
T PRK08251          2 RQKILITGASSGL-GAGMAREFAAKGRDLALCARRTDRLEELKAELLARY---PGIKVAVAALDVNDHDQVFEVFAEFSD   77 (248)
T ss_pred             CCEEEEECCCCHH-HHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHC---CCCEEEEEECCCCCHHHHHHHHHHHHH
T ss_conf             9989994786399-999999999879989999898889999999998737---997399997867868999999999999


Q ss_pred             CCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCC--HHHHHHHHHHHCCC--CCEEEEE
Q ss_conf             5765205772265446446547885455652056689--89999999986246--9837870
Q gi|255764482|r   87 KNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDS--FEKWIRTACAIMRS--SGQLSLI  144 (225)
Q Consensus        87 ~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~--~~~~~~~a~~lLkp--gG~~~~i  144 (225)
                      ..+..|+++.|.-+.........+....... ...+.  ....++.+...++.  +|.+..+
T Consensus        78 ~~g~iD~lvnNAGi~~~~~~~~~~~~~~~~~-~~vN~~g~~~~~~~~l~~m~~~~~G~Iv~i  138 (248)
T PRK08251         78 ELGGLDRVIVNAGIGKGARLGTGKFWANKAT-AETNFVAALAQCEAAMEIFREQGSGHLVLI  138 (248)
T ss_pred             HHCCCCEEEECCCCCCCCCCCCCCHHHHHHH-HHHHHHHHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             8099989998576578866555999999999-999829999999999876554058729999


No 367
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional
Probab=72.17  E-value=7  Score=18.52  Aligned_cols=129  Identities=14%  Similarity=0.169  Sum_probs=65.7

Q ss_pred             CCCCEEEEECCCHH-HHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC--
Q ss_conf             85578999587843-8999999867--998899998898999988999998066452225302004442353100001--
Q gi|255764482|r   10 TGSFHLADLGAGAG-AAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA--   84 (225)
Q Consensus        10 ~~~~~VLDlGcG~G-~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~--   84 (225)
                      -+|+++|=-|+|+| .++..+|+++  .+++|+-...++...+.+++-.+..+     .. .+++.|+.+......+.  
T Consensus         5 L~GK~alITGaa~~~GIG~aiA~~La~~GA~V~i~~~~e~~~~~~~~~~~~~g-----~~-~~~~~Dvsd~~~v~~~v~~   78 (271)
T PRK06505          5 MQGKRGLIMGVANDHSIAWGIAKQLAAQGAELAFTYQGDALGKRVKPLAESLG-----SD-LVLPCDVEDIASVDAVFEA   78 (271)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC-----CC-EEEECCCCCHHHHHHHHHH
T ss_conf             79997999799998549999999999869999998186688999999999649-----81-8998379999999999999


Q ss_pred             -CCCCCCCCEEEECCCCCCCCCCCC--CCHHHH-HHHCCCCC--CHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             -235765205772265446446547--885455-65205668--9899999999862469837870
Q gi|255764482|r   85 -GLKNNFYDHVIMNPPFNERIGTMT--PDKIKE-EAHVMLED--SFEKWIRTACAIMRSSGQLSLI  144 (225)
Q Consensus        85 -~~~~~~fDlii~nPPy~~~~~~~~--~~~~~~-~a~~~~~~--~~~~~~~~a~~lLkpgG~~~~i  144 (225)
                       ....+..|..+.|.-+........  .+.... ..+....+  ......+.+..+++.+|.+..+
T Consensus        79 ~~~~~G~iDiLVnnAG~~~~~~~~~~~~d~~~e~~~~~~~~n~~~~~~~~~~~~~~~~~~Gsii~i  144 (271)
T PRK06505         79 LEKKWGKLDFVVHAIGFSDKNELKGRYADTTRENFSRTMVISCFSFTEIAKRAAKLMPDGGSMLTL  144 (271)
T ss_pred             HHHHHCCCCEEEECCCCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEE
T ss_conf             999839987898566446754444541226799999999999799999999860012678860246


No 368
>PRK09134 short chain dehydrogenase; Provisional
Probab=71.95  E-value=7.1  Score=18.49  Aligned_cols=132  Identities=14%  Similarity=0.067  Sum_probs=74.0

Q ss_pred             CCCCCCCEEEEECCCHHHHHHHHHHHC--CCCEE-EEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC
Q ss_conf             899855789995878438999999867--99889-999889899998899999806645222530200444235310000
Q gi|255764482|r    7 VNATGSFHLADLGAGAGAAGLAVASRL--HEAQI-LLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL   83 (225)
Q Consensus         7 ~~~~~~~~VLDlGcG~G~~~l~la~r~--~~~~v-~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~   83 (225)
                      ++..++..+|=-|++.| ++..+|+++  .+++| +..+.+.+-++...+.++..+     .+...+++|+.+......+
T Consensus         4 m~~~~~KvalVTGas~G-IG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~i~~~g-----~~~~~~~~Dl~~~~~~~~~   77 (256)
T PRK09134          4 MPMAAPRAALVTGAARR-IGRAIALDLAAHGFDVAVHYNRSRDEAEALAAEIRALG-----RRAVALQADLADEAQVRAL   77 (256)
T ss_pred             CCCCCCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCC-----CCEEEEECCCCCHHHHHHH
T ss_conf             98999997999488678-99999999998799899984999899999999999649-----9189997558999999999


Q ss_pred             C---CCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCC-CCCHHHHHHHHHHHCCCC--CEEEEE
Q ss_conf             1---235765205772265446446547885455652056-689899999999862469--837870
Q gi|255764482|r   84 A---GLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-EDSFEKWIRTACAIMRSS--GQLSLI  144 (225)
Q Consensus        84 ~---~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~-~~~~~~~~~~a~~lLkpg--G~~~~i  144 (225)
                      .   ....+..|..+.|.-.+........+.......+.. ......+.+.+.+.++.+  |++..+
T Consensus        78 v~~~~~~~G~iDiLVnNAg~~~~~~~~~~~~e~w~~~~~vNl~~~~~~~q~~~~~m~~~~~G~IVni  144 (256)
T PRK09134         78 VARASAALGPITLLVNNASLFEYDSAASFTRASWDRHMATNLRAPFVLAQAFARALPADARGLVVNM  144 (256)
T ss_pred             HHHHHHHHCCCCEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             9999998299878998871168997020999999999754010599999999999886078069998


No 369
>PRK07326 short chain dehydrogenase; Provisional
Probab=71.74  E-value=7.2  Score=18.47  Aligned_cols=125  Identities=16%  Similarity=0.057  Sum_probs=70.1

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC---CC
Q ss_conf             55789995878438999999867--99889999889899998899999806645222530200444235310000---12
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL---AG   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~---~~   85 (225)
                      .|..+|=-|++.| ++..+|+++  .+++|+.++.+++.++.+.+.+..       .++..+..|+.+.......   ..
T Consensus         4 ~GKvalITGas~G-IG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~~l~~-------~~~~~~~~Dv~d~~~v~~~v~~~~   75 (235)
T PRK07326          4 NGKAALVTGGSKG-IGFAVAEALAAAGYRVAICARDESELEAAAQELGK-------RNVLGLACDVRDEADVRQAVDAHV   75 (235)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCC-------CCEEEEEEECCCHHHHHHHHHHHH
T ss_conf             9989999382679-99999999998799999998988999999998423-------986999963899999999999999


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCH--HHHHHHHHHHCC--CCCEEEEE
Q ss_conf             357652057722654464465478854556520566898--999999998624--69837870
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSF--EKWIRTACAIMR--SSGQLSLI  144 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~--~~~~~~a~~lLk--pgG~~~~i  144 (225)
                      ..-+..|..+.|.-....+.....+... +.+....+..  ....+.+...++  .+|.+..+
T Consensus        76 ~~~G~iDiLVNNAGi~~~~~~~~~~~e~-~~~~~~vNl~g~~~~~~~~~p~m~~~~~G~Iini  137 (235)
T PRK07326         76 EAFGGLDILVNNAGVGHFAPVEELTLEE-WRLVIDTNLTGAFYTIKAAVPALLKRGGGYIVNI  137 (235)
T ss_pred             HHCCCCEEEEECCCCCCCCCHHHCCHHH-HHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             9829966999888778998826599999-9999999879999999999999997199889998


No 370
>KOG0023 consensus
Probab=71.00  E-value=7.5  Score=18.37  Aligned_cols=104  Identities=15%  Similarity=0.151  Sum_probs=56.7

Q ss_pred             CCCCCCEEEEECCC-HHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCC
Q ss_conf             99855789995878-43899999986799889999889899998899999806645222530200444235310000123
Q gi|255764482|r    8 NATGSFHLADLGAG-AGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGL   86 (225)
Q Consensus         8 ~~~~~~~VLDlGcG-~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~   86 (225)
                      +..+|.+|-=.|.| -|.+++..|+.+ +.+|+++|.+..-=+.|-+++   +...           +.....+..+...
T Consensus       178 g~~pG~~vgI~GlGGLGh~aVq~AKAM-G~rV~vis~~~~kkeea~~~L---GAd~-----------fv~~~~d~d~~~~  242 (360)
T KOG0023         178 GLGPGKWVGIVGLGGLGHMAVQYAKAM-GMRVTVISTSSKKKEEAIKSL---GADV-----------FVDSTEDPDIMKA  242 (360)
T ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHH-CCEEEEEECCCHHHHHHHHHC---CCCE-----------EEEECCCHHHHHH
T ss_conf             999986898855764016899999870-867999927853489999854---9621-----------5884278789999


Q ss_pred             CCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHH
Q ss_conf             57652057722654464465478854556520566898999999998624698378702888
Q gi|255764482|r   87 KNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQ  148 (225)
Q Consensus        87 ~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~  148 (225)
                      ..+..|.++---+                      +....-++.+..+||++|++.++--++
T Consensus       243 ~~~~~dg~~~~v~----------------------~~a~~~~~~~~~~lk~~Gt~V~vg~p~  282 (360)
T KOG0023         243 IMKTTDGGIDTVS----------------------NLAEHALEPLLGLLKVNGTLVLVGLPE  282 (360)
T ss_pred             HHHHHCCCCEEEE----------------------ECCCCCHHHHHHHHCCCCEEEEEECCC
T ss_conf             9875267502321----------------------023244388887610397899983667


No 371
>PRK08703 short chain dehydrogenase; Provisional
Probab=70.99  E-value=7.5  Score=18.37  Aligned_cols=128  Identities=12%  Similarity=0.098  Sum_probs=67.2

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCC------C
Q ss_conf             55789995878438999999867--998899998898999988999998066452225302004442353100------0
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENR------N   82 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~------~   82 (225)
                      +|.++|=-|++.|. +..+|+.+  .+++|+.++.+.+.++.+.+.+...+.    .....+..|+.......      .
T Consensus         5 ~gK~~lITGas~GI-G~aiA~~la~~Ga~V~l~~r~~~~l~~~~~~l~~~~~----~~~~~~~~d~~~~~~~~~~~~~~~   79 (239)
T PRK08703          5 SDKTILVTGASQGL-GEQVAKAYAAAGATVILVARHQKKLEKVYDAIVEAGH----PEPFAIRFDLMSAEEKEFEQFAAT   79 (239)
T ss_pred             CCCEEEEECCCCHH-HHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCC----CCEEEEEEECCCCHHHHHHHHHHH
T ss_conf             96989994886289-9999999998799899997988899999999997379----954999985056307899999999


Q ss_pred             CCCCCCCCCCEEEECCCCCCCC-CCCCCCHHHHHHHCCCCCC--HHHHHHHHHHHCCC--CCEEEEE
Q ss_conf             0123576520577226544644-6547885455652056689--89999999986246--9837870
Q gi|255764482|r   83 LAGLKNNFYDHVIMNPPFNERI-GTMTPDKIKEEAHVMLEDS--FEKWIRTACAIMRS--SGQLSLI  144 (225)
Q Consensus        83 ~~~~~~~~fDlii~nPPy~~~~-~~~~~~~~~~~a~~~~~~~--~~~~~~~a~~lLkp--gG~~~~i  144 (225)
                      ......+..|.++.|.-++... .....+... +......+.  ...+.+.+..+|+.  +|++.++
T Consensus        80 ~~~~~~G~lD~lvnnAG~~~~~~~~~~~~~~~-~~~~~~vN~~~~~~l~~~~~p~m~~~~~g~Ii~i  145 (239)
T PRK08703         80 IAEATQGKLDGIVHCAGYFYALSPLDFQTVAE-WVNQYRINTVAPMGLTRALFPLLKQSPDASVIFV  145 (239)
T ss_pred             HHHHHCCCCCEEEECCCCCCCCCCCCCCCHHH-HHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             99983799768996665457889533289999-9999988808999999999999987799089998


No 372
>PRK07097 gluconate 5-dehydrogenase; Provisional
Probab=70.95  E-value=7.5  Score=18.36  Aligned_cols=128  Identities=14%  Similarity=0.021  Sum_probs=72.7

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---C
Q ss_conf             55789995878438999999867--998899998898999988999998066452225302004442353100001---2
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---G   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---~   85 (225)
                      +|..+|=-|.+.| ++..+|.++  .+++|+-.|.+++.++.+.+.++..+     .++..+..|+.+........   .
T Consensus         9 ~gK~alVTG~s~G-IG~aiA~~la~~Ga~Vii~~~~~~~~~~~~~~~~~~g-----~~~~~~~~Dvt~~~~v~~~~~~~~   82 (265)
T PRK07097          9 KGKIALITGASYG-IGFAIAKAYAEAGATIVFNDIKQELVDKGLAAYRELG-----IEAHGYVCDVTDEDGIQAMVAQIE   82 (265)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC-----CCEEEEEECCCCHHHHHHHHHHHH
T ss_conf             9998999585768-9999999999869999999599899999999999549-----917999932899999999999999


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCC-CCCCHHHHHHHHHHHCC--CCCEEEEE
Q ss_conf             3576520577226544644654788545565205-66898999999998624--69837870
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVM-LEDSFEKWIRTACAIMR--SSGQLSLI  144 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~-~~~~~~~~~~~a~~lLk--pgG~~~~i  144 (225)
                      ...+..|..+.|.-..........+......... .....-...+.+...++  .+|++..+
T Consensus        83 ~~~g~iDiLVnNAG~~~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~~~~m~~~~~G~IVni  144 (265)
T PRK07097         83 KEVGVIDILVNNAGIIRRIPMLEMSAEDFRQVIDIDLNAPFIVSKAVLPSMIKKGHGKIINI  144 (265)
T ss_pred             HHCCCCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEE
T ss_conf             98299989998998999988265999999999998607289999999998998089759999


No 373
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional
Probab=70.66  E-value=7.6  Score=18.33  Aligned_cols=127  Identities=11%  Similarity=0.098  Sum_probs=64.3

Q ss_pred             CCCCEEEEECCC-HHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC---
Q ss_conf             855789995878-438999999867--99889999889899998899999806645222530200444235310000---
Q gi|255764482|r   10 TGSFHLADLGAG-AGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL---   83 (225)
Q Consensus        10 ~~~~~VLDlGcG-~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~---   83 (225)
                      -+|..+|=-|++ +-.++..+|+++  .+++|+..+.+++..+.+.+-        ...+...+++|+.+.......   
T Consensus         5 L~gK~~lVTGaag~~GIG~a~A~~la~~Ga~Vv~~~~~~~~~~~~~~~--------~~~~~~~~~~Dvs~~~~v~~~~~~   76 (252)
T PRK06079          5 LSGKKIVVMGVANKRSIAWGCAQAIKDQGATVIYTYQNDRMKKSLQKL--------VDEEDLLVECDVASDESIERAFAQ   76 (252)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHH--------CCCCCEEEEEECCCHHHHHHHHHH
T ss_conf             399889998999987799999999998699999984887999999985--------088865999518999999999999


Q ss_pred             CCCCCCCCCEEEECCCCCCCCCCCC--CCHHHH-HHHCCCCC--CHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             1235765205772265446446547--885455-65205668--9899999999862469837870
Q gi|255764482|r   84 AGLKNNFYDHVIMNPPFNERIGTMT--PDKIKE-EAHVMLED--SFEKWIRTACAIMRSSGQLSLI  144 (225)
Q Consensus        84 ~~~~~~~fDlii~nPPy~~~~~~~~--~~~~~~-~a~~~~~~--~~~~~~~~a~~lLkpgG~~~~i  144 (225)
                      .....+..|.++.|.-+........  .+.... .......+  ......+.+..+++++|....+
T Consensus        77 ~~~~~G~iD~lVnnag~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~g~Iv~i  142 (252)
T PRK06079         77 IKERFGKIDGIVHAIAYAKKEELGGNVTDTSRDGYALAQDISAYSLIAVAKYARPLLNPPASIVTL  142 (252)
T ss_pred             HHHHHCCCCEEEEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEE
T ss_conf             999868887344332025731024644438899999999888899999998887640357706788


No 374
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional
Probab=70.03  E-value=6.1  Score=18.86  Aligned_cols=53  Identities=21%  Similarity=0.212  Sum_probs=36.7

Q ss_pred             EEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCC
Q ss_conf             89995878438999999867--9988999988989999889999980664522253020044423531
Q gi|255764482|r   14 HLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGE   79 (225)
Q Consensus        14 ~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~   79 (225)
                      +|+  =||-|.++..+++..  .+..++.+|.||+.++.+|+.           -..+..+|..+...
T Consensus       401 ~VI--I~G~GRvGq~var~L~~~gi~~vviD~d~~~V~~~r~~-----------G~~v~yGDat~~~v  455 (615)
T PRK03562        401 RVI--IAGFGRFGQIVGRLLLSSGVKMVVLDHDPDHIETLRKF-----------GMKVFYGDATRMDL  455 (615)
T ss_pred             CEE--EEECCCCHHHHHHHHHHCCCCEEEEECCHHHHHHHHHC-----------CCEEEEECCCCHHH
T ss_conf             989--99028046999999997899879997999999999967-----------99089768999999


No 375
>pfam05206 TRM13 Methyltransferase TRM13. This is a family of eukaryotic proteins which are responsible for 2'-O-methylation of tRNA at position 4. TRM13 shows no sequence similarity to other known methyltransferases.
Probab=69.85  E-value=7.9  Score=18.22  Aligned_cols=67  Identities=18%  Similarity=0.225  Sum_probs=40.7

Q ss_pred             CCCCCEEEEECCCHHHHHHHHHHHCCC-----CEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCC
Q ss_conf             985578999587843899999986799-----889999889899998899999806645222530200444235310
Q gi|255764482|r    9 ATGSFHLADLGAGAGAAGLAVASRLHE-----AQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGEN   80 (225)
Q Consensus         9 ~~~~~~VLDlGcG~G~~~l~la~r~~~-----~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~   80 (225)
                      .++...++|.|||-|-+|-.+++..+.     ..++-||....-.+.= ..++..    ....++-...||.+....
T Consensus        16 l~~~~~~vEfGAGrG~LS~~v~~~l~~~~~~~~~~~LIDR~s~R~K~D-~k~r~~----~~~~~~R~riDI~DL~L~   87 (256)
T pfam05206        16 LSPSTAYVEFGAGKGELSRYLNQCLLEDQLSNPGFVLIDRASNRLKAD-RKIRKD----ESPPIKRLRIDIKDLNLD   87 (256)
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHCCCCCCCCCEEEEECCCCCCCCH-HHHHCC----CCCCEEEEEEEHHHCCHH
T ss_conf             899988999789646999999998523456676389998888775431-102137----888258999532545776


No 376
>PRK06701 short chain dehydrogenase; Provisional
Probab=69.40  E-value=8.1  Score=18.17  Aligned_cols=128  Identities=13%  Similarity=0.023  Sum_probs=71.2

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHH-HHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---
Q ss_conf             55789995878438999999867--99889999889899-9988999998066452225302004442353100001---
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLM-AHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---   84 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~-~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---   84 (225)
                      +|..+|=-|.+.|. +..+|.++  .+++|.-++.+.+- .+.+..-++..+     .++..+.+|+.+......+.   
T Consensus        44 ~GKvalVTGgs~GI-G~aiA~~la~~GA~V~i~~~~~~~~a~~~~~~~~~~G-----~~~~~~~~Dv~d~~~v~~~v~~~  117 (289)
T PRK06701         44 KGKVALITGGDSGI-GRAVAVAFAKEGADIAIVYLDEHEDANETKQRVEKEG-----VKCLLIPGDVSDEQFCKDAVEET  117 (289)
T ss_pred             CCCEEEEECCCCHH-HHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCC-----CEEEEEECCCCCHHHHHHHHHHH
T ss_conf             99989996825799-9999999998799899982894678999999999639-----90899984789999999999999


Q ss_pred             CCCCCCCCEEEECCCCCC-CCCCCCCCH-HHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             235765205772265446-446547885-455652056689899999999862469837870
Q gi|255764482|r   85 GLKNNFYDHVIMNPPFNE-RIGTMTPDK-IKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLI  144 (225)
Q Consensus        85 ~~~~~~fDlii~nPPy~~-~~~~~~~~~-~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i  144 (225)
                      ...-+..|..+.|--+.. .......+. .....-.........+.+.+...|+++|.+..+
T Consensus       118 ~~~fG~iDiLVNNAG~~~~~~~~~~~~~~~~~~~~~vNl~g~f~~~~~~~p~m~~gg~IIni  179 (289)
T PRK06701        118 VRELGRLDILVNNAAQQYPQQSLEDITAEQLDKTFRTNIYSYFHMTKAALPHLKPGSAIINT  179 (289)
T ss_pred             HHHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEE
T ss_conf             99859998999888346788872449999999997452178999999999997349779995


No 377
>PRK09242 tropinone reductase; Provisional
Probab=68.75  E-value=8.4  Score=18.09  Aligned_cols=129  Identities=19%  Similarity=0.127  Sum_probs=71.7

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC---CC
Q ss_conf             55789995878438999999867--99889999889899998899999806645222530200444235310000---12
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL---AG   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~---~~   85 (225)
                      +|.++|=-|++.| ++..+|+++  .+++|+.++.+++.++.+...+....   ...++..++.|+.+.......   ..
T Consensus         9 ~gK~alITGgs~G-IG~a~a~~la~~Ga~V~~~~r~~~~~~~~~~~l~~~~---~~~~~~~~~~Dv~~~~~~~~~~~~~~   84 (258)
T PRK09242          9 DGQTALITGASKG-IGLAIARELLGLGADVLIVARDADALAQARDELAEEF---PERELHGLAADVSDDEDRRAILDWVE   84 (258)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHC---CCCEEEEEEEECCCHHHHHHHHHHHH
T ss_conf             9999999484868-9999999999879989999698899999999998644---79729999930799999999999999


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCH--HHHHHHCCCCCCHHHHHHHHHHHCCCC--CEEEEE
Q ss_conf             35765205772265446446547885--455652056689899999999862469--837870
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIGTMTPDK--IKEEAHVMLEDSFEKWIRTACAIMRSS--GQLSLI  144 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~~~~~~~--~~~~a~~~~~~~~~~~~~~a~~lLkpg--G~~~~i  144 (225)
                      ...+..|..+.|.-..........+.  ....-...... .....+.+..+++.+  |++..+
T Consensus        85 ~~~g~iDiLVnnAG~~~~~~~~~~s~~~w~~~~~vNl~~-~~~l~~~~~p~m~~~~~G~IIni  146 (258)
T PRK09242         85 DHWDGLHILVNNAGGNITKAAIDYTEDEWRGIFETNLFS-AFELSRYAYPLLKRHAASSIVNI  146 (258)
T ss_pred             HHCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHH-HHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             974999799989988999980019999999999998199-99999999999997599279999


No 378
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=67.69  E-value=8.8  Score=17.96  Aligned_cols=128  Identities=18%  Similarity=0.090  Sum_probs=70.1

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEE-EECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---
Q ss_conf             55789995878438999999867--9988999-98898999988999998066452225302004442353100001---
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILL-AERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---   84 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~g-vD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---   84 (225)
                      +|..||=.|.+.| ++..+|+++  .+++|+- .+.+++.++.....+...+     .++.+++.|+.+......+.   
T Consensus         4 ~gK~vlITGgs~G-IG~aia~~la~~G~~V~~~~~~~~~~~~~~~~~l~~~~-----~~~~~~~~Dl~~~~~~~~~~~~~   77 (247)
T PRK05565          4 MGKVAIVTGASGG-IGRAIAELLAKEGAKVVIAYDKNEEAANELLEEIKEVG-----GDAIAVKADVSSEDDVENLVEQI   77 (247)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCC-----CCEEEEECCCCCHHHHHHHHHHH
T ss_conf             9988999378458-99999999998799899981799899999999999639-----90899983589999999999999


Q ss_pred             CCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCC-CCCCHHHHHHHHHHHCC--CCCEEEEE
Q ss_conf             23576520577226544644654788545565205-66898999999998624--69837870
Q gi|255764482|r   85 GLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVM-LEDSFEKWIRTACAIMR--SSGQLSLI  144 (225)
Q Consensus        85 ~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~-~~~~~~~~~~~a~~lLk--pgG~~~~i  144 (225)
                      ....+..|.++.|............+......... .......+++.+...++  .+|++..+
T Consensus        78 ~~~~g~iD~lVnnAg~~~~~~~~~~~~~~~~~~~~~Nl~~~~~~~~~~~~~m~~~~~G~II~i  140 (247)
T PRK05565         78 VEKFGKIDILVNNAGISKFGLVTDMTDEEWDRVINVNLTGVMRLTRYALPIMIKRGSGVIVNI  140 (247)
T ss_pred             HHHCCCCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             998099849998998789999155999999999998547899999985798875699759997


No 379
>PRK10669 putative cation:proton antiport protein; Provisional
Probab=67.66  E-value=8.8  Score=17.96  Aligned_cols=66  Identities=14%  Similarity=0.121  Sum_probs=40.7

Q ss_pred             ECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCEEE
Q ss_conf             5878438999999867--99889999889899998899999806645222530200444235310000123576520577
Q gi|255764482|r   18 LGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVI   95 (225)
Q Consensus        18 lGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~fDlii   95 (225)
                      +=||-|..+..+++..  .+..++.+|.||+.++.+++           ....++.+|..+...-.   ...-++...++
T Consensus       421 ii~G~Gr~G~~va~~L~~~~~~~vvid~d~~~v~~~~~-----------~g~~v~~GDa~~~~~L~---~agi~~A~~vv  486 (558)
T PRK10669        421 LLVGYGRVGSLLGEKLLASGIPLVVIETSRTRVDELRE-----------RGIRAVLGNAANEEIMQ---LAHLDCARWLL  486 (558)
T ss_pred             EEECCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHH-----------CCCEEEEECCCCHHHHH---HCCCCCCCEEE
T ss_conf             99898866999999999879988999898999999996-----------89979997899889998---57913249999


Q ss_pred             EC
Q ss_conf             22
Q gi|255764482|r   96 MN   97 (225)
Q Consensus        96 ~n   97 (225)
                      .-
T Consensus       487 it  488 (558)
T PRK10669        487 LT  488 (558)
T ss_pred             EE
T ss_conf             98


No 380
>PRK06484 short chain dehydrogenase; Validated
Probab=67.58  E-value=8.9  Score=17.95  Aligned_cols=84  Identities=17%  Similarity=0.131  Sum_probs=41.7

Q ss_pred             CCCCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC---
Q ss_conf             9855789995878438999999867--99889999889899998899999806645222530200444235310000---
Q gi|255764482|r    9 ATGSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL---   83 (225)
Q Consensus         9 ~~~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~---   83 (225)
                      ..+|..+|=-|++.|. ...+|.++  .+++|+-.|++++..+...+.+   +     .+...+..|+.+.......   
T Consensus       271 ~~kGKvalVTGaa~GI-G~aiA~~la~~GA~Vvi~d~~~~~~~~~~~~~---g-----~~~~~~~~Dv~~~~~v~~~v~~  341 (530)
T PRK06484        271 VRAGRVVCVTGGASGI-GAAIADRFAALGDRVAIIDSDGEEAVKLREIL---G-----GEHLSWQVDITDEASVESAFAG  341 (530)
T ss_pred             CCCCCEEEECCCCCHH-HHHHHHHHHHCCCEEEEEECCHHHHHHHHHHC---C-----CCCEEEEECCCCHHHHHHHHHH
T ss_conf             7789899992876789-99999999988798999958889999999973---9-----9736999538999999999999


Q ss_pred             CCCCCCCCCEEEECCCCC
Q ss_conf             123576520577226544
Q gi|255764482|r   84 AGLKNNFYDHVIMNPPFN  101 (225)
Q Consensus        84 ~~~~~~~fDlii~nPPy~  101 (225)
                      .....+..|.++.|--..
T Consensus       342 ~~~~fG~iDiLVNNAGi~  359 (530)
T PRK06484        342 IQGRLGPLDVLVNNAGIA  359 (530)
T ss_pred             HHHHCCCCCEEEECCCCC
T ss_conf             999829988999897789


No 381
>PRK07478 short chain dehydrogenase; Provisional
Probab=67.18  E-value=9  Score=17.90  Aligned_cols=85  Identities=15%  Similarity=0.053  Sum_probs=56.7

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---C
Q ss_conf             55789995878438999999867--998899998898999988999998066452225302004442353100001---2
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---G   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---~   85 (225)
                      +|..+|=-|++.|. +..+|+++  .+++|+-.+.+++.++.+.+-++..+     .++..+.+|+.+......+.   .
T Consensus         5 ~gKvalVTGas~GI-G~aiA~~la~~Ga~Vvi~~r~~~~l~~~~~ei~~~g-----~~~~~~~~Dvt~~~~v~~~v~~~~   78 (254)
T PRK07478          5 NGKVAIITGASSGI-GRAAAKLFAREGAKVVVGARRQAELDQLVAEIRAEG-----GEAVALAGDVRDEAYAKALVALAV   78 (254)
T ss_pred             CCCEEEEECCCCHH-HHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC-----CCEEEEECCCCCHHHHHHHHHHHH
T ss_conf             99879995887689-999999999879999999798899999999999649-----908999768999999999999999


Q ss_pred             CCCCCCCEEEECCCCC
Q ss_conf             3576520577226544
Q gi|255764482|r   86 LKNNFYDHVIMNPPFN  101 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~  101 (225)
                      ..-+..|..+.|--..
T Consensus        79 ~~~G~iDiLVNNAG~~   94 (254)
T PRK07478         79 ERFGGLDIAFNNAGIL   94 (254)
T ss_pred             HHHCCCCEEEECCCCC
T ss_conf             9849998999887436


No 382
>PRK08339 short chain dehydrogenase; Provisional
Probab=66.97  E-value=9.1  Score=17.88  Aligned_cols=129  Identities=15%  Similarity=0.041  Sum_probs=68.9

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCC--C
Q ss_conf             55789995878438999999867--9988999988989999889999980664522253020044423531000012--3
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAG--L   86 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~--~   86 (225)
                      +|..+|=-|.+.| ++..+|+++  .+++|+.++.+++.++.+.+.+....    ..++..+..|+.+.........  .
T Consensus         7 ~gK~alITG~s~G-IG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~~l~~~~----~~~~~~~~~D~~~~~~v~~~~~~~~   81 (263)
T PRK08339          7 SGKLAFTTASSKG-IGFGVARVLARAGADVIILSRNEENLKRAKEKIKSES----DVEVHYIVADLTKREDLERTVKELK   81 (263)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHC----CCCEEEEECCCCCHHHHHHHHHHHH
T ss_conf             9998999162609-9999999999869999999798899999999998504----9857999848999999999999999


Q ss_pred             CCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCC-CCCCHHHHHHHHHHHCCCC--CEEEEE
Q ss_conf             576520577226544644654788545565205-6689899999999862469--837870
Q gi|255764482|r   87 KNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVM-LEDSFEKWIRTACAIMRSS--GQLSLI  144 (225)
Q Consensus        87 ~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~-~~~~~~~~~~~a~~lLkpg--G~~~~i  144 (225)
                      ..+..|.++.|.-....+.....+......... .......+.+.+...++..  |++..+
T Consensus        82 ~~g~~dilv~nag~~~~~~~~~~~~e~w~~~~~vnl~~~~~~~~~~~p~m~~~~~G~II~i  142 (263)
T PRK08339         82 NIGDPDIFFFSTGGPKPGYFMEMSMEDWEEAVKLLLYPAVYLTRALVPGMERKGFGRIIYS  142 (263)
T ss_pred             HHCCCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             5699989998999999989155999999999999869999999999876524389639995


No 383
>PRK09291 short chain dehydrogenase; Provisional
Probab=66.54  E-value=9.3  Score=17.83  Aligned_cols=123  Identities=16%  Similarity=0.138  Sum_probs=66.0

Q ss_pred             CCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             5789995878438999999867--99889999889899998899999806645222530200444235310000123576
Q gi|255764482|r   12 SFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNN   89 (225)
Q Consensus        12 ~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~   89 (225)
                      +.+||=-|+++|. +..+|.++  .+++|++...+...++..+..+...+     ..+.+...|+.+.....   .....
T Consensus         2 gK~vLITGAssGI-GraiA~~la~~G~~Vi~~~r~~~~l~~l~~~~~~~g-----~~~~~~~lDv~~~~~~~---~~~~~   72 (257)
T PRK09291          2 SKTILITGAGSGF-GREVALRLARKGHRVIAGVQIAPQVTELRAEAARRG-----LALRVEKLDLTDAIDRA---RAAEW   72 (257)
T ss_pred             CCEEEEECCCCHH-HHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC-----CCEEEEECCCCCHHHHH---HHCCC
T ss_conf             9989996898589-999999999879989999687899999999998529-----95599989889999999---98089


Q ss_pred             CCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHH--HHHHHHHHH-C-CCCCEEEEE
Q ss_conf             520577226544644654788545565205668989--999999986-2-469837870
Q gi|255764482|r   90 FYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFE--KWIRTACAI-M-RSSGQLSLI  144 (225)
Q Consensus        90 ~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~--~~~~~a~~l-L-kpgG~~~~i  144 (225)
                      ..|.++.|.-+...+.....+... ..+....+.+.  ...+..... + +..|++.++
T Consensus        73 ~iDvLVNNAGi~~~g~i~e~~~~~-~~~~~~vNv~g~~~ltq~~lp~M~~~~~G~IV~i  130 (257)
T PRK09291         73 DVDVLLNNAGIGEAGALVDIPVEL-VRELFETNVFGPLELTQGVVRKMVARGKGKIVFV  130 (257)
T ss_pred             CCCEEEECCCCCCCCCHHHCCHHH-HHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             999999898568997734499999-9999999979999999997899987699689998


No 384
>PRK05867 short chain dehydrogenase; Provisional
Probab=66.41  E-value=9.4  Score=17.81  Aligned_cols=87  Identities=16%  Similarity=0.080  Sum_probs=57.8

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---C
Q ss_conf             55789995878438999999867--998899998898999988999998066452225302004442353100001---2
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---G   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---~   85 (225)
                      +|.++|=-|.+.|. +..+|+++  .+++|+..+.+++.++.+.+-+...+     .++..++.|+.+......+.   .
T Consensus         8 ~gKvalVTGas~GI-G~aiA~~la~~Ga~V~i~~r~~~~~~~~~~ei~~~g-----~~~~~~~~Dvt~~~~v~~~v~~~~   81 (253)
T PRK05867          8 HGKRALITGASTGI-GKRVALAYVEAGAQVAIAARHLDALEKLADEIGTSG-----GKVVPVCCDVSQHQQVTSMLDQVT   81 (253)
T ss_pred             CCCEEEEECCCCHH-HHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC-----CEEEEEECCCCCHHHHHHHHHHHH
T ss_conf             99989997956599-999999999869999999798899999999998459-----919999836999999999999999


Q ss_pred             CCCCCCCEEEECCCCCCC
Q ss_conf             357652057722654464
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNER  103 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~  103 (225)
                      ...+..|..+.|.-....
T Consensus        82 ~~~G~iDiLVnNAG~~~~   99 (253)
T PRK05867         82 AELGGIDIAVCNAGIITV   99 (253)
T ss_pred             HHHCCCCEEEECCCCCCC
T ss_conf             995998599989977888


No 385
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase. Members of this protein family are the enzyme 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase. The enzymatic properties were confirmed experimentally in Rhodopseudomonas palustris; the enzyme is homotetrameric, and not sensitive to oxygen. This enzyme is part of proposed pathway for degradation of benzoyl-CoA to 3-hydroxypimeloyl-CoA that differs from the analogous in Thauera aromatica. It also may occur in degradation of the non-aromatic compound cyclohexane-1-carboxylate.
Probab=66.14  E-value=9.5  Score=17.78  Aligned_cols=127  Identities=12%  Similarity=0.037  Sum_probs=72.4

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---C
Q ss_conf             55789995878438999999867--998899998898999988999998066452225302004442353100001---2
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---G   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---~   85 (225)
                      +|..+|=-|.+.| ++..+++++  .+++|+-+|.+++.++.....++..+     .++..+.+|+.+........   .
T Consensus         2 ~gKvalITG~s~G-IG~aia~~la~~Ga~V~i~~r~~~~~~~~~~~l~~~g-----~~~~~~~~Dv~d~~~v~~~v~~~~   75 (250)
T TIGR03206         2 KDKTAIVTGGGGG-IGGATCRRFAEEGAKVAVFDLNREAAEKVAADIRAKG-----GNAQAFACDITDRDSVDTAVAAAE   75 (250)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC-----CCEEEEEECCCCHHHHHHHHHHHH
T ss_conf             5199999685768-9999999999879999999798899999999999539-----928999944899999999999999


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCH--HHHHHHHHHHCC--CCCEEEEE
Q ss_conf             357652057722654464465478854556520566898--999999998624--69837870
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSF--EKWIRTACAIMR--SSGQLSLI  144 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~--~~~~~~a~~lLk--pgG~~~~i  144 (225)
                      ..-+..|.++.|.-....+.....+.... .+....+..  -...+.+...++  -+|++..+
T Consensus        76 ~~~G~iDilvnnAg~~~~~~~~~~~~~~w-~~~~~vNl~g~~~~~~~~~p~m~~~~~G~IVni  137 (250)
T TIGR03206        76 QALGPVDVLVNNAGWDKFGPFTKTEPPLW-ERLIAINLTGALHMHHAVLPGMVERGAGRIVNI  137 (250)
T ss_pred             HHCCCCCEEEECCCCCCCCCCHHCCHHHH-HHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             97599979998988899989034999999-999999829999999999999997499179996


No 386
>PRK06949 short chain dehydrogenase; Provisional
Probab=65.89  E-value=9.6  Score=17.75  Aligned_cols=88  Identities=19%  Similarity=0.148  Sum_probs=58.8

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC---CC
Q ss_conf             55789995878438999999867--99889999889899998899999806645222530200444235310000---12
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL---AG   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~---~~   85 (225)
                      +|..+|=-|++.|. +..+|.++  .+++|+..+.+.+.++.....++..+     .....++.|+.+.......   ..
T Consensus         8 ~gKvalVTGas~GI-G~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~i~~~g-----~~~~~~~~Dv~~~~~v~~~v~~~~   81 (258)
T PRK06949          8 EGKVALVTGASSGL-GQRFAQVLSQAGAKVVLASRRVERLKELRAEIEAEG-----GAAHVVSLDVTDYQSIKAAVAHAE   81 (258)
T ss_pred             CCCEEEEECCCCHH-HHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC-----CCEEEEECCCCCHHHHHHHHHHHH
T ss_conf             99989995857799-999999999879999999698899999999999659-----928999826899999999999999


Q ss_pred             CCCCCCCEEEECCCCCCCC
Q ss_conf             3576520577226544644
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERI  104 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~  104 (225)
                      ...+..|..+.|.-.....
T Consensus        82 ~~~G~iDiLVnnAG~~~~~  100 (258)
T PRK06949         82 TEAGTIDILVNNSGVSTTQ  100 (258)
T ss_pred             HHHCCCCEEEECCCCCCCC
T ss_conf             9849998999899889998


No 387
>PRK07074 short chain dehydrogenase; Provisional
Probab=65.85  E-value=9.6  Score=17.75  Aligned_cols=123  Identities=17%  Similarity=0.143  Sum_probs=63.8

Q ss_pred             CEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC--CCCC
Q ss_conf             789995878438999999867--998899998898999988999998066452225302004442353100001--2357
Q gi|255764482|r   13 FHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA--GLKN   88 (225)
Q Consensus        13 ~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~--~~~~   88 (225)
                      ..+|=-|.+.| ++..+|+++  .+++|+.+|.+++.++.....+.       ..++..+..|+.+......+.  -...
T Consensus         3 KvalITGgs~G-IG~aia~~la~~Ga~V~~~~r~~~~~~~~~~~l~-------~~~~~~~~~Dv~~~~~~~~~~~~i~~~   74 (256)
T PRK07074          3 RTALVTGAAGG-IGQALARRFLAAGDRVLALDIDRAALAAFVDALG-------DAAVAPVICDLTDAASVERLAAALANE   74 (256)
T ss_pred             CEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHC-------CCCEEEEEEECCCHHHHHHHHHHHHHH
T ss_conf             88999884689-9999999999869999999798899999999826-------997799997279999999999999985


Q ss_pred             CCCCEEEECCCCCCCCCCCCCCHH--HHHHHCCCCCCHHHHHHHHHHHCCC--CCEEEEE
Q ss_conf             652057722654464465478854--5565205668989999999986246--9837870
Q gi|255764482|r   89 NFYDHVIMNPPFNERIGTMTPDKI--KEEAHVMLEDSFEKWIRTACAIMRS--SGQLSLI  144 (225)
Q Consensus        89 ~~fDlii~nPPy~~~~~~~~~~~~--~~~a~~~~~~~~~~~~~~a~~lLkp--gG~~~~i  144 (225)
                      +..|.++.|--..........+..  ...-....... ..+.+.+...++.  +|++..|
T Consensus        75 g~iDiLVNNAG~~~~~~~~~~~~e~w~~~~~vNl~g~-f~~~~~~~p~m~~~~~G~IIni  133 (256)
T PRK07074         75 GPVDVLVANAGAARAATLHDTTSASWRADNALNLEAT-YLCVEAVEAGMKARSRGAIVNI  133 (256)
T ss_pred             CCCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHH-HHHHHHHHHHHHHCCCCEEEEE
T ss_conf             9987999888778998915599999999999985999-9999999999987599769999


No 388
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional
Probab=65.63  E-value=9.7  Score=17.73  Aligned_cols=129  Identities=15%  Similarity=0.072  Sum_probs=63.6

Q ss_pred             CCCCEEEEECCCHH-HHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC--
Q ss_conf             85578999587843-8999999867--998899998898999988999998066452225302004442353100001--
Q gi|255764482|r   10 TGSFHLADLGAGAG-AAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA--   84 (225)
Q Consensus        10 ~~~~~VLDlGcG~G-~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~--   84 (225)
                      -+|.++|=.|+|.+ .+...+|+++  .+++|+-...++...+.+++-....+      ......+|+.+........  
T Consensus         8 L~GK~alITGaag~~GIG~aiA~~la~~GA~V~i~~~~~~~~~~~~~l~~~~g------~~~~~~~Dvtd~~~v~~~v~~   81 (272)
T PRK08159          8 MQGKRGLILGVANNRSIAWGIAKACRAAGAELAFTYQGDALKKRVEPLAAELG------AFVVGHCDVTDEASIDAVFET   81 (272)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHCC------CEEEEECCCCCHHHHHHHHHH
T ss_conf             58999999889998689999999999869999997486689999999998649------818998378999999999999


Q ss_pred             -CCCCCCCCEEEECCCCCCCCCCCC--CCH-HHHHHHCCCCC--CHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             -235765205772265446446547--885-45565205668--9899999999862469837870
Q gi|255764482|r   85 -GLKNNFYDHVIMNPPFNERIGTMT--PDK-IKEEAHVMLED--SFEKWIRTACAIMRSSGQLSLI  144 (225)
Q Consensus        85 -~~~~~~fDlii~nPPy~~~~~~~~--~~~-~~~~a~~~~~~--~~~~~~~~a~~lLkpgG~~~~i  144 (225)
                       ....+..|.++.|..+........  .+. .....+....+  ....+.+.+..++++||.+..+
T Consensus        82 ~~~~~G~iDiLVnnag~~~~~~~~~~~~d~~~~~~~~~~~vn~~~~~~~~~~~~~~m~~ggsIv~i  147 (272)
T PRK08159         82 LEKKWGKLDFVVHAIGFSDKDELTGRYVDTSEDNFSMTMLISVYSLTAVAQRAEKLMTDGGSILTL  147 (272)
T ss_pred             HHHHHCCCCEEEECCCCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEE
T ss_conf             999869978898535446664456654328899999999888689999998876540478703478


No 389
>PRK07806 short chain dehydrogenase; Provisional
Probab=65.31  E-value=9.9  Score=17.69  Aligned_cols=124  Identities=17%  Similarity=0.153  Sum_probs=70.3

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCH-HHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---
Q ss_conf             55789995878438999999867--998899998898-999988999998066452225302004442353100001---
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSP-LMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---   84 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~-~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---   84 (225)
                      +|+.+|=-|.+.| ++..+|+++  .+++|+-.+.+. +..+...+.++..     ..+...+++|+.+......+.   
T Consensus         5 ~gKvalVTGas~G-IG~aiA~~la~~Ga~Vvi~~~~~~~~a~~~~~~i~~~-----g~~a~~~~~Dvtd~~~v~~l~~~~   78 (248)
T PRK07806          5 PGKIALVTGSSRG-IGAEVAKYLAGAGAHVVVNYRNKAARAEKVVAEIRAA-----GGRASAVGADLTDEASVAALMDAI   78 (248)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHC-----CCEEEEEECCCCCHHHHHHHHHHH
T ss_conf             9988999378859-9999999999879989998389568999999999961-----983999978999999999999999


Q ss_pred             CCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             2357652057722654464465478854556520566898999999998624698378702
Q gi|255764482|r   85 GLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIA  145 (225)
Q Consensus        85 ~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~  145 (225)
                      ...-+..|..+.|........... +...   .... .....+++.+..+++.||+..++-
T Consensus        79 ~~~~G~iDiLVnNAg~~~~~~~~~-~~~~---~~n~-~~~~~~~~~~~p~m~~gg~Ii~is  134 (248)
T PRK07806         79 RAEFGGLDALVLNASGGMESGMDP-DYAM---RLNR-DAQRRLLTLALPLMPAGSRVVFVT  134 (248)
T ss_pred             HHHCCCCCEEEECCCCCCCCCCCH-HHHH---HHHH-HHHHHHHHHHHHHHCCCCEEEEEC
T ss_conf             998499989998999987789972-2689---9998-999999999997750497899985


No 390
>PRK06057 short chain dehydrogenase; Provisional
Probab=65.12  E-value=10  Score=17.67  Aligned_cols=80  Identities=23%  Similarity=0.216  Sum_probs=51.5

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---C
Q ss_conf             55789995878438999999867--998899998898999988999998066452225302004442353100001---2
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---G   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---~   85 (225)
                      +|+.+|=-|.+.| ++..+|+++  .+++|+..|++++..+.+...+          ...+++.|+.+......+.   .
T Consensus         6 ~gKvalVTGas~G-IG~aia~~la~~Ga~Vvi~d~~~~~~~~~~~~~----------~~~~~~~Dv~~~~~v~~~v~~~~   74 (255)
T PRK06057          6 AGRVAVITGGASG-IGLATARRMRAEGATVVVGDIDPEAGKAAADEL----------GGLFVQVDVTDEDAVNALFDTAA   74 (255)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHC----------CCEEEEEECCCHHHHHHHHHHHH
T ss_conf             9998999684888-999999999986998999969889999999864----------99799981699999999999999


Q ss_pred             CCCCCCCEEEECCCCC
Q ss_conf             3576520577226544
Q gi|255764482|r   86 LKNNFYDHVIMNPPFN  101 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~  101 (225)
                      ...+..|..+.|--..
T Consensus        75 ~~~G~iDiLVNnAGi~   90 (255)
T PRK06057         75 ETYGSVDIAFNNAGIS   90 (255)
T ss_pred             HHHCCCCEEEECCCCC
T ss_conf             9819987899888557


No 391
>PRK01747 mnmC 5-methylaminomethyl-2-thiouridine methyltransferase; Reviewed
Probab=65.10  E-value=10  Score=17.67  Aligned_cols=40  Identities=28%  Similarity=0.347  Sum_probs=26.0

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHH-------CCCCEEEEEECCHHHHH
Q ss_conf             85578999587843899999986-------79988999988989999
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASR-------LHEAQILLAERSPLMAH   49 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r-------~~~~~v~gvD~~~~~~~   49 (225)
                      +..-.|+|.|=|+|..-+...+.       ....+.++||.-|-..+
T Consensus        56 ~~~f~i~E~GFGtGLNfl~t~~~~~~~~~~~~~L~~~s~E~~Pl~~~  102 (660)
T PRK01747         56 RRRFVIAETGFGTGLNFLATWQAFRQPPARLKRLHFISFEKFPLTRA  102 (660)
T ss_pred             CCCEEEEEECCCHHHHHHHHHHHHHHCCCCCCEEEEEEEECCCCCHH
T ss_conf             99779999687557999999999971478897589999979989999


No 392
>pfam04378 DUF519 Protein of unknown function (DUF519). Bacterial family of unknown function, possibly secreted.
Probab=64.95  E-value=10  Score=17.65  Aligned_cols=116  Identities=12%  Similarity=0.150  Sum_probs=69.5

Q ss_pred             EEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCEE
Q ss_conf             99958784389999998679988999988989999889999980664522253020044423531000012357652057
Q gi|255764482|r   15 LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHV   94 (225)
Q Consensus        15 VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~fDli   94 (225)
                      -++.-.||=.++..+.  .++-++..+|..|.-.+..+.|+..      ..++.+.+.|-........   -+.++=-+|
T Consensus        61 ~l~~YPGSP~ia~~ll--R~qDrl~l~ELHp~d~~~L~~~~~~------~~~v~v~~~DG~~~l~a~l---PP~~rRglV  129 (245)
T pfam04378        61 KLRYYPGSPLLARQLL--RAQDRLVLCELHPSDYPLLKAEFAG------DRRVRVHQADGFAALKAFL---PPKERRGLV  129 (245)
T ss_pred             CCCCCCCCHHHHHHHC--CCCCCEEEEECCHHHHHHHHHHHCC------CCCCEEEECCHHHHHHHHC---CCCCCCEEE
T ss_conf             9688899899999848--9667689885597999999987455------8765799365899999668---997786799


Q ss_pred             EECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCC--CCCEEEEECC---HHHHHHHHHHHHC
Q ss_conf             722654464465478854556520566898999999998624--6983787028---8889999998521
Q gi|255764482|r   95 IMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMR--SSGQLSLIAR---PQSLIQIVNACAR  159 (225)
Q Consensus        95 i~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLk--pgG~~~~i~~---~~~l~~~l~~~~~  159 (225)
                      +-.|||-.                  ...+..+++...+.++  +.|...+=+|   ..+...++..+..
T Consensus       130 LIDPpYE~------------------k~ey~~v~~~l~~a~~r~~~g~y~iWYPi~~~~~~~~~~~~l~~  181 (245)
T pfam04378       130 LIDPPFEL------------------KDEYQRVVAALREAYKRWPTGIYAIWYPIKDRRQVKRFYRALEG  181 (245)
T ss_pred             EECCCCCC------------------HHHHHHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHH
T ss_conf             96798666------------------56999999999999985788379999655874999999999985


No 393
>PRK08226 short chain dehydrogenase; Provisional
Probab=64.85  E-value=10  Score=17.64  Aligned_cols=126  Identities=16%  Similarity=0.116  Sum_probs=66.9

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---C
Q ss_conf             55789995878438999999867--998899998898999988999998066452225302004442353100001---2
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---G   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---~   85 (225)
                      +|..+|=-|.+.| ++..+|+++  .+++|+.+|++++..+.+++ +...     ..++..+..|+.+........   .
T Consensus         5 ~gKvalVTGas~G-IG~aiA~~la~~Ga~Vvi~d~~~~~~~~~~~-~~~~-----g~~~~~~~~Dvsd~~~v~~~v~~~~   77 (263)
T PRK08226          5 TGKTALITGALQG-IGEGIARVFARHGANLILLDISPEIEKLADE-LCGR-----GHRCTAVVADVRDPASVAAAIKRAK   77 (263)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHH-HHHC-----CCCEEEEEEECCCHHHHHHHHHHHH
T ss_conf             9988999473779-9999999999879989999698799999999-9836-----9917999941799999999999999


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCC--HHHHHHHHHHHCC--CCCEEEEE
Q ss_conf             35765205772265446446547885455652056689--8999999998624--69837870
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDS--FEKWIRTACAIMR--SSGQLSLI  144 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~--~~~~~~~a~~lLk--pgG~~~~i  144 (225)
                      ...+..|..+.|.-..........+..... +....+.  .....+.+...++  .+|++..+
T Consensus        78 ~~~G~iDiLVNNAGi~~~~~~~~~~~e~w~-~~~~vNl~g~f~~~~~~~p~m~~~~~G~IIni  139 (263)
T PRK08226         78 EKEGRIDILVNNAGVCRLGNFLDMSDEDRD-FHIDINIKGVWNVTKAVLPEMIARKDGRIVMM  139 (263)
T ss_pred             HHHCCCCEEEECCCCCCCCCHHHCCHHHHH-HHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             983998699989977899990129999999-99999729999999999999998389989999


No 394
>pfam03686 UPF0146 Uncharacterized protein family (UPF0146). The function of this family of proteins is unknown.
Probab=64.45  E-value=7.1  Score=18.50  Aligned_cols=43  Identities=14%  Similarity=0.169  Sum_probs=28.3

Q ss_pred             HHHC-CCCCCCEEEEECCCHHH-HHHHHHHHCCCCEEEEEECCHHHH
Q ss_conf             2438-99855789995878438-999999867998899998898999
Q gi|255764482|r    4 ASLV-NATGSFHLADLGAGAGA-AGLAVASRLHEAQILLAERSPLMA   48 (225)
Q Consensus         4 a~~~-~~~~~~~VLDlGcG~G~-~~l~la~r~~~~~v~gvD~~~~~~   48 (225)
                      |.++ .-.+.++|.|+|-|.-. .+..|+++  +..|+.+|+++..+
T Consensus         5 a~~ia~~~~~gkiVEVGIG~~~~vA~~L~~~--g~dv~~tDi~~~av   49 (127)
T pfam03686         5 AEYIARENARGKVVEVGIGFFLDVAKRLAER--GFDVLATDINEKAV   49 (127)
T ss_pred             HHHHHHHCCCCCEEEEECCCCHHHHHHHHHC--CCCEEEEECCCCCC
T ss_conf             9998741878858999136888999999985--99689997776576


No 395
>PRK08263 short chain dehydrogenase; Provisional
Probab=64.43  E-value=10  Score=17.59  Aligned_cols=123  Identities=14%  Similarity=0.030  Sum_probs=67.5

Q ss_pred             CCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC---CCC
Q ss_conf             5789995878438999999867--99889999889899998899999806645222530200444235310000---123
Q gi|255764482|r   12 SFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL---AGL   86 (225)
Q Consensus        12 ~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~---~~~   86 (225)
                      |..+|=-||++| ++..+|.++  .+++|++++.+++.++...+.        ...++..+..|+.+.......   ...
T Consensus         3 gKv~lITGassG-IG~a~A~~la~~G~~Vv~~~R~~~~l~~l~~~--------~~~~~~~~~~Dvtd~~~v~~~v~~~~~   73 (275)
T PRK08263          3 GKVWFITGASRG-FGREWTEAALERGDRVVATARDTATLADLAER--------YGDALLPLALDVTDRAAVFAAVEQAVK   73 (275)
T ss_pred             CCEEEEECCCHH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHH--------CCCCEEEEEEECCCHHHHHHHHHHHHH
T ss_conf             998999467439-99999999998799899997989999999997--------599679999648999999999999999


Q ss_pred             CCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCH--HHHHHHHHHHCCC--CCEEEEE
Q ss_conf             57652057722654464465478854556520566898--9999999986246--9837870
Q gi|255764482|r   87 KNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSF--EKWIRTACAIMRS--SGQLSLI  144 (225)
Q Consensus        87 ~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~--~~~~~~a~~lLkp--gG~~~~i  144 (225)
                      ..+..|.++.|.-+...+.....+... ..+....+.+  ....+.+...++.  +|++..+
T Consensus        74 ~~G~iDiLVNNAG~~~~~~~~e~~~~~-~~~~~~vNl~g~~~~~~a~lp~m~~~~~G~Ivni  134 (275)
T PRK08263         74 HFGRLDIVVNNAGYGLFGMIEEVTESE-ARAQIDTNVFGALWVTQAVLPYLRAQRSGHIIQI  134 (275)
T ss_pred             HHCCCCEEEECCCCCCCCCHHHCCHHH-HHHHHHHHHHHHHHHHHHHCCHHHHCCCCEEEEE
T ss_conf             849987899888667888747699999-9999998619999987642613351699779994


No 396
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=63.91  E-value=11  Score=17.54  Aligned_cols=128  Identities=17%  Similarity=0.099  Sum_probs=68.9

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECC-HHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC--
Q ss_conf             855789995878438999999867--99889999889-8999988999998066452225302004442353100001--
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRL--HEAQILLAERS-PLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA--   84 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~-~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~--   84 (225)
                      -+|..++=.|++.| ++..+|+++  .+++|+.++.+ +..++.+.+.+...     ..++.++..|+.+......+.  
T Consensus         5 LkgK~~lITGas~G-IG~aia~~la~~G~~V~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~Dl~~~~~~~~~~~~   78 (250)
T PRK12825          5 LSGRVALVTGAARG-IGRAIALRLAAAGADVIVHPPSDEAAAEETVAAVEAL-----GRRAQAVQADVTDAAALEAAVEE   78 (250)
T ss_pred             CCCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHC-----CCCEEEEEEECCCHHHHHHHHHH
T ss_conf             09788999389558-9999999999879989999798878999999999853-----99489999418999999999999


Q ss_pred             -CCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCC--HHHHHHHHHHHCC--CCCEEEEE
Q ss_conf             -235765205772265446446547885455652056689--8999999998624--69837870
Q gi|255764482|r   85 -GLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDS--FEKWIRTACAIMR--SSGQLSLI  144 (225)
Q Consensus        85 -~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~--~~~~~~~a~~lLk--pgG~~~~i  144 (225)
                       ....+..|.++.|.-..........+.... ......+.  ...+.+.+...++  .+|++..+
T Consensus        79 ~~~~~g~iDilInnAg~~~~~~~~~~~~~~~-~~~~~vNl~~~~~~~~~~~~~m~~~~~G~II~i  142 (250)
T PRK12825         79 LVERFGAIDILVNNAGITGDGRLWEMSDDEW-ERVIDVNLTGVFNVLRAVVPPMIEAGGGRIVNI  142 (250)
T ss_pred             HHHHCCCCCEEEECCCCCCCCCHHHCCHHHH-HHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             9997699989998998899989023999999-999998518999999998999997499739999


No 397
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional
Probab=63.61  E-value=11  Score=17.50  Aligned_cols=130  Identities=13%  Similarity=0.082  Sum_probs=64.8

Q ss_pred             CCCEEEEECCCH-HHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC---C
Q ss_conf             557899958784-38999999867--99889999889899998899999806645222530200444235310000---1
Q gi|255764482|r   11 GSFHLADLGAGA-GAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL---A   84 (225)
Q Consensus        11 ~~~~VLDlGcG~-G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~---~   84 (225)
                      +|+.+|=-|++. -.++..+|+++  .+++|+-.+.++...+.+++-++...    ..+...++.|+.+.......   .
T Consensus         5 ~gK~~lVTGaag~rGIG~aiA~~la~~Ga~Vvi~~~~~~~~~~~~~~~~~~~----~~~~~~~~~Dvs~~~~v~~~~~~~   80 (256)
T PRK08594          5 EGKTYVVMGVANKRSIAWGIARSLHNAGAKLVFTYAGERLEKEVRELAETLE----QQESLVLPCDVTSDEEITACFETI   80 (256)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHC----CCCEEEEECCCCCHHHHHHHHHHH
T ss_conf             9988999899999639999999999879999997488066999999998707----994799991389999999999999


Q ss_pred             CCCCCCCCEEEECCCCCCCCCCC----CCCHHH-HHHHCCCCCCHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             23576520577226544644654----788545-5652056689899999999862469837870
Q gi|255764482|r   85 GLKNNFYDHVIMNPPFNERIGTM----TPDKIK-EEAHVMLEDSFEKWIRTACAIMRSSGQLSLI  144 (225)
Q Consensus        85 ~~~~~~fDlii~nPPy~~~~~~~----~~~~~~-~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i  144 (225)
                      ....+..|.++.|-.+.......    ..+... ..........+....+.+..+++.+|.+..+
T Consensus        81 ~~~~g~id~lv~na~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GsIv~i  145 (256)
T PRK08594         81 KKEVGVIHGVAHCIAFANKEDLRGEFLETSRDGFLLAQNISAYSLTAVAREAKKLMTEGGSIVTL  145 (256)
T ss_pred             HHHHCCCCEEEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEE
T ss_conf             99858867466532102344445530018899999988554367778888887653578669985


No 398
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=63.19  E-value=11  Score=17.46  Aligned_cols=85  Identities=16%  Similarity=0.057  Sum_probs=56.1

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---C
Q ss_conf             55789995878438999999867--998899998898999988999998066452225302004442353100001---2
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---G   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---~   85 (225)
                      +|..+|=-|.+.| ++..+|+++  .+++|+.+|.+++.++.+.+.++..+     .++.....|+.+........   .
T Consensus         4 ~gK~~lITGas~G-IG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~~l~~~g-----~~~~~~~~Dv~~~~~v~~~~~~~~   77 (253)
T PRK08217          4 KDKVIVITGGAQG-LGRAMAEYLAQKGAKLALIDLNQEKLEEAVAQCAALG-----GEAEVYAANVTDEEDVEATFAQIA   77 (253)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC-----CCEEEEECCCCCHHHHHHHHHHHH
T ss_conf             9988999488778-9999999999879989999799999999999999659-----948999824799999999999999


Q ss_pred             CCCCCCCEEEECCCCC
Q ss_conf             3576520577226544
Q gi|255764482|r   86 LKNNFYDHVIMNPPFN  101 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~  101 (225)
                      ...+..|.++.|.-..
T Consensus        78 ~~~g~iD~lVnNAGi~   93 (253)
T PRK08217         78 EDFGQLNGLINNAGIL   93 (253)
T ss_pred             HHHCCCCEEEECCCCC
T ss_conf             9839985999857436


No 399
>PRK07035 short chain dehydrogenase; Provisional
Probab=63.18  E-value=11  Score=17.46  Aligned_cols=127  Identities=15%  Similarity=0.164  Sum_probs=68.6

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC---CC
Q ss_conf             55789995878438999999867--99889999889899998899999806645222530200444235310000---12
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL---AG   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~---~~   85 (225)
                      +|..+|=-|.+.| ++..+|+++  .+++|+..+.+.+.++...+.++..+     .+...+..|+.+......+   ..
T Consensus         7 ~gKvalITGas~G-IG~aia~~la~~Ga~V~i~~r~~~~l~~~~~~i~~~g-----~~~~~~~~Dv~~~~~v~~~~~~~~   80 (252)
T PRK07035          7 TGKIALVTGASRG-IGEAIAKLLAQQGAHVIVSSRKLDGCQAVADAIVAAG-----GKAEALACHIGEMEQIDALFAQIR   80 (252)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC-----CCEEEEECCCCCHHHHHHHHHHHH
T ss_conf             8998999588749-9999999999879989999798899999999999649-----957999824899999999999999


Q ss_pred             CCCCCCCEEEECCCCCCC-CCCCCCC--HHHHHHHCCCCCCHHHHHHHHHHHCCC--CCEEEEE
Q ss_conf             357652057722654464-4654788--545565205668989999999986246--9837870
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNER-IGTMTPD--KIKEEAHVMLEDSFEKWIRTACAIMRS--SGQLSLI  144 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~-~~~~~~~--~~~~~a~~~~~~~~~~~~~~a~~lLkp--gG~~~~i  144 (225)
                      ...+..|.++.|.-.... +.....+  .....-.......+ ...+.+..+++.  +|++..+
T Consensus        81 ~~~G~iDilVnnAg~~~~~~~~~~~~~~~~~~~~~vNl~~~~-~~~~~~~~~m~~~~~G~Ivni  143 (252)
T PRK07035         81 ERHGRLDILVNNAAANPYFGHILDTDLGAFQKTVDVNIRGYF-FMSVEAGKLMKEQGGGSIVNV  143 (252)
T ss_pred             HHHCCCCEEEECCCCCCCCCCCCCCCHHHHHHHHHHHCCCCH-HHHHHHHHHHHHCCCCEEEEE
T ss_conf             982997789876855888888200999999999998712431-000453699996699749997


No 400
>PRK12939 short chain dehydrogenase; Provisional
Probab=63.12  E-value=11  Score=17.45  Aligned_cols=127  Identities=17%  Similarity=0.108  Sum_probs=74.1

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---C
Q ss_conf             55789995878438999999867--998899998898999988999998066452225302004442353100001---2
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---G   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---~   85 (225)
                      +|..+|=-|.+.| ++..+|+++  .+++|+..+.+++-++.+.+-++..+     .++...++|+.+......+.   .
T Consensus         6 ~~KvalVTGgs~G-IG~aia~~la~~Ga~Vvi~~~~~~~~~~~~~~l~~~g-----~~~~~~~~Dv~~~~~~~~~~~~~~   79 (250)
T PRK12939          6 AGKRALVTGAARG-LGAAFAEALAEAGATVAFNDGLAAEARELAAALEAAG-----GRAHAIAADLADPASVQRFFDAAA   79 (250)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC-----CEEEEEEECCCCHHHHHHHHHHHH
T ss_conf             9987999583668-9999999999879999999698899999999999559-----909999924899999999999999


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCC--CHHHHHHHHHHHCCC--CCEEEEE
Q ss_conf             3576520577226544644654788545565205668--989999999986246--9837870
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLED--SFEKWIRTACAIMRS--SGQLSLI  144 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~--~~~~~~~~a~~lLkp--gG~~~~i  144 (225)
                      ...+..|..+.|--+.........+..... +....+  ..-.+.+.+...++.  +|++..+
T Consensus        80 ~~~g~iDiLVNNAG~~~~~~~~~~~~e~~~-~~~~iNl~~~~~~~k~~~~~m~~~~~G~IIni  141 (250)
T PRK12939         80 AALGGLDGLVNNAGITNSKSATELDIDTWD-AVMNVNVRGTFLMSRAALPHLRDSGRGRIVNL  141 (250)
T ss_pred             HHCCCCCEEEECCCCCCCCCCHHCCHHHHH-HHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             974999799988778999990349999999-99999829999999999999998499379998


No 401
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional
Probab=62.54  E-value=11  Score=17.39  Aligned_cols=82  Identities=21%  Similarity=0.174  Sum_probs=49.9

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---C
Q ss_conf             55789995878438999999867--998899998898999988999998066452225302004442353100001---2
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---G   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---~   85 (225)
                      +|+.+|=-|++.| ++..+|+++  .+++|+.+|.++...+.+.+-. .     ...++..+..|+........+.   .
T Consensus         7 ~gKvalITGas~G-IG~aiA~~la~~Ga~V~~~~r~~~~~~~~~~~~-~-----~~~~~~~~~~Dv~~~~~~~~~~~~~~   79 (260)
T PRK12823          7 AGKVAVVTGAAQG-IGRGVALRAAAEGARVVLVDRSELVHEVAAELV-A-----AGGEALALTADLETYAGAQAVMAAAV   79 (260)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHH-H-----CCCCEEEEECCCCCHHHHHHHHHHHH
T ss_conf             9998999488678-999999999987999999969468999999998-5-----49948999812688589999999999


Q ss_pred             CCCCCCCEEEECCC
Q ss_conf             35765205772265
Q gi|255764482|r   86 LKNNFYDHVIMNPP   99 (225)
Q Consensus        86 ~~~~~fDlii~nPP   99 (225)
                      ...+..|.++.|.-
T Consensus        80 ~~~G~iDiLVnnag   93 (260)
T PRK12823         80 EAFGRIDVLINNVG   93 (260)
T ss_pred             HHHCCCCEEEECCC
T ss_conf             98399879997752


No 402
>PRK12824 acetoacetyl-CoA reductase; Provisional
Probab=62.45  E-value=11  Score=17.38  Aligned_cols=125  Identities=17%  Similarity=0.093  Sum_probs=65.7

Q ss_pred             EEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---CCCC
Q ss_conf             89995878438999999867--998899998898999988999998066452225302004442353100001---2357
Q gi|255764482|r   14 HLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---GLKN   88 (225)
Q Consensus        14 ~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---~~~~   88 (225)
                      .+|=-|++.| ++..+|+++  .+++|+..+.+.+-...  +......  ....++.....|+.+......+.   ....
T Consensus         4 valITGas~G-IG~a~a~~la~~G~~Vv~~~~~~~~~~~--~~~~~~~--~~~~~~~~~~~D~~d~~~~~~~v~~~~~~~   78 (245)
T PRK12824          4 IALVTGAKRG-IGSAIARELLADGYRVIATYFGNYDAAK--DWFEEYG--FTEDQVRLKSLDVTDTEECQEALARIEEEE   78 (245)
T ss_pred             EEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCCHHHHH--HHHHHHH--HCCCCEEEEECCCCCHHHHHHHHHHHHHHC
T ss_conf             9999478888-9999999999879989999588077899--9999874--049938999913899999999999999974


Q ss_pred             CCCCEEEECCCCCCCCCCCCCCHHH--HHHHCCCCCCHHHHHHHHHHHCCC--CCEEEEE
Q ss_conf             6520577226544644654788545--565205668989999999986246--9837870
Q gi|255764482|r   89 NFYDHVIMNPPFNERIGTMTPDKIK--EEAHVMLEDSFEKWIRTACAIMRS--SGQLSLI  144 (225)
Q Consensus        89 ~~fDlii~nPPy~~~~~~~~~~~~~--~~a~~~~~~~~~~~~~~a~~lLkp--gG~~~~i  144 (225)
                      +..|.++.|............+...  ..-..... ....+.+.+.+.++.  +|++..+
T Consensus        79 g~iDiLVnnAG~~~~~~~~~~~~e~w~~~~~vNl~-~~f~~~~~~~~~m~~~~~G~IVni  137 (245)
T PRK12824         79 GPVDILVNNAGITRDSGFKRMSHQEWNDVINTNLN-SVFNVTQPLFPAMCEQGYGRIINI  137 (245)
T ss_pred             CCCCEEEECCCCCCCCCCHHCCHHHHHHHHHHHHH-HHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             99989998988899999023999999999999734-159999999999998399559997


No 403
>PRK08213 gluconate 5-dehydrogenase; Provisional
Probab=62.07  E-value=11  Score=17.34  Aligned_cols=86  Identities=20%  Similarity=0.130  Sum_probs=58.3

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---C
Q ss_conf             55789995878438999999867--998899998898999988999998066452225302004442353100001---2
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---G   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---~   85 (225)
                      +|..+|=-|++.| ++..+|+++  .+++|+..+.+++.++.+.+.++..+     .+...+++|+.+........   .
T Consensus        11 ~gKvalVTG~s~G-IG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~l~~~g-----~~~~~~~~Dv~~~~~v~~~v~~~~   84 (259)
T PRK08213         11 TGKTALVTGGSRG-LGLQIAEALGEAGARVVLSARKAEELEEAAAHLEALG-----IDALWLAADVADEADIERLAEETL   84 (259)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC-----CCEEEEECCCCCHHHHHHHHHHHH
T ss_conf             9998999487768-9999999999869999999798899999999999549-----958999826899999999999999


Q ss_pred             CCCCCCCEEEECCCCCC
Q ss_conf             35765205772265446
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNE  102 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~  102 (225)
                      ..-+..|..+.|.-...
T Consensus        85 ~~~G~iDiLVNNAG~~~  101 (259)
T PRK08213         85 ERFGHIDILVNNAGATW  101 (259)
T ss_pred             HHHCCCCEEEECCCCCC
T ss_conf             98399989998997788


No 404
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional
Probab=61.32  E-value=12  Score=17.26  Aligned_cols=49  Identities=22%  Similarity=0.220  Sum_probs=35.0

Q ss_pred             CCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCC
Q ss_conf             78438999999867--9988999988989999889999980664522253020044423531
Q gi|255764482|r   20 AGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGE   79 (225)
Q Consensus        20 cG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~   79 (225)
                      ||-|.++..+++..  .+..++.+|.||+.++.+|+           .-..+..+|..+...
T Consensus       406 ~G~GR~Gq~var~L~~~gi~~vviD~d~~~V~~~r~-----------~G~~v~yGDat~~~v  456 (602)
T PRK03659        406 VGFGRFGQVIGRLLMANKMRITVLERDISAVNLMRK-----------YGYKVYYGDATQLEL  456 (602)
T ss_pred             ECCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHH-----------CCCEEEEECCCCHHH
T ss_conf             788756899999999789998999786799999997-----------899089758999999


No 405
>COG5379 BtaA S-adenosylmethionine:diacylglycerol 3-amino-3-carboxypropyl transferase [Lipid metabolism]
Probab=61.18  E-value=12  Score=17.25  Aligned_cols=47  Identities=21%  Similarity=0.224  Sum_probs=33.4

Q ss_pred             CCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHH
Q ss_conf             8998557899958784389999998679988999988989999889999
Q gi|255764482|r    7 VNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTL   55 (225)
Q Consensus         7 ~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~   55 (225)
                      ++...|.+|.-+|+|.-.+. .+..|.| ++|+.||+++..+++-+-.+
T Consensus        59 m~~g~ghrivtigSGGcn~L-~ylsr~P-a~id~VDlN~ahiAln~lkl  105 (414)
T COG5379          59 MQLGIGHRIVTIGSGGCNML-AYLSRAP-ARIDVVDLNPAHIALNRLKL  105 (414)
T ss_pred             HHCCCCCEEEEECCCCCHHH-HHHHCCC-CEEEEEECCHHHHHHHHHHH
T ss_conf             85077837999458861387-8761497-60378837889989989999


No 406
>PRK05993 short chain dehydrogenase; Provisional
Probab=61.14  E-value=12  Score=17.24  Aligned_cols=120  Identities=14%  Similarity=0.114  Sum_probs=63.6

Q ss_pred             CCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC----C
Q ss_conf             5789995878438999999867--998899998898999988999998066452225302004442353100001----2
Q gi|255764482|r   12 SFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA----G   85 (225)
Q Consensus        12 ~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~----~   85 (225)
                      ...||=-||++|. +..+|+++  .+++|+++..+++.++..+.           ..++....|+.+........    .
T Consensus         4 ~K~vlITGassGI-G~alA~~la~~G~~V~~~~R~~~~l~~l~~-----------~~~~~~~~Dv~d~~~v~~~v~~~~~   71 (277)
T PRK05993          4 KRSILITGCSSGI-GAYCAHALQKRGWRVFATCRKPEDIAALEA-----------EGLEAFYLDYAEPESIAALVAQVLE   71 (277)
T ss_pred             CCEEEEECCCCHH-HHHHHHHHHHCCCEEEEEECCHHHHHHHHH-----------CCCEEEEEECCCHHHHHHHHHHHHH
T ss_conf             8689992568699-999999999879999999799999999984-----------8981999726677999999999999


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCH--HHHHHHHHHHCCC--CCEEEEE
Q ss_conf             357652057722654464465478854556520566898--9999999986246--9837870
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSF--EKWIRTACAIMRS--SGQLSLI  144 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~--~~~~~~a~~lLkp--gG~~~~i  144 (225)
                      ...+..|.++.|--+...+.....+... .......+.+  ..+.+.+..+++.  .|++..+
T Consensus        72 ~~~g~id~lvNnAg~~~~g~~e~~~~~~-~~~~~~vN~~g~~~~~~~~lP~m~~~~~G~IVni  133 (277)
T PRK05993         72 LSGGKLDALFNNGAYGQPGAVEDLPVEA-LRAQFEANFFGWHDLTRRIIPVMRKQGHGRIVQC  133 (277)
T ss_pred             HHCCCEEEEEECCCCCCCCCHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEE
T ss_conf             8089706999666435677088867999-9999887018999999997233134898389998


No 407
>PRK12747 short chain dehydrogenase; Provisional
Probab=60.89  E-value=12  Score=17.22  Aligned_cols=128  Identities=16%  Similarity=0.046  Sum_probs=65.5

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEE-EECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCC--
Q ss_conf             55789995878438999999867--9988999-988989999889999980664522253020044423531000012--
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILL-AERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAG--   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~g-vD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~--   85 (225)
                      +|..+|=-|.+.| ++..+|+++  .+++|.- ...+++..+.....+...+     .+...+..|+.+.........  
T Consensus         3 ~gKvalITGas~G-IG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~d~~~~~~~~~~~~~~   76 (252)
T PRK12747          3 KGKVALVTGASRG-IGRAIAKRLANDGALVAIHYGNRKEEAEETVYEIQSNG-----GSAFSIGANLESLHGVEALYSSL   76 (252)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCC-----CCEEEEECCCCCHHHHHHHHHHH
T ss_conf             9599999484778-99999999998799999965998789999999999649-----95799833635679999999999


Q ss_pred             -------CCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHC-CCCCCHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             -------357652057722654464465478854556520-56689899999999862469837870
Q gi|255764482|r   86 -------LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHV-MLEDSFEKWIRTACAIMRSSGQLSLI  144 (225)
Q Consensus        86 -------~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~-~~~~~~~~~~~~a~~lLkpgG~~~~i  144 (225)
                             ...++.|..+.|.-+.........+........ ........+.+.+...++.+|++..+
T Consensus        77 ~~~~~~~~g~~~iDiLVnnAG~~~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~~~~m~~~g~IVni  143 (252)
T PRK12747         77 DNELQKRTGSTKFDILINNAGIGPGAFIEETTEQFFDRMVSVNAKAPFFIIQQALSRLRDNSRIINI  143 (252)
T ss_pred             HHHHHHHCCCCCCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEE
T ss_conf             9999984289981089989999999881349999999999997568999999999999766975089


No 408
>PRK06545 prephenate dehydrogenase; Validated
Probab=60.55  E-value=12  Score=17.18  Aligned_cols=40  Identities=20%  Similarity=0.136  Sum_probs=28.3

Q ss_pred             EEEEECCCH--HHHHHHHHHHCCCCEEEEEECCHHHHHHHHH
Q ss_conf             899958784--3899999986799889999889899998899
Q gi|255764482|r   14 HLADLGAGA--GAAGLAVASRLHEAQILLAERSPLMAHYARK   53 (225)
Q Consensus        14 ~VLDlGcG~--G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~   53 (225)
                      +|+=+|+|-  |.+++++.++.+..+++|+|.++..++.|.+
T Consensus         2 ~V~IiGlGLIGgSlalalk~~g~~~~i~~~d~~~~~l~~A~~   43 (357)
T PRK06545          2 TVLIVGLGLIGGSLALAIKAAGPDVFIIGYDPSGAQLARALG   43 (357)
T ss_pred             EEEEEEECHHHHHHHHHHHHCCCCEEEEEECCCHHHHHHHHH
T ss_conf             799997787899999999854997699996699999999986


No 409
>PRK08643 acetoin reductase; Validated
Probab=60.48  E-value=12  Score=17.18  Aligned_cols=124  Identities=17%  Similarity=0.083  Sum_probs=66.1

Q ss_pred             EEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC---CCCCC
Q ss_conf             89995878438999999867--99889999889899998899999806645222530200444235310000---12357
Q gi|255764482|r   14 HLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL---AGLKN   88 (225)
Q Consensus        14 ~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~---~~~~~   88 (225)
                      .+|=-|++.| ++..+|.++  .+++|.-.|++++.++.+.+.+...+     .+...++.|+.+.......   ....-
T Consensus         4 valVTGg~~G-IG~aia~~la~~Ga~V~i~d~~~~~~~~~~~~~~~~~-----~~~~~~~~Dvt~~~~v~~~~~~~~~~~   77 (256)
T PRK08643          4 VALVTGAGQG-IGFAIAKRLVEDGFKVAIVDYNEETAKAAADKLSSDG-----GKAIAVKADVSNRDQVFDAVQQVVDTF   77 (256)
T ss_pred             EEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC-----CEEEEEECCCCCHHHHHHHHHHHHHHH
T ss_conf             9999575788-9999999999879999999698899999999998539-----909999805899999999999999982


Q ss_pred             CCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCH--HHHHHHHHHHCCC---CCEEEEE
Q ss_conf             652057722654464465478854556520566898--9999999986246---9837870
Q gi|255764482|r   89 NFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSF--EKWIRTACAIMRS---SGQLSLI  144 (225)
Q Consensus        89 ~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~--~~~~~~a~~lLkp---gG~~~~i  144 (225)
                      +..|..+.|--.............. +.+....+..  -...+.+.++++.   +|++..+
T Consensus        78 G~iDiLVNnAG~~~~~~~~~~~~~~-w~~~~~vNl~g~~~~~~~~~~~m~~~~~~G~IVni  137 (256)
T PRK08643         78 GDLNVVVNNAGLAPTTPIDTITEEQ-FKKVYGINVGGVIWGIQAAQEQFKKLGHGGKIINA  137 (256)
T ss_pred             CCCCEEEECCCCCCCCCHHHCCHHH-HHHHHHHHCHHHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             9987999899889998825599999-99999997636899999999999982899279998


No 410
>PRK07776 consensus
Probab=60.46  E-value=12  Score=17.17  Aligned_cols=83  Identities=20%  Similarity=0.147  Sum_probs=51.9

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC---CC
Q ss_conf             55789995878438999999867--99889999889899998899999806645222530200444235310000---12
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL---AG   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~---~~   85 (225)
                      ++..+|=-|.+.| ++..+|+++  .+++|+-.+.+++.++.+.+.+.       ..+...+.+|+.+......+   ..
T Consensus         7 ~gKv~lITG~~~G-IG~aiA~~la~~Ga~V~i~~~~~~~l~~~~~~l~-------~~~~~~~~~Dv~~~~~~~~~~~~~~   78 (252)
T PRK07776          7 TGRTAIVTGASRG-IGLAIAQALAAAGANVVITARKQEALDEAAAQLG-------AERALGVAGHAVDEEHAREAVDLTL   78 (252)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHC-------CCCEEEEEEECCCHHHHHHHHHHHH
T ss_conf             9998999477879-9999999999879989999798899999999847-------9957999974289999999999999


Q ss_pred             CCCCCCCEEEECCCCC
Q ss_conf             3576520577226544
Q gi|255764482|r   86 LKNNFYDHVIMNPPFN  101 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~  101 (225)
                      ..-+..|.++.|.-..
T Consensus        79 ~~~g~iDilVnNAg~~   94 (252)
T PRK07776         79 ERFGSVDILVNNAGTN   94 (252)
T ss_pred             HHHCCCCEEEECCCCC
T ss_conf             9849986999878668


No 411
>PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional
Probab=59.73  E-value=13  Score=17.10  Aligned_cols=71  Identities=15%  Similarity=0.119  Sum_probs=41.7

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCC
Q ss_conf             55789995878438999999867--9988999988989999889999980664522253020044423531000012357
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKN   88 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~   88 (225)
                      +|+++|=-|++.| ++..+|+++  .+++|+++|.++...+..                .+.+.|+.+............
T Consensus         4 ~gK~alVTG~s~G-IG~aia~~la~~GA~V~~~d~~~~~~~~~----------------~~~~~D~~~~~~v~~~v~~~~   66 (261)
T PRK12428          4 DGKTIVVTGVASG-IGAEVARLLRFLGARVIGLDRRPPGMTLD----------------GFHQADLGDPASIDAAVAALP   66 (261)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCCCCCCCC----------------CEEECCCCCHHHHHHHHHHHC
T ss_conf             9988999785779-99999999998699999996885545613----------------176737899999999999837


Q ss_pred             CCCCEEEECC
Q ss_conf             6520577226
Q gi|255764482|r   89 NFYDHVIMNP   98 (225)
Q Consensus        89 ~~fDlii~nP   98 (225)
                      +..|.++.|-
T Consensus        67 g~id~lvn~A   76 (261)
T PRK12428         67 GRIDALFNVA   76 (261)
T ss_pred             CCCCEEEECC
T ss_conf             9887899867


No 412
>PRK05693 short chain dehydrogenase; Provisional
Probab=59.43  E-value=13  Score=17.07  Aligned_cols=118  Identities=15%  Similarity=0.119  Sum_probs=62.5

Q ss_pred             EEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC---CCCCC
Q ss_conf             89995878438999999867--99889999889899998899999806645222530200444235310000---12357
Q gi|255764482|r   14 HLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL---AGLKN   88 (225)
Q Consensus        14 ~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~---~~~~~   88 (225)
                      .||=-||++| ++..+|+++  .+++|++...+++.++....           ..+..+..|+.+.......   .....
T Consensus         3 vvlITGassG-IG~alA~~la~~G~~V~~~~R~~~~l~~l~~-----------~~~~~~~~Dvtd~~~i~~~~~~~~~~~   70 (274)
T PRK05693          3 VVLITGCSSG-IGRALADAFKAAGYEVWATARKAEDVEALAA-----------AGFTAVQLDVNDGAALARLAEELEAEH   70 (274)
T ss_pred             EEEECCCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHH-----------CCCCEEEEECCCHHHHHHHHHHHHHHC
T ss_conf             8999488858-9999999999879999999799999999984-----------899189984699899999999999972


Q ss_pred             CCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCH--HHHHHHHHHHCC-CCCEEEEE
Q ss_conf             652057722654464465478854556520566898--999999998624-69837870
Q gi|255764482|r   89 NFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSF--EKWIRTACAIMR-SSGQLSLI  144 (225)
Q Consensus        89 ~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~--~~~~~~a~~lLk-pgG~~~~i  144 (225)
                      +..|.++.|.-+...+.....+... ..+....+.+  ....+....+++ .+|++..+
T Consensus        71 g~iDiLVNNAG~~~~g~~~~~~~~~-~~~~~~vN~~g~~~~~~~~lP~m~~~~G~IVni  128 (274)
T PRK05693         71 QGLDVLINNAGYGAMGPLLDGGVEA-MRRQFETNVFAVVGVTRALFPLLRRSRGLVVNI  128 (274)
T ss_pred             CCCCEEEECCCCCCCCCHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEE
T ss_conf             9976899888677887589876899-999999981999999999999997589679998


No 413
>PRK06138 short chain dehydrogenase; Provisional
Probab=59.01  E-value=13  Score=17.03  Aligned_cols=126  Identities=22%  Similarity=0.213  Sum_probs=70.7

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---C
Q ss_conf             55789995878438999999867--998899998898999988999998066452225302004442353100001---2
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---G   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---~   85 (225)
                      +|..+|=-|.+.| ++..+|+++  .+++|+..|.+++.++...+.+..      ..++..++.|+.+........   .
T Consensus         4 ~gKvalVTGas~G-IG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~------~~~~~~~~~Dvs~~~~v~~~~~~~~   76 (252)
T PRK06138          4 AGRVAIVTGAGSG-IGRATAKLFAREGARVVVADRDAEAAERVAAAIAA------GGRAFARQGDVGSAEAVEALVDFVA   76 (252)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHC------CCCEEEEEECCCCHHHHHHHHHHHH
T ss_conf             9988999474679-99999999998799899996887899999999837------9919999942899999999999999


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCC--HHHHHHHHHHHCCC--CCEEEEE
Q ss_conf             35765205772265446446547885455652056689--89999999986246--9837870
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDS--FEKWIRTACAIMRS--SGQLSLI  144 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~--~~~~~~~a~~lLkp--gG~~~~i  144 (225)
                      ..-+..|..+.|--..........+... +.+....+.  .....+.+...++.  +|++..+
T Consensus        77 ~~~G~iDiLVNNAG~~~~~~~~~~~~e~-w~~~~~vNl~g~f~~~~~~~p~m~~~~~G~IIni  138 (252)
T PRK06138         77 ARWGRLDVLVNNAGFGCGGTVVTTDEAD-WDAVMRVNVGGVFLWAKYAIPIMQRQGGGSIVNT  138 (252)
T ss_pred             HHCCCCCEEEECCCCCCCCCCCCCCHHH-HHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             9829998999898899999801099999-9999999969999999999999998199679997


No 414
>TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family; InterPro: IPR014189   Members of this family are putative quinone oxidoreductases that belong to the broader superfamily of zinc-dependent alcohol (of medium chain length) dehydrogenases and quinone oxidoreductases. An alignment shows no motif of conserved Cys residues as are found in zinc-binding members of the superfamily, consequently members of this entry are likely to be quinone oxidoreductases. A member of this family in Homo sapiens (Human), PIG3, is induced by p53 but is otherwise uncharacterised..
Probab=58.70  E-value=13  Score=17.00  Aligned_cols=104  Identities=14%  Similarity=0.095  Sum_probs=72.4

Q ss_pred             HHCCCCCCCEEEE--ECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCC
Q ss_conf             4389985578999--58784389999998679988999988989999889999980664522253020044423531000
Q gi|255764482|r    5 SLVNATGSFHLAD--LGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRN   82 (225)
Q Consensus         5 ~~~~~~~~~~VLD--lGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~   82 (225)
                      .....++|++||=  =.+|.|+.++.||+.+ +++|+.+==|++=++.+.+.+   +   .+.-++....||....... 
T Consensus       138 ~~g~L~~GEtvLiHGGaSGIGttAIqLAKA~-Ga~V~~TaGS~eK~~~a~~~L---G---Ad~aINY~e~DFve~~k~~-  209 (334)
T TIGR02824       138 QRGGLKAGETVLIHGGASGIGTTAIQLAKAF-GARVFTTAGSDEKCATACEAL---G---ADIAINYREEDFVEVVKEE-  209 (334)
T ss_pred             HHCCCCCCCEEEEEECCCCHHHHHHHHHHHC-CCEEEEEECCHHHHHHHHHHC---C---CEEEEECCCCCHHHHHHHH-
T ss_conf             2211378972899713673679999999856-975999828989999999860---9---8078607773479999982-


Q ss_pred             CCCCCCC--CCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             0123576--52057722654464465478854556520566898999999998624698378702
Q gi|255764482|r   83 LAGLKNN--FYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIA  145 (225)
Q Consensus        83 ~~~~~~~--~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~  145 (225)
                          ..+  -+|.|+-.-                         --+++..-...|.+.|++.+|-
T Consensus       210 ----t~g~kGvDVILD~v-------------------------Gg~Yl~~N~~alA~dGRlV~Ig  245 (334)
T TIGR02824       210 ----TGGGKGVDVILDIV-------------------------GGSYLARNIKALALDGRLVQIG  245 (334)
T ss_pred             ----CCCCCCCCEEEECC-------------------------CHHHHHHHHHHHHCCCCEEEEE
T ss_conf             ----68998531798577-------------------------6688998999984079399985


No 415
>PRK08862 short chain dehydrogenase; Provisional
Probab=58.45  E-value=13  Score=16.97  Aligned_cols=82  Identities=12%  Similarity=0.051  Sum_probs=51.2

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---C
Q ss_conf             55789995878438999999867--998899998898999988999998066452225302004442353100001---2
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---G   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---~   85 (225)
                      ++..+|=-|++.| ++..+|.++  .+++|+.+|.+++.++.+.+.+...+     .++.....|..+......+.   .
T Consensus         4 k~Kv~lITGas~G-IG~aiA~~~A~~Ga~Vii~~r~~~~l~~~~~~i~~~g-----~~~~~~~~d~~~~~~v~~~~~~i~   77 (227)
T PRK08862          4 KNSIILITSAGSV-LGRTISCHFARLGATLILCDQDQSALNDTYEQCSALT-----DNVYSYQLKDFSQESIRHLFDAIE   77 (227)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC-----CCEEEEEECCCCHHHHHHHHHHHH
T ss_conf             9999999798879-9999999999879999999699999999999999758-----974899951661999999999999


Q ss_pred             CCCC-CCCEEEECC
Q ss_conf             3576-520577226
Q gi|255764482|r   86 LKNN-FYDHVIMNP   98 (225)
Q Consensus        86 ~~~~-~fDlii~nP   98 (225)
                      ..-+ ..|..+-|-
T Consensus        78 ~~~g~~iDvLVNNa   91 (227)
T PRK08862         78 QQFNRAPDVLVNNW   91 (227)
T ss_pred             HHHCCCCEEEEECC
T ss_conf             99589974998566


No 416
>PRK08085 gluconate 5-dehydrogenase; Provisional
Probab=56.87  E-value=14  Score=16.82  Aligned_cols=87  Identities=20%  Similarity=0.164  Sum_probs=57.8

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---C
Q ss_conf             55789995878438999999867--998899998898999988999998066452225302004442353100001---2
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---G   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---~   85 (225)
                      +|+.+|=-|.+.| ++..+|+.+  .+++|+-.|.+++-++.+.+.+...+     .+....+.|+.+........   .
T Consensus         8 ~gK~alVTG~~~G-IG~aiA~~la~~Ga~Vvi~~~~~~~~~~~~~~l~~~g-----~~~~~~~~Dvtd~~~v~~~v~~~~   81 (254)
T PRK08085          8 AGKNILITGSAQG-IGFLLATGLAEYGAEIIINDITAERAEKAVAKLRQEG-----IKAHAAAFNVTHKQEIEAAIEHIE   81 (254)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC-----CEEEEEECCCCCHHHHHHHHHHHH
T ss_conf             9998999685678-9999999999869999999698899999999998449-----818999826899999999999999


Q ss_pred             CCCCCCCEEEECCCCCCC
Q ss_conf             357652057722654464
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNER  103 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~  103 (225)
                      ...+..|..+.|.-....
T Consensus        82 ~~~G~iDilVnNAG~~~~   99 (254)
T PRK08085         82 KDIGPIDVLINNAGIQRR   99 (254)
T ss_pred             HHHCCCCEEEECCCCCCC
T ss_conf             983998699989867888


No 417
>PRK06482 short chain dehydrogenase; Provisional
Probab=56.30  E-value=14  Score=16.76  Aligned_cols=121  Identities=17%  Similarity=0.169  Sum_probs=65.9

Q ss_pred             EEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---CCCC
Q ss_conf             89995878438999999867--998899998898999988999998066452225302004442353100001---2357
Q gi|255764482|r   14 HLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---GLKN   88 (225)
Q Consensus        14 ~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---~~~~   88 (225)
                      .++=-||.+| ++..+|+++  .+.+|+++..+++.++.....        ...++..+..|+.+........   ....
T Consensus         4 v~lITGaSsG-iG~ala~~l~~~G~~Vi~t~R~~~~l~~l~~~--------~~~~~~~~~~Dvt~~~~v~~~v~~~~~~~   74 (276)
T PRK06482          4 TWFITGASSG-FGRGLTERLLARGDRVAATVRRPDALDDLKAR--------YGERLWVLQLDVTDTAAVRAVVDRAFAEL   74 (276)
T ss_pred             EEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHH--------CCCCEEEEEEECCCHHHHHHHHHHHHHHC
T ss_conf             8999158659-99999999998899899997898999999986--------69957999953799999999999999980


Q ss_pred             CCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCH--HHHHHHHHHHCCC--CCEEEEE
Q ss_conf             652057722654464465478854556520566898--9999999986246--9837870
Q gi|255764482|r   89 NFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSF--EKWIRTACAIMRS--SGQLSLI  144 (225)
Q Consensus        89 ~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~--~~~~~~a~~lLkp--gG~~~~i  144 (225)
                      +..|.++.|--|...+.....+..... +....+.+  ..+++.+...++.  +|++..+
T Consensus        75 G~iDvLVNNAG~~~~g~~ee~~~~~~~-~~~~vN~~g~~~~~ra~lP~mr~~~~G~Iini  133 (276)
T PRK06482         75 GRIDVVVSNAGYGLFGAAEELSDAQIR-RQIDTNLTGSIQVIRAALPHLRRQGGGRIVQV  133 (276)
T ss_pred             CCCCEEEECCCCCCCCCHHHCCHHHHH-HHHHHHHHHHHHHHHHHCHHHHHCCCCEEEEE
T ss_conf             998788746877788876767757799-99887417799999985735575589779995


No 418
>PRK06841 short chain dehydrogenase; Provisional
Probab=56.18  E-value=14  Score=16.75  Aligned_cols=124  Identities=14%  Similarity=0.029  Sum_probs=65.6

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---C
Q ss_conf             55789995878438999999867--998899998898999988999998066452225302004442353100001---2
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---G   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---~   85 (225)
                      +|..+|=-|.+.| ++..+|+++  .+++|+.+|++++..+.+.+   ..     ..+...++.|+.+........   .
T Consensus        14 ~gKvalVTGas~G-IG~aiA~~la~~Ga~V~i~d~~~~~~~~~~~---~~-----~~~~~~~~~Dvt~~~~v~~~v~~~~   84 (255)
T PRK06841         14 SGKVAVVTGGASG-IGHAIAELFAAKGARVALLDRSEDVAEVAAQ---LL-----GGNAKGLVCDVSDSQSVEAAVAAAI   84 (255)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHH---HC-----CCCEEEEEEECCCHHHHHHHHHHHH
T ss_conf             9999999796778-9999999999879999999698789999998---45-----9966999984699999999999999


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCH--HHHHHHHHHHCC--CCCEEEEE
Q ss_conf             357652057722654464465478854556520566898--999999998624--69837870
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSF--EKWIRTACAIMR--SSGQLSLI  144 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~--~~~~~~a~~lLk--pgG~~~~i  144 (225)
                      ..-+..|..+.|.-..........+.. .+.+....+..  ....+.+.+.++  .+|++..+
T Consensus        85 ~~~g~iDiLVNNAGi~~~~~~~~~~~e-~w~~~~~vNl~g~f~~~~~~~~~m~~~~~G~IIni  146 (255)
T PRK06841         85 SAFGRIDILVNSAGVALLAPAEDVSEA-DWDKTIDINLKGSFLMAQAVGRHMIAAGGGKIVNL  146 (255)
T ss_pred             HHHCCCCEEEECCCCCCCCCHHHCCHH-HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             981998799989978999980449999-99999998559999999999999998299659999


No 419
>PRK07775 short chain dehydrogenase; Provisional
Probab=55.94  E-value=15  Score=16.73  Aligned_cols=131  Identities=14%  Similarity=0.038  Sum_probs=71.4

Q ss_pred             CCCCCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCC
Q ss_conf             99855789995878438999999867--9988999988989999889999980664522253020044423531000012
Q gi|255764482|r    8 NATGSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAG   85 (225)
Q Consensus         8 ~~~~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~   85 (225)
                      +...+..+|=-|+++|. +..+|+++  .+++|+....+.+.++.....++..+     ..+..+..|+.+.........
T Consensus         6 p~~~~KtAlVTGAssGI-G~aiA~~la~~G~~V~l~~R~~e~l~~~~~~l~~~g-----~~~~~~~~Dvtd~~~v~~~v~   79 (275)
T PRK07775          6 PHPARRPAIVAGASSGI-GAATAIELAAHGFPVALGARRVEKCEEIVDKIRADG-----GEAVAFPLDVTDPDSVKSFVA   79 (275)
T ss_pred             CCCCCCEEEEECCCHHH-HHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC-----CCEEEEEECCCCHHHHHHHHH
T ss_conf             89999979994623599-999999999879989999898999999999999649-----948999912899999999999


Q ss_pred             ---CCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCC--HHHHHHHHHHHC--CCCCEEEEEC
Q ss_conf             ---35765205772265446446547885455652056689--899999999862--4698378702
Q gi|255764482|r   86 ---LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDS--FEKWIRTACAIM--RSSGQLSLIA  145 (225)
Q Consensus        86 ---~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~--~~~~~~~a~~lL--kpgG~~~~i~  145 (225)
                         ..-+..|.++.|.-....+.....+...... ....+.  ...+.+.+...+  +..|++..+-
T Consensus        80 ~~~~~~G~iDiLVnNAG~~~~~~~~e~~~e~~~~-~~~vNl~g~~~~~~a~lP~M~~~~~G~IV~is  145 (275)
T PRK07775         80 QATEALGDIEVLVSGAGDTYFGKLHEISTEQFES-QVQIHLVGANRLATAVLPGMVERRRGDLIFVG  145 (275)
T ss_pred             HHHHHHCCCCEEEECCCCCCCCCCCCCCHHHHHH-HHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEE
T ss_conf             9999859965999767568888601099999999-99885279999999999999975995799984


No 420
>PRK06128 oxidoreductase; Provisional
Probab=55.78  E-value=15  Score=16.71  Aligned_cols=127  Identities=12%  Similarity=-0.018  Sum_probs=66.7

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHH--HHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC--
Q ss_conf             55789995878438999999867--99889999889899--9988999998066452225302004442353100001--
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLM--AHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA--   84 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~--~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~--   84 (225)
                      +|.++|=-|.++|. +.++|.++  .+++|.-.+++.+.  .+...+-++..+     .+...+.+|+.+......+.  
T Consensus        54 ~GKvAlVTGgssGI-G~AiA~~lA~eGA~Vvi~~~~~~~~~a~~~~~~i~~~G-----~~a~~v~~Dvsd~~~~~~~v~~  127 (300)
T PRK06128         54 QGRKALITGADSGI-GRATAIAFAREGADIVLNYLPEEEQDAAEVVQLIQAEG-----RKAVAVPGDLKDEAFCRQLVER  127 (300)
T ss_pred             CCCEEEEECCCCHH-HHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHCC-----CEEEEEECCCCCHHHHHHHHHH
T ss_conf             99958991736699-99999999986999999429955678999999999659-----8189997478999999999999


Q ss_pred             -CCCCCCCCEEEECCCCCCC-CCCCCCCHHHHHHHCCCCCC--HHHHHHHHHHHCCCCCEEEEE
Q ss_conf             -2357652057722654464-46547885455652056689--899999999862469837870
Q gi|255764482|r   85 -GLKNNFYDHVIMNPPFNER-IGTMTPDKIKEEAHVMLEDS--FEKWIRTACAIMRSSGQLSLI  144 (225)
Q Consensus        85 -~~~~~~fDlii~nPPy~~~-~~~~~~~~~~~~a~~~~~~~--~~~~~~~a~~lLkpgG~~~~i  144 (225)
                       ...-+..|..+.|--.... ......+... +.+....+.  .....+.+..++++||.+..+
T Consensus       128 ~~~~~G~iDiLVNNAG~~~~~~~~~~~~~e~-w~~~~~vNl~g~f~~~~aa~p~m~~gGsIIni  190 (300)
T PRK06128        128 AVKELGGLDILVNIAGKQTARKDIADITTEQ-FDATFKTNVYAMFWLCKAAIPHLPPGASIINT  190 (300)
T ss_pred             HHHHHCCCCEEEECCCCCCCCCCHHHCCHHH-HHHHHHHCCHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             9998099998998999977899917799999-99998661158999999999987538714787


No 421
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional
Probab=55.46  E-value=15  Score=16.68  Aligned_cols=128  Identities=13%  Similarity=0.108  Sum_probs=63.0

Q ss_pred             CCCEEEEECCC-HHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---
Q ss_conf             55789995878-438999999867--998899998898999988999998066452225302004442353100001---
Q gi|255764482|r   11 GSFHLADLGAG-AGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---   84 (225)
Q Consensus        11 ~~~~VLDlGcG-~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---   84 (225)
                      +|.++|=.|++ +..++..+|+++  .+++|.-.+.++...+.+++-....+      ...+.+.|+.+......+.   
T Consensus         4 ~GK~alITGaag~~GIG~aiA~~la~~GA~V~i~~~~~~~~~~~~~l~~~~g------~~~~~~~Dvs~~~~v~~~~~~i   77 (274)
T PRK08415          4 KGKKGLIVGVANNKSIAYGIAKACFEQGAELAFTYLNDALKKRVEPIAQELG------SPYVYELDVSKEEHFKSLAESI   77 (274)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC------CCEEEEECCCCHHHHHHHHHHH
T ss_conf             9987999899998379999999999869999998488789999999998629------9769990289999999999999


Q ss_pred             CCCCCCCCEEEECCCCCCCCCCCC--CCHHHHHHHCCCC---CCHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             235765205772265446446547--8854556520566---89899999999862469837870
Q gi|255764482|r   85 GLKNNFYDHVIMNPPFNERIGTMT--PDKIKEEAHVMLE---DSFEKWIRTACAIMRSSGQLSLI  144 (225)
Q Consensus        85 ~~~~~~fDlii~nPPy~~~~~~~~--~~~~~~~a~~~~~---~~~~~~~~~a~~lLkpgG~~~~i  144 (225)
                      ....+..|.++.|--+.+......  .+...........   .....+.+.+..+++.+|....+
T Consensus        78 ~~~~G~iDilVnnag~~~~~~~~~~~~d~~~~~~~~~~~~n~~~~~~~~~~~~~~m~~~GsIi~i  142 (274)
T PRK08415         78 KKDLGEIDFIVHSVAFAPKEALEGSFLETSKEAFDIAMEISVYSLIELTRALLPLLNDGGSVLTL  142 (274)
T ss_pred             HHHHCCCCEEEECCCCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             99858988885335557643346873338999999999999999999999999874307987642


No 422
>PRK12828 short chain dehydrogenase; Provisional
Probab=54.53  E-value=15  Score=16.60  Aligned_cols=125  Identities=14%  Similarity=0.014  Sum_probs=66.9

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC---CC
Q ss_conf             55789995878438999999867--99889999889899998899999806645222530200444235310000---12
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL---AG   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~---~~   85 (225)
                      +|..+|=-|++.| ++..+|+++  .+++|.-++.+.+.++.+.+++..       ....+...|+.+.......   ..
T Consensus         6 ~gKvalITGas~G-IG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~-------~~~~~~~~Dvt~~~~~~~~v~~~~   77 (239)
T PRK12828          6 QGKVVAITGGFGG-LGRATAAWLAARGARVALIGRGAAPLSQTLPGVPA-------DALRIGGIDLVDPQAARRAVDEVN   77 (239)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHC-------CCCEEEEECCCCHHHHHHHHHHHH
T ss_conf             9898999472548-99999999998799899997987789999987517-------885699960799999999999999


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCC--HHHHHHHHHHHCC--CCCEEEEE
Q ss_conf             35765205772265446446547885455652056689--8999999998624--69837870
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDS--FEKWIRTACAIMR--SSGQLSLI  144 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~--~~~~~~~a~~lLk--pgG~~~~i  144 (225)
                      ..-+..|.++.|--..........+.. .+.+....+.  ...+.+.+..+++  .+|++..+
T Consensus        78 ~~~G~iDilVnNAG~~~~~~~~~~~~e-~w~~~~~vNl~g~~~~~~~~~p~m~~~~~G~IIni  139 (239)
T PRK12828         78 RQFGRLDALVNIAGAFVWGTIADGDAD-TWDRMYGVNVKTTLNASKAALPALTASGGGRIVNI  139 (239)
T ss_pred             HHCCCCCEEEECCCCCCCCCHHHCCHH-HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             983999799989778999990449999-99999999969999999999999987699869999


No 423
>pfam04072 LCM Leucine carboxyl methyltransferase. Family of leucine carboxyl methyltransferases EC:2.1.1.-. This family may need divides a the full alignment contains a significantly shorter mouse sequence.
Probab=54.09  E-value=16  Score=16.55  Aligned_cols=70  Identities=14%  Similarity=0.172  Sum_probs=27.3

Q ss_pred             HHCCCCCCC-EEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCC
Q ss_conf             438998557-899958784389999998679988999988989999889999980664522253020044423
Q gi|255764482|r    5 SLVNATGSF-HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL   76 (225)
Q Consensus         5 ~~~~~~~~~-~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~   76 (225)
                      +++...++. .|+-+|||-=.-..-+....++.+++-+|.- ++++.-++-++..+. ....+.+++..|+.+
T Consensus        63 ~fl~~~~~~~qVV~LGaGlDTr~~Rl~~~~~~~~~~evD~p-~v~~~k~~~l~~~~~-~~~~~~~~v~~Dl~~  133 (175)
T pfam04072        63 AFLAAHPGARQVVILGAGLDTRAYRLDWPAGGVRWFEVDLP-EVIEFKRRLLPEAGA-RPPARRRYVAVDLRD  133 (175)
T ss_pred             HHHHHCCCCCEEEEECCCCCCHHHHCCCCCCCCEEEEECCH-HHHHHHHHHHHHCCC-CCCCCEEEECCCCCC
T ss_conf             99985969878999696433547664698899459994778-899999999876368-898675884688764


No 424
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated
Probab=53.79  E-value=16  Score=16.53  Aligned_cols=128  Identities=16%  Similarity=0.060  Sum_probs=68.6

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHH-HHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---
Q ss_conf             55789995878438999999867--99889999889899-9988999998066452225302004442353100001---
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLM-AHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---   84 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~-~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---   84 (225)
                      +|+.+|=-|++.| ++..+|+++  .+++|+..+.+.+. .+.+.+.....     ..++...+.|+.+......+.   
T Consensus         4 ~gK~~lITGgs~G-IG~aia~~la~~G~~Vii~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~Dlt~~~~v~~~~~~~   77 (248)
T PRK05557          4 EGKVALVTGASRG-IGRAIAERLAAQGANVVLNYASSEAGAEALVAEIGAL-----GGKALAVQGDVADAESIERAVDEA   77 (248)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHC-----CCCEEEEEECCCCHHHHHHHHHHH
T ss_conf             9988999489768-9999999999879989999698565899999999963-----995899990389999999999999


Q ss_pred             CCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCC-CCCCHHHHHHHHHHHCCC--CCEEEEE
Q ss_conf             23576520577226544644654788545565205-668989999999986246--9837870
Q gi|255764482|r   85 GLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVM-LEDSFEKWIRTACAIMRS--SGQLSLI  144 (225)
Q Consensus        85 ~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~-~~~~~~~~~~~a~~lLkp--gG~~~~i  144 (225)
                      ....+..|.++.|......+.....+......... .......+++.+...++.  +|++..+
T Consensus        78 ~~~~g~iD~linnAg~~~~~~~~~~~~~~~~~~~~vN~~~~~~~~~~~~p~m~~~~~G~IVni  140 (248)
T PRK05557         78 KAEFGGVDILVNNAGITRDNLLMRMKEEDWDRVIDTNLTGVFNLTKAVARPMMKQRSGRIINI  140 (248)
T ss_pred             HHHCCCCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             998299719998997799999155999999999987830499999999999997069718998


No 425
>PRK12829 short chain dehydrogenase; Provisional
Probab=53.53  E-value=16  Score=16.50  Aligned_cols=88  Identities=15%  Similarity=0.166  Sum_probs=55.9

Q ss_pred             HCCCCCCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC
Q ss_conf             3899855789995878438999999867--99889999889899998899999806645222530200444235310000
Q gi|255764482|r    6 LVNATGSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL   83 (225)
Q Consensus         6 ~~~~~~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~   83 (225)
                      .+.--+|..+|=-|.+.| ++..+|+++  .+++|+..|.+++.++...+.+.       ......+++|+.+.......
T Consensus         5 ~m~~L~GKvalVTGgs~G-IG~aiA~~la~~Ga~V~i~~r~~~~~~~~~~~~~-------~~~~~~~~~Dvt~~~~v~~~   76 (264)
T PRK12829          5 LLKPLDGLRVLVTGGASG-IGRAIAEAFAEAGARVHVCDVSEAALAATAARLP-------GAKVTATVADVADPAQVERV   76 (264)
T ss_pred             CCCCCCCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCC-------CCCEEEEEEECCCHHHHHHH
T ss_conf             576899997999473768-9999999999879989999799899999999747-------99759999628999999999


Q ss_pred             C---CCCCCCCCEEEECCCCC
Q ss_conf             1---23576520577226544
Q gi|255764482|r   84 A---GLKNNFYDHVIMNPPFN  101 (225)
Q Consensus        84 ~---~~~~~~fDlii~nPPy~  101 (225)
                      .   ...-+..|..+.|--..
T Consensus        77 v~~~~~~~G~iDiLVNNAGi~   97 (264)
T PRK12829         77 FDTAVERFGGLDVLVNNAGIA   97 (264)
T ss_pred             HHHHHHHCCCCCEEEECCCCC
T ss_conf             999999739998999899899


No 426
>PRK06180 short chain dehydrogenase; Provisional
Probab=53.48  E-value=16  Score=16.50  Aligned_cols=124  Identities=16%  Similarity=0.088  Sum_probs=66.0

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---C
Q ss_conf             55789995878438999999867--998899998898999988999998066452225302004442353100001---2
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---G   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---~   85 (225)
                      ....||=-||++|. +..+|+++  .+++|+++..+++.++....   .     ...+...+..|+.+........   .
T Consensus         3 ~~KvvlITGassGI-G~aiA~~l~~~G~~Vi~~~R~~~~l~~l~~---~-----~~~~~~~~~~Dvtd~~~v~~~v~~~~   73 (277)
T PRK06180          3 SMKTWLITGVSSGF-GRALAQAALAAGHRVVGTVRSAAARRDFEA---L-----HPGRALARVLDVTDFDAIDGVVADAE   73 (277)
T ss_pred             CCCEEEECCCCCHH-HHHHHHHHHHCCCEEEEEECCHHHHHHHHH---H-----CCCCEEEEEEECCCHHHHHHHHHHHH
T ss_conf             99889991787399-999999999879999999899999999998---6-----79957999983799999999999999


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCH--HHHHHHHHHHCCC--CCEEEEE
Q ss_conf             357652057722654464465478854556520566898--9999999986246--9837870
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSF--EKWIRTACAIMRS--SGQLSLI  144 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~--~~~~~~a~~lLkp--gG~~~~i  144 (225)
                      ...+..|.++.|--+...+.....+.... .+....+.+  ....+.+...++.  +|++..+
T Consensus        74 ~~~G~iDvLVNNAG~~~~~~~e~~~~~~~-~~~~~vN~~g~~~~~~a~lp~m~~~~~G~Ivni  135 (277)
T PRK06180         74 ATVGPIDVLVNNAGYGHEGAIEESPLAEM-RRQFEVNVFGAVAMIKAVLPGMRARRRGHIVNI  135 (277)
T ss_pred             HHHCCCCEEEECCCCCCCCCHHHCCHHHH-HHHHHHHHHHHHHHHHCCCHHHHHCCCCEEEEE
T ss_conf             98199869998997788886333999999-999988537765442004888896589657753


No 427
>PRK06198 short chain dehydrogenase; Provisional
Probab=53.26  E-value=16  Score=16.48  Aligned_cols=127  Identities=16%  Similarity=0.152  Sum_probs=72.5

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCE-EEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC---C
Q ss_conf             55789995878438999999867--9988-9999889899998899999806645222530200444235310000---1
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQ-ILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL---A   84 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~-v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~---~   84 (225)
                      +|.++|=-|++.| ++..+|.++  .+++ |+..+.+++.++...+.++..+     .++.++++|+.+.......   .
T Consensus         5 ~gK~alVTGas~G-IG~aiA~~la~~Ga~vv~~~~~~~~~~~~~~~~~~~~g-----~~~~~~~~Dv~~~~~v~~~~~~~   78 (268)
T PRK06198          5 DGKIALVTGGTQG-LGAAIARLFAERGAAGLVICGRSAEKGEAKAAELEALG-----AKAVFVQADLAKVEDCRAVVAAA   78 (268)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHCC-----CCEEEEECCCCCHHHHHHHHHHH
T ss_conf             9988999585778-99999999998799389996298889999999999549-----96799982689999999999999


Q ss_pred             CCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCH--HHHHHHHHHHC-CCC--CEEEEE
Q ss_conf             2357652057722654464465478854556520566898--99999999862-469--837870
Q gi|255764482|r   85 GLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSF--EKWIRTACAIM-RSS--GQLSLI  144 (225)
Q Consensus        85 ~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~--~~~~~~a~~lL-kpg--G~~~~i  144 (225)
                      ....++.|..+-|.-..........+.... .+....+..  .-+++.+.+.+ +.+  |++..+
T Consensus        79 ~~~fG~iDiLVNnAG~~~~~~~~~~~~e~w-~~~~~vNl~~~~~~~~~~~~~m~~~~~~G~IVni  142 (268)
T PRK06198         79 DEAFGRLDALVNAAGLTDRGTILDTSPELF-DRMFAVNVRAPFFLMQEAIKLMRRRRAEGTIVNI  142 (268)
T ss_pred             HHHHCCCCEEEECCCCCCCCCHHHCCHHHH-HHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEE
T ss_conf             998399989998997899998265999999-9999987269999999999999975999279999


No 428
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional
Probab=52.72  E-value=17  Score=16.43  Aligned_cols=129  Identities=18%  Similarity=0.131  Sum_probs=62.3

Q ss_pred             CCCCEEEEECCCHH-HHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC--
Q ss_conf             85578999587843-8999999867--998899998898999988999998066452225302004442353100001--
Q gi|255764482|r   10 TGSFHLADLGAGAG-AAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA--   84 (225)
Q Consensus        10 ~~~~~VLDlGcG~G-~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~--   84 (225)
                      -+|.++|=-|.+.| .++.++|+.+  .+++|+-+..++...+.++.-.+..+.     + .+.+.|+.+......+.  
T Consensus         6 L~GK~alVTGaa~g~Gig~aia~~~~~~Ga~V~i~~~~~~~~~~~~~l~~~~g~-----~-~~~~~Dvt~~~~v~~~~~~   79 (260)
T PRK06603          6 LQGKKGLITGIANNMSISWAIAQLAKKHGAELWFTYQSEVLEKRVKPLAEEIGC-----N-FVSELDVTNPKSISNLFDD   79 (260)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHCCC-----C-EEEECCCCCHHHHHHHHHH
T ss_conf             899989998999966899999999998799999966867999999999984383-----7-6986579999999999999


Q ss_pred             -CCCCCCCCEEEECCCCCCCCCCCC--CCHHHHHH-HCCCC--CCHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             -235765205772265446446547--88545565-20566--89899999999862469837870
Q gi|255764482|r   85 -GLKNNFYDHVIMNPPFNERIGTMT--PDKIKEEA-HVMLE--DSFEKWIRTACAIMRSSGQLSLI  144 (225)
Q Consensus        85 -~~~~~~fDlii~nPPy~~~~~~~~--~~~~~~~a-~~~~~--~~~~~~~~~a~~lLkpgG~~~~i  144 (225)
                       ....++.|..+.|..+........  .+...... +....  .......+.+..+++.+|.+..+
T Consensus        80 ~~~~~G~iDiLVnnag~~~~~~~~~~~~d~~~~~~~~~~~~n~~~~~~~~~~a~~~m~~~GsIi~i  145 (260)
T PRK06603         80 IKEKWGSFDFLLHGMAFADKNELKGRYVDTSLENFHNSLHISCYSLLELSRSAEALMHDGGSIVTL  145 (260)
T ss_pred             HHHHHCCCCEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCC
T ss_conf             999869977899644237776567751029899999999999899999999977874179730234


No 429
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated
Probab=52.71  E-value=17  Score=16.42  Aligned_cols=129  Identities=12%  Similarity=0.069  Sum_probs=59.0

Q ss_pred             CCCEEEEECCC-HHHHHHHHHHHC--CCCEEEEEECCHHHH--HHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC--
Q ss_conf             55789995878-438999999867--998899998898999--98899999806645222530200444235310000--
Q gi|255764482|r   11 GSFHLADLGAG-AGAAGLAVASRL--HEAQILLAERSPLMA--HYARKTLALPANAQISKRISLIEVDVTLVGENRNL--   83 (225)
Q Consensus        11 ~~~~VLDlGcG-~G~~~l~la~r~--~~~~v~gvD~~~~~~--~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~--   83 (225)
                      +|.++|=-|++ +..+...+|+++  .+++|.-.+++.+.-  +...+.+...     .....+++.|+.+......+  
T Consensus         6 ~GK~alVTGaag~~GiG~aia~~la~~GA~V~i~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~Dvs~~~~v~~~~~   80 (259)
T PRK07370          6 TGKKALVTGIANNRSIAWGIAQQLHAAGAELGITYLPDEKGRFEKKVRELTEP-----LNPSLFLPCNVQDDAQIEEVFE   80 (259)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHC-----CCCEEEEECCCCCHHHHHHHHH
T ss_conf             99989997989985799999999998699999994787013589999999841-----2864899912899999999999


Q ss_pred             -CCCCCCCCCEEEECCCCCCCCCCCCC--CH-HHHHHHCCCCC--CHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             -12357652057722654464465478--85-45565205668--9899999999862469837870
Q gi|255764482|r   84 -AGLKNNFYDHVIMNPPFNERIGTMTP--DK-IKEEAHVMLED--SFEKWIRTACAIMRSSGQLSLI  144 (225)
Q Consensus        84 -~~~~~~~fDlii~nPPy~~~~~~~~~--~~-~~~~a~~~~~~--~~~~~~~~a~~lLkpgG~~~~i  144 (225)
                       .....+..|.++-|.-+........+  +. .....+....+  ......+.+..+++.+|.+..+
T Consensus        81 ~~~~~~G~iDilVnna~~~~~~~~~~~~~~~~~~~~~~~~~vn~~~~~~~~~~~~~~~~~~g~Ii~i  147 (259)
T PRK07370         81 TIKQKWGQLDILVHCLAFAGKEELSGDFSATSREGFARALEISAYSLAPLCRAAKPLMSEGGSIVTL  147 (259)
T ss_pred             HHHHHHCCCCEEEEEECCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             9999858987798630114643367992559999999999998799999999998860458853127


No 430
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional
Probab=52.17  E-value=17  Score=16.37  Aligned_cols=128  Identities=16%  Similarity=0.091  Sum_probs=62.9

Q ss_pred             CCCEEEEECCCHH-HHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC---C
Q ss_conf             5578999587843-8999999867--99889999889899998899999806645222530200444235310000---1
Q gi|255764482|r   11 GSFHLADLGAGAG-AAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL---A   84 (225)
Q Consensus        11 ~~~~VLDlGcG~G-~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~---~   84 (225)
                      +|.++|=-|+++| .++..+|+.+  .+++|+-.+.++.....+++-.+..+      ...+...|+.+......+   .
T Consensus         5 ~GK~alVTGaa~g~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~------~~~~~~~Dvt~~~~v~~~~~~~   78 (254)
T PRK07533          5 AGKRGLVVGIANEQSIAWGCARAFRALGAELAVTYLNDKARPYVEPLAEELD------APLLMPLDVREPGQLEAVFARI   78 (254)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC------CEEEEEECCCCHHHHHHHHHHH
T ss_conf             9998999688898089999999999879999998288778999999997459------8189991699999999999999


Q ss_pred             CCCCCCCCEEEECCCCCCCCCCC--CCCHH-HHHHHCCCCCC--HHHHHHHHHHHCCCCCEEEEE
Q ss_conf             23576520577226544644654--78854-55652056689--899999999862469837870
Q gi|255764482|r   85 GLKNNFYDHVIMNPPFNERIGTM--TPDKI-KEEAHVMLEDS--FEKWIRTACAIMRSSGQLSLI  144 (225)
Q Consensus        85 ~~~~~~fDlii~nPPy~~~~~~~--~~~~~-~~~a~~~~~~~--~~~~~~~a~~lLkpgG~~~~i  144 (225)
                      ....+..|.++.|--+.+.....  ..+.. ....+....+.  +....+.+..+++.||.+..+
T Consensus        79 ~~~~G~iDilVnna~~~~~~~~~~~~~d~~~~~~~~~~~vn~~~~~~~~~~~~~~m~~gG~iv~i  143 (254)
T PRK07533         79 AEEWGRLDFVLHSIAFAPKEDLHGRVVDCSREGFALAMDVSCHSFIRMARLAEPLMTNGGSLLTM  143 (254)
T ss_pred             HHHHCCCCEEEECCCCCCCHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEE
T ss_conf             99849977897422126601114760149999999999998599999999988886517831567


No 431
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=51.65  E-value=17  Score=16.33  Aligned_cols=90  Identities=19%  Similarity=0.149  Sum_probs=50.4

Q ss_pred             HHHCCCCCCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCC
Q ss_conf             243899855789995878438999999867--998899998898999988999998066452225302004442353100
Q gi|255764482|r    4 ASLVNATGSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENR   81 (225)
Q Consensus         4 a~~~~~~~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~   81 (225)
                      +++-++-.|+.+|=-|.+.|+ ..++|+.+  .+++|+.+|++...-+.++ -....+       ...+..|+.......
T Consensus       199 ~~~~~pL~GKVALVTGAArGI-G~AIA~~LAreGA~VVi~Di~~a~~~l~~-~a~elg-------g~al~~DVt~~~a~~  269 (447)
T PRK08261        199 ADWDRPLAGKVALVTGAARGI-GAAIAEVLARDGAHVVCLDVPQAGDDLAA-VAARLG-------GTALALDITAPDAPA  269 (447)
T ss_pred             CCCCCCCCCCEEEEECCCCHH-HHHHHHHHHHCCCEEEEEECCHHHHHHHH-HHHHCC-------CEEEEECCCCHHHHH
T ss_conf             887888999989991725789-99999999986999999827114899999-998709-------808995368999999


Q ss_pred             CCC---CCCCCCCCEEEECCCCCC
Q ss_conf             001---235765205772265446
Q gi|255764482|r   82 NLA---GLKNNFYDHVIMNPPFNE  102 (225)
Q Consensus        82 ~~~---~~~~~~fDlii~nPPy~~  102 (225)
                      .+.   ....+..|.++.|.-...
T Consensus       270 ~lv~~~~~~~G~lDILVnNAGi~~  293 (447)
T PRK08261        270 KIAEHLAERHGGLDIVVHNAGITR  293 (447)
T ss_pred             HHHHHHHHHCCCCCEEEECCCCCC
T ss_conf             999999996499989998997899


No 432
>PRK07985 oxidoreductase; Provisional
Probab=51.16  E-value=18  Score=16.28  Aligned_cols=128  Identities=11%  Similarity=0.042  Sum_probs=67.0

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEE--CCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCC-
Q ss_conf             55789995878438999999867--998899998--8989999889999980664522253020044423531000012-
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAE--RSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAG-   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD--~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~-   85 (225)
                      +|.++|=-|.+.| +...+|+++  .+++|.-.+  .+....+.+.+.++..     ..+...+.+|+.+......+.. 
T Consensus        48 ~gKvalVTGas~G-IG~aiA~~lA~~GA~Vvi~~~~~~~~~a~~~~~~~~~~-----g~~~~~~~~Dvs~~~~v~~lv~~  121 (294)
T PRK07985         48 KDRKALVTGGDSG-IGRAAAIAYAREGADVAISYLPVEEEDAQDVKKIIEEC-----GRKAVLLPGDLSDEKFARSLVHE  121 (294)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHC-----CCCEEEEECCCCCHHHHHHHHHH
T ss_conf             9997999172669-99999999998799999942996667899999999972-----99589997678999999999999


Q ss_pred             --CCCCCCCEEEECCCCCCC-CCCCC--CCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             --357652057722654464-46547--8854556520566898999999998624698378702
Q gi|255764482|r   86 --LKNNFYDHVIMNPPFNER-IGTMT--PDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIA  145 (225)
Q Consensus        86 --~~~~~fDlii~nPPy~~~-~~~~~--~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~  145 (225)
                        ...+..|..+.|.-.... .....  .+........... ...-..+.+..+++.+|++..+-
T Consensus       122 ~~~~fG~iDiLVnnAG~~~~~~~~~~~s~e~~~~~~~vNl~-g~~~~~qaa~p~m~~gGsIInis  185 (294)
T PRK07985        122 AHKALGGLDIMALVAGKQVAIPDIADLTSEQFQKTFAINVF-ALFWLTQEAIPLLPKGASIITTS  185 (294)
T ss_pred             HHHHHCCCCEEEEECCCCCCCCCHHHCCHHHHHHHHHHHCH-HHHHHHHHHHHHHCCCCEEEEEC
T ss_conf             99985998889980666668888365899999999998653-47888887677642487799966


No 433
>PRK07454 short chain dehydrogenase; Provisional
Probab=49.97  E-value=18  Score=16.17  Aligned_cols=128  Identities=13%  Similarity=-0.019  Sum_probs=70.8

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC---C
Q ss_conf             855789995878438999999867--99889999889899998899999806645222530200444235310000---1
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL---A   84 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~---~   84 (225)
                      .+-..+|=-|++.|. +..+|.++  .+++|+.++.+++.++...+.+...+     .++.....|+.+.......   .
T Consensus         4 ~~mKvalITGas~GI-G~a~A~~la~~G~~V~l~~R~~~~l~~~~~e~~~~g-----~~~~~~~~Dvt~~~~v~~~~~~~   77 (241)
T PRK07454          4 NSMPTALITGASRGI-GKATALAFAKAGWDLALVARSQDALEALAEELRSTG-----VKVAAYSIDLSNPEAIAPGIAEL   77 (241)
T ss_pred             CCCCEEEECCCCCHH-HHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC-----CCEEEEEEECCCHHHHHHHHHHH
T ss_conf             999889991758789-999999999879989999899999999999999659-----92899995189999999999999


Q ss_pred             CCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCH--HHHHHHHHHHCC--CCCEEEEE
Q ss_conf             2357652057722654464465478854556520566898--999999998624--69837870
Q gi|255764482|r   85 GLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSF--EKWIRTACAIMR--SSGQLSLI  144 (225)
Q Consensus        85 ~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~--~~~~~~a~~lLk--pgG~~~~i  144 (225)
                      ....+..|..+.|.-....+.....+. ..+.+....+..  ....+.+...++  .+|++..|
T Consensus        78 ~~~~G~iDiLVnNAG~~~~~~~~~~~~-e~~~~~~~vNl~g~~~~~~~~lp~M~~~~~G~Iini  140 (241)
T PRK07454         78 LEQFGCPSVLINNAGAAYTGPLLEMPL-SDWQWVIQLNLTSVFQCCSAVLPGMRARGGGLIINV  140 (241)
T ss_pred             HHHCCCCCEEEECCCCCCCCCHHHCCH-HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             997599889998898899999266999-999999999869999999999999997399899998


No 434
>PRK10538 3-hydroxy acid dehydrogenase; Provisional
Probab=49.69  E-value=19  Score=16.15  Aligned_cols=78  Identities=15%  Similarity=0.198  Sum_probs=49.4

Q ss_pred             EEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---CCCCC
Q ss_conf             9995878438999999867--998899998898999988999998066452225302004442353100001---23576
Q gi|255764482|r   15 LADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---GLKNN   89 (225)
Q Consensus        15 VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---~~~~~   89 (225)
                      ||=-|+++| ++..+|+++  .+++|+.++.+++.++.+.+.+        ..++.....|+.+......+.   ....+
T Consensus         3 vlVTGassG-IG~a~A~~la~~Ga~Vv~~~r~~~~l~~l~~~l--------g~~~~~~~~Dvsd~~~v~~~~~~~~~~~g   73 (248)
T PRK10538          3 VLVTGATAG-FGECITRRFIQNGHKVIATGRRQERLQELKDEL--------GDNLYIAQLDVRNRAAIEEMLASLPAEWR   73 (248)
T ss_pred             EEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHH--------CCCEEEEEEECCCHHHHHHHHHHHHHHCC
T ss_conf             999888669-999999999987999999989999999999984--------88679999734888999999999999709


Q ss_pred             CCCEEEECCCCC
Q ss_conf             520577226544
Q gi|255764482|r   90 FYDHVIMNPPFN  101 (225)
Q Consensus        90 ~fDlii~nPPy~  101 (225)
                      ..|.++.|--..
T Consensus        74 ~iDiLVnNAG~~   85 (248)
T PRK10538         74 NIDILVNNAGLA   85 (248)
T ss_pred             CCCEEEECCCCC
T ss_conf             975999778546


No 435
>PRK12770 putative glutamate synthase subunit beta; Provisional
Probab=48.90  E-value=19  Score=16.07  Aligned_cols=40  Identities=13%  Similarity=0.043  Sum_probs=28.4

Q ss_pred             HHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECC
Q ss_conf             4389985578999587843899999986799889999889
Q gi|255764482|r    5 SLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERS   44 (225)
Q Consensus         5 ~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~   44 (225)
                      ..-++..|.+|+=+|+|.+.++-++.....+.++.=+|..
T Consensus        10 ~~~~p~~gkkV~IIGaGPaGlsAA~~aa~~G~~v~viEk~   49 (350)
T PRK12770         10 KEKPPPTGKKVAIIGAGPAGLAAAGYLACLGHEVHVYDKL   49 (350)
T ss_pred             CCCCCCCCCEEEEECCCHHHHHHHHHHHHCCCCEEEEEEC
T ss_conf             7899989798999995588999999999789985999536


No 436
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional
Probab=47.88  E-value=20  Score=15.98  Aligned_cols=87  Identities=11%  Similarity=0.005  Sum_probs=53.6

Q ss_pred             CEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---CCC
Q ss_conf             789995878438999999867--998899998898999988999998066452225302004442353100001---235
Q gi|255764482|r   13 FHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---GLK   87 (225)
Q Consensus        13 ~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---~~~   87 (225)
                      ..+|=-|++.| ++..+|+++  .+++|+.++.+++.++.+.+.+....   ...++..+++|+.+........   ...
T Consensus         3 KvalITG~s~G-IG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~l~~~~---~~~~~~~~~~Dv~~~~~v~~~~~~~~~~   78 (259)
T PRK12384          3 KVAVVIGGGQT-LGAFLCHGLAEEGYRVAVADINSEKAANVAQEINAEY---GEGMAYGFGADATSEQSVLALSRGVDEI   78 (259)
T ss_pred             CEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHC---CCCEEEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             78999468868-9999999999879999999798899999999998624---8860899983279999999999999998


Q ss_pred             CCCCCEEEECCCCCCC
Q ss_conf             7652057722654464
Q gi|255764482|r   88 NNFYDHVIMNPPFNER  103 (225)
Q Consensus        88 ~~~fDlii~nPPy~~~  103 (225)
                      .+..|.++.|..+...
T Consensus        79 ~G~iDilVnnAG~~~~   94 (259)
T PRK12384         79 FGRVDLLVYSAGIAKA   94 (259)
T ss_pred             HCCCCEEEECCCCCCC
T ss_conf             2997199989977788


No 437
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=47.79  E-value=20  Score=15.97  Aligned_cols=73  Identities=18%  Similarity=0.140  Sum_probs=46.6

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCC
Q ss_conf             55789995878438999999867--9988999988989999889999980664522253020044423531000012357
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKN   88 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~   88 (225)
                      ++..+|=-|++.| ++..+|+++  .+++|+++|.++...              ....+.+.+.|+.+.......  ...
T Consensus         4 ~gK~alVTGas~G-IG~aia~~~a~~Ga~V~~~d~~~~~~--------------~~~~~~~~~~Dv~~~~v~~~~--~~~   66 (237)
T PRK06550          4 MTKTVLVTGAASG-IGLAQARAFLEQGAHVYGVDKSDKPD--------------LSGNFHFIQLDLSSDKLEPLF--KVV   66 (237)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHH--------------CCCCEEEEECCCCHHHHHHHH--HHC
T ss_conf             9989999374779-99999999998799999970861243--------------069738998638889999999--975


Q ss_pred             CCCCEEEECCCC
Q ss_conf             652057722654
Q gi|255764482|r   89 NFYDHVIMNPPF  100 (225)
Q Consensus        89 ~~fDlii~nPPy  100 (225)
                      +..|..+-|.-.
T Consensus        67 g~iDiLvNnAGi   78 (237)
T PRK06550         67 PSVDILCNTAGI   78 (237)
T ss_pred             CCCCEEEECCCC
T ss_conf             999799989888


No 438
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase. Members of this family occur as the BphD protein of biphenyl catabolism and as the TodD protein of toluene catabolism. Members catalyze the second step in each pathway and proved interchangeable when tested; the first and fourth enzymes in each pathway confer metabolic specificity. In the context of biphenyl degradation, the enzyme acts as cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase (EC 1.3.1.56), while in toluene degradation it acts as cis-toluene dihydrodiol dehydrogenase.
Probab=47.35  E-value=20  Score=15.93  Aligned_cols=81  Identities=16%  Similarity=0.155  Sum_probs=52.7

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---C
Q ss_conf             55789995878438999999867--998899998898999988999998066452225302004442353100001---2
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---G   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---~   85 (225)
                      +|..+|=-|.+.| ++..+|+++  .+++|+.+|.+.+.++....   .     ...++..+..|+.+........   .
T Consensus         4 ~gKvalITGgs~G-IG~aia~~~a~~Ga~V~i~~r~~~~l~~~~~---~-----~g~~~~~~~~Dv~~~~~~~~~v~~~~   74 (262)
T TIGR03325         4 KGEVVLVTGGASG-LGRAIVDRFVAEGARVAVLDKSAAGLQELEA---A-----HGDAVVGVEGDVRSLDDHKEAVARCV   74 (262)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHH---H-----CCCCEEEEECCCCCHHHHHHHHHHHH
T ss_conf             9988999067878-9999999999879999999899899999998---6-----79967999845799999999999999


Q ss_pred             CCCCCCCEEEECCCC
Q ss_conf             357652057722654
Q gi|255764482|r   86 LKNNFYDHVIMNPPF  100 (225)
Q Consensus        86 ~~~~~fDlii~nPPy  100 (225)
                      ..-++.|..+.|.-.
T Consensus        75 ~~~G~iDiLVnNAG~   89 (262)
T TIGR03325        75 AAFGKIDCLIPNAGI   89 (262)
T ss_pred             HHHCCCCEEEECCCC
T ss_conf             984998889972651


No 439
>pfam03435 Saccharop_dh Saccharopine dehydrogenase. This family comprised of three structural domains that can not be separated in the linear sequence. In some organisms this enzyme is found as a bifunctional polypeptide with lysine ketoglutarate reductase. The saccharopine dehydrogenase can also function as a saccharopine reductase.
Probab=47.29  E-value=20  Score=15.93  Aligned_cols=76  Identities=25%  Similarity=0.194  Sum_probs=39.1

Q ss_pred             EEEECCC-HHHHHHHHHHHCCC-CEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             9995878-43899999986799-889999889899998899999806645222530200444235310000123576520
Q gi|255764482|r   15 LADLGAG-AGAAGLAVASRLHE-AQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFYD   92 (225)
Q Consensus        15 VLDlGcG-~G~~~l~la~r~~~-~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~fD   92 (225)
                      ||=+||| .|...+....+..+ .+|+-.|.+.+-++.....       ....++...+.|+.+.....   .. -...|
T Consensus         1 IlvlGaG~vG~~~~~~L~~~~~~~~i~vad~~~~~~~~~~~~-------~~~~~~~~~~~d~~~~~~l~---~~-~~~~d   69 (384)
T pfam03435         1 VLIIGAGGVGQGVAPLLARHGDVDEITVADRSLEKAQALAAP-------KLGLRFIAIAVDADNYEALA---AL-LKEGD   69 (384)
T ss_pred             CEEECCCHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHH-------CCCCCEEEEEECCCCHHHHH---HH-HHCCC
T ss_conf             989897787999999997289988699998988998987752-------36985389995778999999---98-71289


Q ss_pred             EEEECCCCC
Q ss_conf             577226544
Q gi|255764482|r   93 HVIMNPPFN  101 (225)
Q Consensus        93 lii~nPPy~  101 (225)
                      +|++--|++
T Consensus        70 iVv~~~p~~   78 (384)
T pfam03435        70 LVINLAPPF   78 (384)
T ss_pred             EEEECCCHH
T ss_conf             999998434


No 440
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=46.58  E-value=21  Score=15.86  Aligned_cols=128  Identities=13%  Similarity=0.101  Sum_probs=60.6

Q ss_pred             CCCEEEEECCCH-HHHHHHHHHHC--CCCEEEEEE-----------CCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCC
Q ss_conf             557899958784-38999999867--998899998-----------8989999889999980664522253020044423
Q gi|255764482|r   11 GSFHLADLGAGA-GAAGLAVASRL--HEAQILLAE-----------RSPLMAHYARKTLALPANAQISKRISLIEVDVTL   76 (225)
Q Consensus        11 ~~~~VLDlGcG~-G~~~l~la~r~--~~~~v~gvD-----------~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~   76 (225)
                      +|..+|=-|++. +.++..+|.++  .+++|+-..           .+........+.+..+     ..++..++.|+.+
T Consensus         5 ~gKvalVTGas~~~GIG~aiA~~la~~Ga~Vvi~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----g~~~~~~~~Dl~~   79 (257)
T PRK12859          5 KNKVAVVTGVSRLDGIGAAICKELAEAGYDIFFTYWTAYDKEMPWGVDQSEQIQLQEELLKN-----GVKVSSMELDLTQ   79 (257)
T ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHC-----CCEEEEEECCCCC
T ss_conf             98889992889998629999999998799899983652011123453757999999999954-----9859999835899


Q ss_pred             CCCCCCCC---CCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHC--CCCCCHHHHHHHHHHHC-C-CCCEEEEE
Q ss_conf             53100001---2357652057722654464465478854556520--56689899999999862-4-69837870
Q gi|255764482|r   77 VGENRNLA---GLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHV--MLEDSFEKWIRTACAIM-R-SSGQLSLI  144 (225)
Q Consensus        77 ~~~~~~~~---~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~--~~~~~~~~~~~~a~~lL-k-pgG~~~~i  144 (225)
                      ......+.   ....+..|.++.|..+.................+  .....+ .+.+.+.+.+ + .+|++..+
T Consensus        80 ~~~~~~~i~~~~~~~g~iDilVnnAg~~~~~~~~~~~~e~~~~~~~vN~~~~~-~~~~~~~~~m~~~~~G~IIni  153 (257)
T PRK12859         80 NDAPKELINKVTEQLGYPHILINNAAYSTNNDFSNLTAEELDKHYMVNIRATT-LLSSQFARGFDKKSGGRIVNM  153 (257)
T ss_pred             HHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHH-HHHHHHHHHHHHCCCCEEEEE
T ss_conf             99999999999998299989998999999999055999999999999835789-999999998755379539999


No 441
>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase; InterPro: IPR014183   The members of this protein family show dual function. First, they remove formaldehyde, a toxic metabolite, by acting as S-(hydroxymethyl)glutathione dehydrogenase (1.1.1.284 from EC). S-(hydroxymethyl)glutathione can form spontaneously from formaldehyde and glutathione, and so this enzyme previously was designated glutathione-dependent formaldehyde dehydrogenase. These same proteins are also designated as class III alcohol dehydrogenases (1.1.1.1 from EC), i.e. alcohol dehydrogenases that do not require glutathione and they tend to show poor activity for ethanol among their various substrate alcohols..
Probab=46.16  E-value=21  Score=15.83  Aligned_cols=49  Identities=16%  Similarity=0.238  Sum_probs=37.8

Q ss_pred             HHCCCCCCCEEEEECCCHHHHHHHHHHHC-CCCEEEEEECCHHHHHHHHH
Q ss_conf             43899855789995878438999999867-99889999889899998899
Q gi|255764482|r    5 SLVNATGSFHLADLGAGAGAAGLAVASRL-HEAQILLAERSPLMAHYARK   53 (225)
Q Consensus         5 ~~~~~~~~~~VLDlGcG~G~~~l~la~r~-~~~~v~gvD~~~~~~~~A~~   53 (225)
                      +.+++++|..|.=.|-|.=.++.....+. ...+++++|+++.-.+.|++
T Consensus       179 ntakv~~G~~vavfGlG~~Gl~~~~Ga~~a~a~ri~a~d~n~~k~~~a~~  228 (368)
T TIGR02818       179 NTAKVEEGDTVAVFGLGGIGLSVIQGAKLAKASRIIAIDINPAKFELAKK  228 (368)
T ss_pred             HHHCCCCCCEEEEEECCHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHH
T ss_conf             32002578768998210467788764322035117998317579999976


No 442
>pfam03269 DUF268 Caenorhabditis protein of unknown function, DUF268.
Probab=45.99  E-value=21  Score=15.81  Aligned_cols=108  Identities=13%  Similarity=0.004  Sum_probs=54.5

Q ss_pred             CCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHH-HHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             578999587843899999986799889999889899998-8999998066452225302004442353100001235765
Q gi|255764482|r   12 SFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHY-ARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNF   90 (225)
Q Consensus        12 ~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~-A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~   90 (225)
                      |.++|=+|+=.=.+- ++|-.....+|+-||.+.-.+.. ++.++  ..         +...|+..     .+ ....++
T Consensus         2 gk~glVvGS~~PWvE-~~aL~~GA~~vlTvEYn~l~i~~~~~~rl--ss---------i~p~ef~~-----~~-~~~~~~   63 (177)
T pfam03269         2 GKSGVVIGSMQPWVE-VSALQNGASKILTVEYNKLTIQEEFRDRL--SS---------ILPTDFAK-----NF-KKYAES   63 (177)
T ss_pred             CCEEEEECCCCHHHH-HHHHHCCCCCEEEEEECCCCCCCHHHHCC--CC---------CCHHHHHH-----HH-HHHCCC
T ss_conf             951899847753999-99998188734899723555661332100--11---------56889999-----98-752353


Q ss_pred             CCEEEECCCCCCCCCCCCCCHHHHHHHCCCC---CCHHHHHHHHHHHCCCCCEEEEECCH
Q ss_conf             2057722654464465478854556520566---89899999999862469837870288
Q gi|255764482|r   91 YDHVIMNPPFNERIGTMTPDKIKEEAHVMLE---DSFEKWIRTACAIMRSSGQLSLIARP  147 (225)
Q Consensus        91 fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~---~~~~~~~~~a~~lLkpgG~~~~i~~~  147 (225)
                      ||.+++---+-+.+-          -|+.+.   .....-+....++|||||.+++..|-
T Consensus        64 FD~a~SfSSiEH~GL----------GRYGDpidp~Gdlk~m~~i~~~Lk~~G~l~l~vPi  113 (177)
T pfam03269        64 FDFAASFSSIEHSGL----------GRYGDPIDPIGDLREMLKIKCVLKKGGLLFLGLPL  113 (177)
T ss_pred             EEEEEEEEEEEECCC----------CCCCCCCCCCCCHHHHHHHHHHHCCCCEEEEEECC
T ss_conf             238999612444056----------55689779851099999999861789679999537


No 443
>COG0827 Adenine-specific DNA methylase [DNA replication, recombination, and repair]
Probab=45.43  E-value=22  Score=15.76  Aligned_cols=135  Identities=19%  Similarity=0.152  Sum_probs=59.4

Q ss_pred             CCCCEEEEECCCH-HHHHHHHHHHCCC----CEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCC---CCC
Q ss_conf             8557899958784-3899999986799----8899998898999988999998066452225302004442353---100
Q gi|255764482|r   10 TGSFHLADLGAGA-GAAGLAVASRLHE----AQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVG---ENR   81 (225)
Q Consensus        10 ~~~~~VLDlGcG~-G~~~l~la~r~~~----~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~---~~~   81 (225)
                      +..-.++|.++|. |...-...-+...    ..-.|.+.++..+..+..+......     +..+.+.+.....   ...
T Consensus       151 ~~e~t~~~~~~~~~~~~f~~~~~~~~~~~~~~~~~~~e~~~~l~~~~~~~~~~~~~-----~~~l~~~~~v~~~~~~~~~  225 (381)
T COG0827         151 KREITILDFCSGDFGNLFQTVILNLVKKGLKLDNFGKEVDDLLIKLALLTAYFLEL-----QQILKEVDAVKVGITGRNS  225 (381)
T ss_pred             CCCEEEECHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHHHHHHHHCCCCCCCCH
T ss_conf             44415403432342013268887642655544300033147888887757779999-----8742146541003234302


Q ss_pred             CCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHC-CCCCEEEEECCHHHH
Q ss_conf             001235765205772265446446547885455652056689899999999862-469837870288889
Q gi|255764482|r   82 NLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIM-RSSGQLSLIARPQSL  150 (225)
Q Consensus        82 ~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lL-kpgG~~~~i~~~~~l  150 (225)
                      .+..... .+|.++..-|.+...............+.........+++.+...+ +|+|+..++.|-..+
T Consensus       226 ~~~~~~~-~~~~~~~~~Pig~~~~~~~~~~f~~~~~~~~~~~h~~~iE~~~~~~~k~~~~~~fl~p~~~~  294 (381)
T COG0827         226 YFLGPKA-NSDIVIFDLPIGFYPNDLAAKRFDLEPNDGHLLAHILFIEQSLLHLKKPGGYAIFLAPKDLF  294 (381)
T ss_pred             HHCCCCC-CCCEEEEECCCCCCCCHHHHHHHCCCCCCCHHHHHHHHHHHHCCCCCCCCCCEEEECCHHHH
T ss_conf             3214555-67736885365677604542331255677327779999986413356887547997114641


No 444
>KOG1209 consensus
Probab=45.19  E-value=22  Score=15.74  Aligned_cols=79  Identities=18%  Similarity=0.150  Sum_probs=51.3

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCH-HHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCC----CCC
Q ss_conf             55789995878438999999867--998899998898-99998899999806645222530200444235310----000
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSP-LMAHYARKTLALPANAQISKRISLIEVDVTLVGEN----RNL   83 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~-~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~----~~~   83 (225)
                      ....||=.||-.|+++-++|..+  .+..|++.-.+- .|..++.+           ..+....-|+......    ...
T Consensus         6 ~~k~VlItgcs~GGIG~ala~ef~~~G~~V~AtaR~~e~M~~L~~~-----------~gl~~~kLDV~~~~~V~~v~~ev   74 (289)
T KOG1209           6 QPKKVLITGCSSGGIGYALAKEFARNGYLVYATARRLEPMAQLAIQ-----------FGLKPYKLDVSKPEEVVTVSGEV   74 (289)
T ss_pred             CCCEEEEEECCCCCHHHHHHHHHHHCCEEEEEECCCCCHHHHHHHH-----------HCCEEEEECCCCHHHHHHHHHHH
T ss_conf             7975999605776534999999986781999970224607667886-----------09705870568727789988888


Q ss_pred             CCCCCCCCCEEEECCCC
Q ss_conf             12357652057722654
Q gi|255764482|r   84 AGLKNNFYDHVIMNPPF  100 (225)
Q Consensus        84 ~~~~~~~fDlii~nPPy  100 (225)
                      ...++++.|+.+-|.--
T Consensus        75 r~~~~Gkld~L~NNAG~   91 (289)
T KOG1209          75 RANPDGKLDLLYNNAGQ   91 (289)
T ss_pred             HHCCCCCEEEEECCCCC
T ss_conf             61899826888717998


No 445
>PRK05717 oxidoreductase; Validated
Probab=44.57  E-value=22  Score=15.68  Aligned_cols=125  Identities=18%  Similarity=0.151  Sum_probs=67.4

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC---C
Q ss_conf             855789995878438999999867--99889999889899998899999806645222530200444235310000---1
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL---A   84 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~---~   84 (225)
                      -.|..+|=-|.+.| ++..+|+++  .+++|+..|.+++-.+...+.+        ..+..++..|+.+.......   .
T Consensus         8 l~GKvalITG~s~G-IG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~--------~~~~~~~~~Dvt~~~~v~~~i~~~   78 (255)
T PRK05717          8 HNGRVALVTGAARG-IGLGIAAWLIAEGWQVVLADLDRERGAKVAKAL--------GENAWFIAMDVADEAQVAAGVAEV   78 (255)
T ss_pred             CCCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHH--------CCCEEEEEEECCCHHHHHHHHHHH
T ss_conf             99988999587888-999999999987998999969889999999984--------897589993079999999999999


Q ss_pred             CCCCCCCCEEEECCCCCCCCCCC--CCC--HHHHHHHCCCCCCHHHHHHHHHHHCC-CCCEEEEE
Q ss_conf             23576520577226544644654--788--54556520566898999999998624-69837870
Q gi|255764482|r   85 GLKNNFYDHVIMNPPFNERIGTM--TPD--KIKEEAHVMLEDSFEKWIRTACAIMR-SSGQLSLI  144 (225)
Q Consensus        85 ~~~~~~fDlii~nPPy~~~~~~~--~~~--~~~~~a~~~~~~~~~~~~~~a~~lLk-pgG~~~~i  144 (225)
                      ....++.|.++.|--........  ..+  .....-.......+ ...+.+...++ .+|.+..+
T Consensus        79 ~~~~G~id~lvnNAg~~~~~~~~l~~~~~~~w~~~~~vNl~g~f-~~~k~~~~~m~~~~G~IIni  142 (255)
T PRK05717         79 LGQFGRLDALVCNAAIANPHNTTLESLSLAQWNRVLAVNLGGPM-LLAKHCAPYLRAHNGAIVNL  142 (255)
T ss_pred             HHHHCCCCEEEECCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHH-HHHHHCHHHHHHCCCCEEEE
T ss_conf             99829998999877305789998355999999999998604265-77664319887479986999


No 446
>PRK07774 short chain dehydrogenase; Provisional
Probab=44.50  E-value=22  Score=15.68  Aligned_cols=84  Identities=20%  Similarity=0.159  Sum_probs=54.0

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---C
Q ss_conf             55789995878438999999867--998899998898999988999998066452225302004442353100001---2
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---G   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---~   85 (225)
                      +|..+|=-|.+.| ++..+|.++  .+++|+-.|.+++..+.+.+.+...+     .+...+..|+.+......+.   .
T Consensus         5 ~gK~alVTGgs~G-iG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~i~~~g-----~~~~~~~~Dv~~~~~v~~~~~~~~   78 (250)
T PRK07774          5 DDKVAIVTGAAGG-IGQAYAEALAREGASVVVADINAEGAERVAKQIVADG-----GTAIAVQVDVSDPDSAKAMADRTV   78 (250)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC-----CEEEEEECCCCCHHHHHHHHHHHH
T ss_conf             9988999797688-9999999999869999999798899999999998559-----849999825899999999999999


Q ss_pred             CCCCCCCEEEECCCC
Q ss_conf             357652057722654
Q gi|255764482|r   86 LKNNFYDHVIMNPPF  100 (225)
Q Consensus        86 ~~~~~fDlii~nPPy  100 (225)
                      ..-+..|.++-|.-.
T Consensus        79 ~~fG~iDilVNnAg~   93 (250)
T PRK07774         79 SAFGGIDYLVNNAAI   93 (250)
T ss_pred             HHHCCCCEEEECCCC
T ss_conf             983999899988843


No 447
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed
Probab=43.84  E-value=23  Score=15.62  Aligned_cols=64  Identities=16%  Similarity=0.119  Sum_probs=34.4

Q ss_pred             CCHHHHHHHHHHHCC--CCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCEEEE
Q ss_conf             784389999998679--98899998898999988999998066452225302004442353100001235765205772
Q gi|255764482|r   20 AGAGAAGLAVASRLH--EAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIM   96 (225)
Q Consensus        20 cG~G~~~l~la~r~~--~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~fDlii~   96 (225)
                      ||.|-++..||++..  +-.|+-+|.|++.++.+..+.          .+..+++|..+....   .......+|++++
T Consensus         6 ~GaG~vG~~La~~Ls~e~~dV~vID~d~~~~~~~~~~l----------Dv~~i~Gd~~~~~~L---~~Agi~~ad~~IA   71 (455)
T PRK09496          6 LGAGQVGGTLAERLVGENNDVTVIDTDEERLRRLQDRL----------DVRTVVGNGSHPDVL---REAGAEDADMLIA   71 (455)
T ss_pred             ECCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHC----------CEEEEEECCCCHHHH---HHCCCCCCCEEEE
T ss_conf             99888999999999868997999989999999988625----------868999668999999---9659986999999


No 448
>pfam02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain. This family also includes lambda crystallin.
Probab=43.54  E-value=23  Score=15.59  Aligned_cols=44  Identities=25%  Similarity=0.271  Sum_probs=31.4

Q ss_pred             EEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHH
Q ss_conf             99958784389999998679988999988989999889999980
Q gi|255764482|r   15 LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALP   58 (225)
Q Consensus        15 VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~   58 (225)
                      |.=+|+|+=+.+++......+.+|+-+|.+++.++.++..+...
T Consensus         2 V~ViGaG~mG~~iA~~~a~~G~~V~l~D~~~~~l~~~~~~i~~~   45 (180)
T pfam02737         2 VAVIGAGTMGAGIAQVFARAGLEVVLVDISEEALEKARARIEKS   45 (180)
T ss_pred             EEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHH
T ss_conf             89999788999999999967993999979989999999999998


No 449
>COG0338 Dam Site-specific DNA methylase [DNA replication, recombination, and repair]
Probab=43.00  E-value=6.6  Score=18.67  Aligned_cols=35  Identities=17%  Similarity=0.303  Sum_probs=29.2

Q ss_pred             CEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHH
Q ss_conf             78999587843899999986799889999889899998
Q gi|255764482|r   13 FHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHY   50 (225)
Q Consensus        13 ~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~   50 (225)
                      .+..|+.||.|++.+.+++.   -+.+.-|++++.+..
T Consensus        27 ~~y~EPF~GggaV~i~~~~~---~~~i~~Din~~Lvn~   61 (274)
T COG0338          27 VSYIEPFVGGGAVFINLAAK---KKYILNDINPDLVNL   61 (274)
T ss_pred             CEEECCCCCCCEEEEEHHHH---HHHHHHCCCHHHHHH
T ss_conf             61637766742010323022---446675078899999


No 450
>PRK07067 sorbitol dehydrogenase; Provisional
Probab=42.96  E-value=24  Score=15.54  Aligned_cols=124  Identities=17%  Similarity=0.133  Sum_probs=67.4

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---C
Q ss_conf             55789995878438999999867--998899998898999988999998066452225302004442353100001---2
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---G   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---~   85 (225)
                      +|..+|=-|++.| ++..+|+++  .+++|+..|++++..+...+.+        ..+...++.|+.+........   .
T Consensus         4 ~gKvalVTGas~G-IG~aia~~la~~Ga~V~i~d~~~~~~~~~~~~~--------g~~~~~~~~Dvt~~~~v~~~v~~~~   74 (256)
T PRK07067          4 QGKVALLTGAASG-IGEAVAQRYLREGARVVLADIKPARAALAALEI--------GPAAVAVSLDVTRQDSIDRIVAAAV   74 (256)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHH--------CCCEEEEEEECCCHHHHHHHHHHHH
T ss_conf             9988999376778-999999999987999999979889999999981--------9975999984899999999999999


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCH--HHHHHHHHHHC-C--CCCEEEEE
Q ss_conf             357652057722654464465478854556520566898--99999999862-4--69837870
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSF--EKWIRTACAIM-R--SSGQLSLI  144 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~--~~~~~~a~~lL-k--pgG~~~~i  144 (225)
                      ...+..|..+.|.-..........+... +.+....+..  .-..+.+.+.+ +  .+|++..+
T Consensus        75 ~~~G~iDiLVNNAGi~~~~~~~~~~~e~-~~~~~~vNl~g~f~~~~~~~~~m~~~~~~G~IVni  137 (256)
T PRK07067         75 ERFGGIDILVNNAALFDMAPILEISRDV-YDRLFAVNVKGLFFLMQAVAQHMVEQGRGGKIINM  137 (256)
T ss_pred             HHCCCCCEEEECCCCCCCCCHHHCCHHH-HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEE
T ss_conf             9819998999899889998813499999-99999985177899999999999980899559998


No 451
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=42.90  E-value=24  Score=15.53  Aligned_cols=47  Identities=17%  Similarity=0.061  Sum_probs=32.1

Q ss_pred             HHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHH
Q ss_conf             43899855789995878438999999867998899998898999988
Q gi|255764482|r    5 SLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYA   51 (225)
Q Consensus         5 ~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A   51 (225)
                      ..-+..+|.+|+=+|.|--+.+.+-.-...+.+|++.|.++..+...
T Consensus         5 ~~~~~~~Gk~V~V~GlG~sG~a~a~~L~~~G~~v~~~D~~~~~~~~~   51 (487)
T PRK03369          5 MLDPLTPGAPVLVAGAGVTGRAVLAALTRFGARPTVCDDDPDALRPH   51 (487)
T ss_pred             CCCCCCCCCEEEEEEECHHHHHHHHHHHHCCCEEEEEECCCHHHHHH
T ss_conf             47865798989999156838999999997869799998982577999


No 452
>PRK08589 short chain dehydrogenase; Validated
Probab=42.44  E-value=24  Score=15.49  Aligned_cols=126  Identities=15%  Similarity=0.149  Sum_probs=65.6

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---C
Q ss_conf             55789995878438999999867--998899998898999988999998066452225302004442353100001---2
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---G   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---~   85 (225)
                      +|..+|=-|.+.|. +..+|+++  .+++|+..|+++..-+.++ .+...+     .++..+..|+.+......+.   .
T Consensus         5 ~gKvalVTGas~GI-G~aiA~~la~~Ga~Vv~~d~~~~~~~~~~-~i~~~g-----~~~~~~~~Dvsd~~~v~~~v~~~~   77 (272)
T PRK08589          5 ENKVAVITGASTGI-GQASAIALAQEGAYVLAVDIAEAVSETVD-KIKSNG-----GKAKAYHVDISDEQQVKDFASDIK   77 (272)
T ss_pred             CCCEEEEECCCCHH-HHHHHHHHHHCCCEEEEEECCHHHHHHHH-HHHHCC-----CCEEEEEECCCCHHHHHHHHHHHH
T ss_conf             97989997825699-99999999986999999838278999999-999559-----948999960799999999999999


Q ss_pred             CCCCCCCEEEECCCCCCCCC-CCCCCH--HHHHHHCCCCCCHHHHHHHHHHH-CCCCCEEEEE
Q ss_conf             35765205772265446446-547885--45565205668989999999986-2469837870
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIG-TMTPDK--IKEEAHVMLEDSFEKWIRTACAI-MRSSGQLSLI  144 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~-~~~~~~--~~~~a~~~~~~~~~~~~~~a~~l-LkpgG~~~~i  144 (225)
                      ...+..|..+.|--...... ....+.  ....-.......+ ...+.+..+ .+.||.+..+
T Consensus        78 ~~~G~iDiLVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~f-~~~~~~~p~m~~~gG~IVni  139 (272)
T PRK08589         78 EQFGHIDVLFNNAGVDNAAGRIHEYPVDVFDKIMAVDMRGTF-LMTKMLLPLMMEQGGSIINT  139 (272)
T ss_pred             HHHCCCCEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHH-HHHHHHHHHHHHCCCEEEEE
T ss_conf             982998789989866788887100999999999999829999-99999999999759907999


No 453
>KOG1197 consensus
Probab=42.30  E-value=24  Score=15.48  Aligned_cols=54  Identities=17%  Similarity=0.100  Sum_probs=35.7

Q ss_pred             CCHHHCCCCCCCEEEEECC--CHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHH
Q ss_conf             6624389985578999587--843899999986799889999889899998899999
Q gi|255764482|r    2 ILASLVNATGSFHLADLGA--GAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLA   56 (225)
Q Consensus         2 lLa~~~~~~~~~~VLDlGc--G~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~   56 (225)
                      ||-.+-++++|..||=-.+  |.|.+...++ |..+.++++.-...+-.++|++|=.
T Consensus       137 ll~e~y~vkpGhtVlvhaAAGGVGlll~Ql~-ra~~a~tI~~asTaeK~~~akenG~  192 (336)
T KOG1197         137 LLFEAYNVKPGHTVLVHAAAGGVGLLLCQLL-RAVGAHTIATASTAEKHEIAKENGA  192 (336)
T ss_pred             HHHHHCCCCCCCEEEEEECCCCHHHHHHHHH-HHCCCEEEEEECCHHHHHHHHHCCC
T ss_conf             9998658899978999831562879999999-7528679997253788999986487


No 454
>pfam11312 DUF3115 Protein of unknown function (DUF3115). This eukaryotic family of proteins has no known function.
Probab=42.00  E-value=25  Score=15.45  Aligned_cols=126  Identities=16%  Similarity=0.176  Sum_probs=66.4

Q ss_pred             CCCEEEEECCCHHHHHHHHHHH-----------CCCCEEEEEECCH--HHHHHHHHHHHHHCC----CCCCCCCEEECCC
Q ss_conf             5578999587843899999986-----------7998899998898--999988999998066----4522253020044
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASR-----------LHEAQILLAERSP--LMAHYARKTLALPAN----AQISKRISLIEVD   73 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r-----------~~~~~v~gvD~~~--~~~~~A~~n~~~~~~----~~~~~~~~~~~~D   73 (225)
                      +..+||=+|-|.|+=.+++|.-           .++.++++|||-+  ..+......+.-+..    ......+.|.+.|
T Consensus        79 ~~~~VlcIGGGAgaElvAla~~~~~~~~~~~~~~~~l~it~vDiAdWs~VV~~L~~~i~s~~~~~~~~~~~~~v~F~~~D  158 (288)
T pfam11312        79 STLNVLCIGGGAGAELVALAAVFRLSREHLSKSPSGLSVTLVDIADWSNVVDRLATAIRSPWVPQSIEADRFNVKFRQGD  158 (288)
T ss_pred             CCCCEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEECCHHHHHHHHHHHCCCCCCCCCCCCHHCEEEEEECC
T ss_conf             77656997888238999999998742431578888861789974256999999986435889866688203025466544


Q ss_pred             CCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHHHH
Q ss_conf             42353100001235765205772265446446547885455652056689899999999862469837870288889
Q gi|255764482|r   74 VTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSL  150 (225)
Q Consensus        74 ~~~~~~~~~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~~l  150 (225)
                      +......... ......-++|--   +|..      +    .-.......-..|+......++||-.+.++-.|.-+
T Consensus       159 vL~~~~~~l~-~l~~~~~~LiTL---lFTl------N----ELFs~s~~kTt~FLl~Lt~~~~~GslLLVvdSpGSY  221 (288)
T pfam11312       159 VLSLSKDELI-GLLGDKLDLVTL---LFTL------N----ELFTESRAKTTKFLLRLTAQCKPGSLLLIVDSAGSY  221 (288)
T ss_pred             CCCCCHHHHH-HCCCCCCCCHHH---HHHH------H----HHHHCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCC
T ss_conf             0137846665-304788613038---8787------8----987647188999999998547999589998689973


No 455
>PRK12354 carbamate kinase; Reviewed
Probab=41.72  E-value=25  Score=15.43  Aligned_cols=11  Identities=18%  Similarity=0.135  Sum_probs=5.9

Q ss_pred             CCEEEEECCCH
Q ss_conf             57899958784
Q gi|255764482|r   12 SFHLADLGAGA   22 (225)
Q Consensus        12 ~~~VLDlGcG~   22 (225)
                      .+.|+-=|-|.
T Consensus        42 ~~vvitHGNGP   52 (302)
T PRK12354         42 NEVVIVHGNGP   52 (302)
T ss_pred             CEEEEEECCCH
T ss_conf             95999827816


No 456
>COG2933 Predicted SAM-dependent methyltransferase [General function prediction only]
Probab=41.64  E-value=25  Score=15.42  Aligned_cols=39  Identities=18%  Similarity=0.337  Sum_probs=29.7

Q ss_pred             CCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHH
Q ss_conf             98557899958784389999998679988999988989999
Q gi|255764482|r    9 ATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAH   49 (225)
Q Consensus         9 ~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~   49 (225)
                      ..+|-...|+|+-.|+.+-.|.+|  +-.|++||.-+-+-.
T Consensus       209 L~~~M~avDLGAcPGGWTyqLVkr--~m~V~aVDng~ma~s  247 (358)
T COG2933         209 LAPGMWAVDLGACPGGWTYQLVKR--NMRVYAVDNGPMAQS  247 (358)
T ss_pred             HCCCCEEEECCCCCCCCCHHHHHC--CEEEEEECCCHHHHH
T ss_conf             067865642266898622542315--608999436222265


No 457
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed
Probab=41.50  E-value=25  Score=15.41  Aligned_cols=48  Identities=21%  Similarity=0.212  Sum_probs=34.3

Q ss_pred             CCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHH
Q ss_conf             985578999587843899999986799889999889899998899999
Q gi|255764482|r    9 ATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLA   56 (225)
Q Consensus         9 ~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~   56 (225)
                      +++-.+|-=+|+|+=+..++...-..+..|+-+|++++.++.++.++.
T Consensus       310 ~~~i~~v~ViGaG~MG~GIA~~~a~aG~~V~l~D~~~e~l~~g~~~~~  357 (715)
T PRK11730        310 AKDVKQAAVLGAGIMGGGIAYQSASKGVPVIMKDINQKALDLGMNEAA  357 (715)
T ss_pred             CCCCCEEEEECCCCCHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHH
T ss_conf             777627999787710799999999579957999789999999999999


No 458
>TIGR01137 cysta_beta cystathionine beta-synthase; InterPro: IPR005857    This model discriminates cystathionine beta-synthase, a protein found primarily in eukaryotes and carrying a C-terminal CBS domain from cysteine synthases. Cysteine synthase (O-acetylserine (thiol)-lyase) is the enzyme responsible for the formation of cysteine from O-acetyl-serine and hydrogen sulphide with the concomitant release of acetic acid - the function of many of these enzymes is unproven.; GO: 0004122 cystathionine beta-synthase activity, 0019343 cysteine biosynthetic process via cystathionine, 0005737 cytoplasm.
Probab=40.77  E-value=26  Score=15.34  Aligned_cols=33  Identities=12%  Similarity=0.225  Sum_probs=19.5

Q ss_pred             CCCC-CEEEEECCCHHHHHHHHHHHCCCCEEEEE
Q ss_conf             9855-78999587843899999986799889999
Q gi|255764482|r    9 ATGS-FHLADLGAGAGAAGLAVASRLHEAQILLA   41 (225)
Q Consensus         9 ~~~~-~~VLDlGcG~G~~~l~la~r~~~~~v~gv   41 (225)
                      .+|| +.+.||=+|+=+++|+|+....|.+.+=+
T Consensus        61 lkPGr~TiiEPTSGNTGiGLAL~Aa~kGYk~Iiv   94 (527)
T TIGR01137        61 LKPGRDTIIEPTSGNTGIGLALVAAIKGYKCIIV   94 (527)
T ss_pred             EECCCCCEEECCCCCHHHHHHHHHHHCCCEEEEE
T ss_conf             3068872460688844689999995268639998


No 459
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated
Probab=40.69  E-value=26  Score=15.33  Aligned_cols=46  Identities=20%  Similarity=0.114  Sum_probs=33.7

Q ss_pred             CEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHH
Q ss_conf             7899958784389999998679988999988989999889999980
Q gi|255764482|r   13 FHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALP   58 (225)
Q Consensus        13 ~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~   58 (225)
                      ++|.=+|+|+=+.+++...-..+.+|+-+|.+++.++.++.+++..
T Consensus         3 kkV~ViGaG~MG~~IA~~~a~~G~~V~l~D~~~e~l~~~~~~i~~~   48 (289)
T PRK09260          3 EKIVVVGAGVMGRGIAYVFASSGFQTTLVDISQEQLASAQQEIESI   48 (289)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHH
T ss_conf             7699979688789999999968998899979989999999999999


No 460
>PRK06197 short chain dehydrogenase; Provisional
Probab=40.62  E-value=26  Score=15.33  Aligned_cols=92  Identities=21%  Similarity=0.182  Sum_probs=59.9

Q ss_pred             CCCCCCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC
Q ss_conf             899855789995878438999999867--998899998898999988999998066452225302004442353100001
Q gi|255764482|r    7 VNATGSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA   84 (225)
Q Consensus         7 ~~~~~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~   84 (225)
                      +|--.|..|+=-|+-+| ++...|+.+  .+++|+-.-.|++-.+.+.+.+....   ...++.+...|+.+........
T Consensus        11 ipDL~GK~~lITGa~sG-IG~~~A~~La~~ga~Vil~~R~~~k~~~a~~~i~~~~---~~~~i~~~~lDLssl~sV~~~a   86 (306)
T PRK06197         11 IPDQSGRVAVVTGANTG-LGYETAAALAAKGAHVVLAVRNLDKGNAAAARITAAH---PGADVTLQELDLASLASVRAAA   86 (306)
T ss_pred             CCCCCCCEEEECCCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHC---CCCCEEEEECCCHHHHHHHHHH
T ss_conf             88989999999168959-9999999999784989999798999999999999768---9985799976643077899999


Q ss_pred             ---CCCCCCCCEEEECCCCCC
Q ss_conf             ---235765205772265446
Q gi|255764482|r   85 ---GLKNNFYDHVIMNPPFNE  102 (225)
Q Consensus        85 ---~~~~~~fDlii~nPPy~~  102 (225)
                         .......|..+.|.--+.
T Consensus        87 ~~~~~~~~~lDvLinNAGi~~  107 (306)
T PRK06197         87 DALRAAYPRIDLLINNAGVMY  107 (306)
T ss_pred             HHHHHCCCCCCEEEECCCCCC
T ss_conf             999961898768997784456


No 461
>PRK07069 short chain dehydrogenase; Validated
Probab=40.38  E-value=26  Score=15.30  Aligned_cols=118  Identities=17%  Similarity=0.057  Sum_probs=58.0

Q ss_pred             HHHHHHHHHHC--CCCEEEEEECCHHHH-HHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC---CCCCCCCCCEEEE
Q ss_conf             38999999867--998899998898999-98899999806645222530200444235310000---1235765205772
Q gi|255764482|r   23 GAAGLAVASRL--HEAQILLAERSPLMA-HYARKTLALPANAQISKRISLIEVDVTLVGENRNL---AGLKNNFYDHVIM   96 (225)
Q Consensus        23 G~~~l~la~r~--~~~~v~gvD~~~~~~-~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~---~~~~~~~fDlii~   96 (225)
                      +.++..+|+++  .+++|+-+|++.+.. +...+.+....   ........+.|+.+......+   .....+..|..+.
T Consensus         9 ~GIG~aia~~la~~Ga~V~i~d~~~~~~~~~~~~~l~~~~---~~~~~~~~~~Dv~~~~~v~~~v~~~~~~~G~iDilVN   85 (251)
T PRK07069          9 GGLGRAIARRMAEQGARVFLTDINDAAALDAFAAEINAAH---GEGVAFAAVQDVTDEAQWQALLAQAADAMGGLSVLVN   85 (251)
T ss_pred             CHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCC---CCCEEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             8899999999998699999996894358999999998615---9963999957799999999999999998299989998


Q ss_pred             CCCCCCCCCCCCCCHHHHHHHCCCCCC--HHHHHHHHHHHCCCC--CEEEEE
Q ss_conf             265446446547885455652056689--899999999862469--837870
Q gi|255764482|r   97 NPPFNERIGTMTPDKIKEEAHVMLEDS--FEKWIRTACAIMRSS--GQLSLI  144 (225)
Q Consensus        97 nPPy~~~~~~~~~~~~~~~a~~~~~~~--~~~~~~~a~~lLkpg--G~~~~i  144 (225)
                      |.-..........+... +.+....+.  ...+.+.+..+++.+  |++..+
T Consensus        86 nAGi~~~~~~~~~~~~~-w~~~~~vNl~g~f~~~~~~~p~m~~~~~G~IVni  136 (251)
T PRK07069         86 NAGVGSFGAIEQIELDE-WRRVMAINVESIVLGCKHALPYLRASQPASIVNI  136 (251)
T ss_pred             CCCCCCCCCCHHCCHHH-HHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             99999999903499999-9999999978999999999999996699789992


No 462
>PRK07523 gluconate 5-dehydrogenase; Provisional
Probab=39.96  E-value=27  Score=15.27  Aligned_cols=84  Identities=21%  Similarity=0.192  Sum_probs=53.3

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC---CC
Q ss_conf             55789995878438999999867--99889999889899998899999806645222530200444235310000---12
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL---AG   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~---~~   85 (225)
                      +|.++|=-|.+.| ++..+|+++  .+++|+-.+.+++.++.+.+.+        ..+......|+.+.......   ..
T Consensus         8 ~gK~alVTG~s~G-IG~aiA~~la~~Ga~Vvi~~r~~~~l~~~~~~l--------~~~~~~~~~Dvtd~~~v~~~v~~~~   78 (251)
T PRK07523          8 TGRRALITGSSQG-IGYALAKGLAQAGAEVILNGRDAAKLAAAAESL--------KGSAHTLAFDVTDHDAVRAAIDAFE   78 (251)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHC--------CCCCEEEEEECCCHHHHHHHHHHHH
T ss_conf             9998999583669-999999999987999999969989999999981--------8872799995799999999999999


Q ss_pred             CCCCCCCEEEECCCCCCC
Q ss_conf             357652057722654464
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNER  103 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~  103 (225)
                      ...+..|..+.|.-....
T Consensus        79 ~~~G~iDiLVNNAG~~~~   96 (251)
T PRK07523         79 AEIGPIDILVNNAGMQHR   96 (251)
T ss_pred             HHCCCCCEEEECCCCCCC
T ss_conf             975998699989887999


No 463
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional
Probab=39.82  E-value=27  Score=15.25  Aligned_cols=42  Identities=14%  Similarity=0.179  Sum_probs=30.9

Q ss_pred             CCCCEEEEECCCHHHH-HHHHHHHCCCCEEEEEECCHHHHHHHH
Q ss_conf             8557899958784389-999998679988999988989999889
Q gi|255764482|r   10 TGSFHLADLGAGAGAA-GLAVASRLHEAQILLAERSPLMAHYAR   52 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~-~l~la~r~~~~~v~gvD~~~~~~~~A~   52 (225)
                      -++.+|+=+|+|.-++ ++..|++ -++.|.++|..+...+..+
T Consensus       163 VpPAkVlViGaGVAGlqAi~tA~~-LGA~V~a~DvR~~~~Eqve  205 (510)
T PRK09424        163 VPPAKVLVIGAGVAGLAAIGAAGS-LGAIVRAFDTRPEVKEQVE  205 (510)
T ss_pred             CCCCEEEEECCCHHHHHHHHHHHH-CCCEEEEECCCHHHHHHHH
T ss_conf             788528997464777999999962-7978999658788999999


No 464
>KOG0919 consensus
Probab=39.49  E-value=27  Score=15.22  Aligned_cols=78  Identities=10%  Similarity=0.204  Sum_probs=45.2

Q ss_pred             CCEEEEECCCHHHHHHHHHHH-CCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             578999587843899999986-7998899998898999988999998066452225302004442353100001235765
Q gi|255764482|r   12 SFHLADLGAGAGAAGLAVASR-LHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNF   90 (225)
Q Consensus        12 ~~~VLDlGcG~G~~~l~la~r-~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~   90 (225)
                      .-|||++-+|.|.+--++-.. .|+--|-++|+++.+-+.-..|..    .+.-.     .-|+.....    .....-.
T Consensus         3 pLrVlelysg~ggmhyal~~a~ipaqiVaAiDvNtvANevY~~N~h----~~L~k-----~~~I~~lt~----kefd~l~   69 (338)
T KOG0919           3 PLRVLELYSGHGGMHYALEDAQIPAQIVAAIDVNTVANEVYAHNYH----SNLVK-----TRNIQSLTV----KEFDKLQ   69 (338)
T ss_pred             CEEHHHHHHCCCHHHHHHHHHCCCHHHEEEEECCHHHHHHHHCCCC----CCHHH-----CCCCCEEEH----HHHHHCC
T ss_conf             4133355543214565676516864527877334267788841854----31220-----135441128----6641014


Q ss_pred             CCEEEECCCCCC
Q ss_conf             205772265446
Q gi|255764482|r   91 YDHVIMNPPFNE  102 (225)
Q Consensus        91 fDlii~nPPy~~  102 (225)
                      +++++..||+-+
T Consensus        70 ~~m~lMSPpCQP   81 (338)
T KOG0919          70 ANMLLMSPPCQP   81 (338)
T ss_pred             CCEEEECCCCCC
T ss_conf             555850799984


No 465
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed
Probab=38.90  E-value=28  Score=15.17  Aligned_cols=49  Identities=18%  Similarity=0.118  Sum_probs=33.6

Q ss_pred             CCCCCEEEEECCCHHHHHHH-HHHHCCCCEEEEEECCHHHHHHHHHHHHH
Q ss_conf             98557899958784389999-99867998899998898999988999998
Q gi|255764482|r    9 ATGSFHLADLGAGAGAAGLA-VASRLHEAQILLAERSPLMAHYARKTLAL   57 (225)
Q Consensus         9 ~~~~~~VLDlGcG~G~~~l~-la~r~~~~~v~gvD~~~~~~~~A~~n~~~   57 (225)
                      +++=.+|-=+|+|+=..+++ +.....+.+|+-+|+|++.++.++.+++.
T Consensus       306 p~~i~kv~ViGaG~MG~gIA~~~a~~aG~~V~l~D~~~e~l~~~~~~i~~  355 (706)
T PRK11154        306 PRPVNKVGVLGGGLMGGGIAYVTATKAGLPVRIKDINPQGINHALKYSWD  355 (706)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHH
T ss_conf             77676799986473238999999998698799997999999999998899


No 466
>PRK07831 short chain dehydrogenase; Provisional
Probab=37.46  E-value=29  Score=15.04  Aligned_cols=131  Identities=16%  Similarity=0.055  Sum_probs=70.3

Q ss_pred             CCCCEEEEECCC-HHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC--
Q ss_conf             855789995878-438999999867--998899998898999988999998066452225302004442353100001--
Q gi|255764482|r   10 TGSFHLADLGAG-AGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA--   84 (225)
Q Consensus        10 ~~~~~VLDlGcG-~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~--   84 (225)
                      -+|.++|=-|++ .| ++..+|+++  .+++|+-.|.+++.+..+...+....   ...++..+.+|+.+......+.  
T Consensus        14 L~gKvalVTGgsg~G-IG~a~a~~la~~Ga~V~i~d~~~~~~~e~~~~~~~~~---g~~~v~~~~~Dvt~~~~v~~~v~~   89 (261)
T PRK07831         14 LAGKVVVVTAAAGTG-IGSATARRALEEGADVVISDIHERRLGETADELAAEL---GLGRVEGVVCDVTSEAQVDALIDA   89 (261)
T ss_pred             CCCCEEEEECCCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHC---CCCEEEEEECCCCCHHHHHHHHHH
T ss_conf             699849994999647-8999999999879989998087777899999999843---877289997568999999999999


Q ss_pred             -CCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCC-CCCCHHHHHHHHHHHCCC---CCEEEEE
Q ss_conf             -23576520577226544644654788545565205-668989999999986246---9837870
Q gi|255764482|r   85 -GLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVM-LEDSFEKWIRTACAIMRS---SGQLSLI  144 (225)
Q Consensus        85 -~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~-~~~~~~~~~~~a~~lLkp---gG~~~~i  144 (225)
                       ....+..|..+.|.-..........+.......+. .........+.+.+.++.   ||.+..+
T Consensus        90 ~~~~~G~iDiLVNNAG~~~~~~~~e~~~e~w~~~~~vNl~g~~~~~~~~~p~m~~~~~gG~Iini  154 (261)
T PRK07831         90 AVERLGRLDVLVNNAGLGGQTPVVDMTDDEWSRVLDVTLTGTFRATRAALRYMRAAPHGGVIVNN  154 (261)
T ss_pred             HHHHHCCCCEEEECCCCCCCCCHHHCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCCEEEEC
T ss_conf             99982998699988866899881449999999986132151999999999999976999789845


No 467
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated
Probab=37.14  E-value=29  Score=15.01  Aligned_cols=45  Identities=20%  Similarity=0.090  Sum_probs=33.8

Q ss_pred             CEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHH
Q ss_conf             789995878438999999867998899998898999988999998
Q gi|255764482|r   13 FHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLAL   57 (225)
Q Consensus        13 ~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~   57 (225)
                      .+|.=+|+|+=+.+++......+.+|+-+|.++++++.++..+..
T Consensus         3 ~~VaViGaG~mG~giA~~~a~~G~~V~l~D~~~~~l~~a~~~i~~   47 (308)
T PRK06129          3 GSIAIVGAGLIGRAWAIVFARAGHRVRLWDADPAALAAAPAYIAG   47 (308)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHH
T ss_conf             879997778999999999985899389998988999999999999


No 468
>PRK05854 short chain dehydrogenase; Provisional
Probab=36.85  E-value=30  Score=14.98  Aligned_cols=91  Identities=18%  Similarity=0.194  Sum_probs=60.1

Q ss_pred             CCCCCCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC
Q ss_conf             899855789995878438999999867--998899998898999988999998066452225302004442353100001
Q gi|255764482|r    7 VNATGSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA   84 (225)
Q Consensus         7 ~~~~~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~   84 (225)
                      +|--.|..++=-|+-+| ++...|+..  .+++|+..-.|++-.+.|...++...   ...++.+.+.|+-+........
T Consensus         9 iPdL~GK~~vITGa~sG-IG~~~a~~La~~Ga~Vil~~R~~~k~~~a~~~i~~~~---~~~~v~~~~lDLs~l~sVr~~a   84 (314)
T PRK05854          9 VPDLSGKLAVVTGASSG-LGFGLARRLAAAGADVILPVRNRAKGEAAVAAIRTAV---PDAKLTIRALDLSSLASVAALG   84 (314)
T ss_pred             CCCCCCCEEEECCCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHC---CCCCEEEEECCCCCHHHHHHHH
T ss_conf             98999998999068829-9999999999784989999799999999999999868---9985699964631689999999


Q ss_pred             ---CCCCCCCCEEEECCCCC
Q ss_conf             ---23576520577226544
Q gi|255764482|r   85 ---GLKNNFYDHVIMNPPFN  101 (225)
Q Consensus        85 ---~~~~~~fDlii~nPPy~  101 (225)
                         .......|.++.|.--+
T Consensus        85 ~~~~~~~~~lDiLInNAGv~  104 (314)
T PRK05854         85 EQLLAEGRPIHLLINNAGVM  104 (314)
T ss_pred             HHHHHCCCCCCEEEECCCCC
T ss_conf             98753068752787267666


No 469
>KOG1201 consensus
Probab=36.01  E-value=31  Score=14.90  Aligned_cols=127  Identities=13%  Similarity=0.061  Sum_probs=69.6

Q ss_pred             CCCCEEEEECCCHHH---HHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC---
Q ss_conf             855789995878438---99999986799889999889899998899999806645222530200444235310000---
Q gi|255764482|r   10 TGSFHLADLGAGAGA---AGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL---   83 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~---~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~---   83 (225)
                      -.|+.||=-|.|.|.   +++-+|+|  ++++.-.|++++......+.++.++      +++....|+.+.......   
T Consensus        36 v~g~~vLITGgg~GlGr~ialefa~r--g~~~vl~Din~~~~~etv~~~~~~g------~~~~y~cdis~~eei~~~a~~  107 (300)
T KOG1201          36 VSGEIVLITGGGSGLGRLIALEFAKR--GAKLVLWDINKQGNEETVKEIRKIG------EAKAYTCDISDREEIYRLAKK  107 (300)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHH--CCEEEEEECCCCCHHHHHHHHHHCC------CEEEEEECCCCHHHHHHHHHH
T ss_conf             06988999689860789999999970--7848999556512399999998448------525899558988999999999


Q ss_pred             CCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCC--HHHHHHHHHHHCC-CCCEEEEE
Q ss_conf             1235765205772265446446547885455652056689--8999999998624-69837870
Q gi|255764482|r   84 AGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDS--FEKWIRTACAIMR-SSGQLSLI  144 (225)
Q Consensus        84 ~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~--~~~~~~~a~~lLk-pgG~~~~i  144 (225)
                      ....-+..|.++.|.--.........++.......+....  +...-+..-.+++ +.|.+..|
T Consensus       108 Vk~e~G~V~ILVNNAGI~~~~~ll~~~d~ei~k~~~vN~~~~f~t~kaFLP~M~~~~~GHIV~I  171 (300)
T KOG1201         108 VKKEVGDVDILVNNAGIVTGKKLLDCSDEEIQKTFDVNTIAHFWTTKAFLPKMLENNNGHIVTI  171 (300)
T ss_pred             HHHHCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             9986199549983664244887567998999999987668999999987388874579639983


No 470
>COG4627 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=35.59  E-value=31  Score=14.86  Aligned_cols=24  Identities=13%  Similarity=0.286  Sum_probs=19.5

Q ss_pred             HHHHHHHHHHCCCCCEEEEECCHH
Q ss_conf             999999998624698378702888
Q gi|255764482|r  125 EKWIRTACAIMRSSGQLSLIARPQ  148 (225)
Q Consensus       125 ~~~~~~a~~lLkpgG~~~~i~~~~  148 (225)
                      ..+++.+-+.|||||.+-+..|.-
T Consensus        66 ~~alkechr~Lrp~G~LriAvPdl   89 (185)
T COG4627          66 TSALKECHRFLRPGGKLRIAVPDL   89 (185)
T ss_pred             HHHHHHHHHHHCCCCEEEEECCCC
T ss_conf             999999999708675899974875


No 471
>KOG2098 consensus
Probab=35.16  E-value=29  Score=15.08  Aligned_cols=95  Identities=15%  Similarity=0.156  Sum_probs=43.9

Q ss_pred             HCCCCEEEEEECCHHHHHHHHH-------H-HHHHCCC---CCC---CCCEEECCCCCCCCCCCCCCCCCCCCCCEEEEC
Q ss_conf             6799889999889899998899-------9-9980664---522---253020044423531000012357652057722
Q gi|255764482|r   32 RLHEAQILLAERSPLMAHYARK-------T-LALPANA---QIS---KRISLIEVDVTLVGENRNLAGLKNNFYDHVIMN   97 (225)
Q Consensus        32 r~~~~~v~gvD~~~~~~~~A~~-------n-~~~~~~~---~~~---~~~~~~~~D~~~~~~~~~~~~~~~~~fDlii~n   97 (225)
                      ....++.+-.|++--+...|..       | ++.+...   -..   .....+++|++.+.-      .--++|.+|++.
T Consensus       323 hm~TCkYVHYe~d~~~~~~a~~~~~t~~k~~l~~~rsv~~~ss~~~l~p~QWI~CDiR~~dm------~iLGkFaVVmAD  396 (591)
T KOG2098         323 HMDTCKYVHYEIDACMDSEAPGSKDTTPKQELALTRSVGGDSSADRLFPPQWICCDIRYLDM------SILGKFAVVMAD  396 (591)
T ss_pred             HHCCCCEEEEECCCCHHHHCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCCEEEEECEEEEE------EEECEEEEEEEC
T ss_conf             00423203322014145536888899816541202344666631202786137730314201------432105799607


Q ss_pred             CCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEE
Q ss_conf             6544644654788545565205668989999999986246983787
Q gi|255764482|r   98 PPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSL  143 (225)
Q Consensus        98 PPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~  143 (225)
                      |||.-.-..+           .++...++....-...|...|.+++
T Consensus       397 PpWdIHMeLP-----------YGTm~DdEmr~L~vp~LQddGlIFL  431 (591)
T KOG2098         397 PPWDIHMELP-----------YGTMTDDEMRRLNVPVLQDDGLIFL  431 (591)
T ss_pred             CCCCCEEECC-----------CCCCCHHHHHCCCCCCCCCCCEEEE
T ss_conf             9741002267-----------6665657763389851135867999


No 472
>COG0698 RpiB Ribose 5-phosphate isomerase RpiB [Carbohydrate transport and metabolism]
Probab=34.96  E-value=32  Score=14.81  Aligned_cols=35  Identities=23%  Similarity=0.201  Sum_probs=25.0

Q ss_pred             ECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHH
Q ss_conf             587843899999986799889999889899998899
Q gi|255764482|r   18 LGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARK   53 (225)
Q Consensus        18 lGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~   53 (225)
                      +.||||.=....|-+.|+. .-++=.|+.+..++|+
T Consensus        64 liCGTGiG~~iaANKv~Gi-raAl~~D~~sA~~ar~   98 (151)
T COG0698          64 LICGTGIGMSIAANKVPGI-RAALVSDPTSAKLARE   98 (151)
T ss_pred             EEECCCHHHHHHHHCCCCE-EEEEECCHHHHHHHHH
T ss_conf             9815776277875526873-8999638788999986


No 473
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated
Probab=34.03  E-value=33  Score=14.72  Aligned_cols=46  Identities=20%  Similarity=0.246  Sum_probs=33.8

Q ss_pred             CEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHH
Q ss_conf             7899958784389999998679988999988989999889999980
Q gi|255764482|r   13 FHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALP   58 (225)
Q Consensus        13 ~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~   58 (225)
                      .+|-=+|+|+=+.+++...-..+.+|+-+|.+++.++.++..+...
T Consensus         3 ~kV~ViGaG~mG~~IA~~~a~~G~~V~l~D~~~~~~~~~~~~i~~~   48 (284)
T PRK07819          3 QRVGVVGAGQMGSGIAEVCARAGVDVLVFETTEEAATAGRNRIEKS   48 (284)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHH
T ss_conf             6799989778999999999957990899979889999999999999


No 474
>COG1255 Uncharacterized protein conserved in archaea [Function unknown]
Probab=33.44  E-value=34  Score=14.66  Aligned_cols=33  Identities=15%  Similarity=0.156  Sum_probs=23.2

Q ss_pred             CCEEEEECCCHHH-HHHHHHHHCCCCEEEEEECCHH
Q ss_conf             5789995878438-9999998679988999988989
Q gi|255764482|r   12 SFHLADLGAGAGA-AGLAVASRLHEAQILLAERSPL   46 (225)
Q Consensus        12 ~~~VLDlGcG~G~-~~l~la~r~~~~~v~gvD~~~~   46 (225)
                      .++|.|+|.|.=. .+-.|+++  +..++++|+++.
T Consensus        14 ~gkVvEVGiG~~~~VA~~L~e~--g~dv~atDI~~~   47 (129)
T COG1255          14 RGKVVEVGIGFFLDVAKRLAER--GFDVLATDINEK   47 (129)
T ss_pred             CCCEEEECCCHHHHHHHHHHHC--CCCEEEEECCCC
T ss_conf             8837998141179999999974--886899852301


No 475
>PRK06114 short chain dehydrogenase; Provisional
Probab=32.53  E-value=35  Score=14.57  Aligned_cols=86  Identities=16%  Similarity=0.093  Sum_probs=52.1

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECC-HHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---
Q ss_conf             55789995878438999999867--99889999889-8999988999998066452225302004442353100001---
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERS-PLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---   84 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~-~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---   84 (225)
                      +|+.+|=-|.+.|. +..+|+++  .+++|..+|++ +..++.+.+.++..+     .+...+++|+.+........   
T Consensus        15 ~gKvalVTGa~~GI-G~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g-----~~~~~~~~Dvt~~~~v~~~v~~~   88 (262)
T PRK06114         15 DGQVAFVTGAGSGI-GQRIAIGLAQAGADVALFDLRTDDGLAETAEHIEAAG-----RRAIQIAADVTSKSDLAAAVART   88 (262)
T ss_pred             CCCEEEEECCCCHH-HHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCC-----CCEEEEECCCCCHHHHHHHHHHH
T ss_conf             99989996847899-9999999998799899995897469999999999659-----95899981689999999999999


Q ss_pred             CCCCCCCCEEEECCCCCC
Q ss_conf             235765205772265446
Q gi|255764482|r   85 GLKNNFYDHVIMNPPFNE  102 (225)
Q Consensus        85 ~~~~~~fDlii~nPPy~~  102 (225)
                      ...-+..|..+.|.-...
T Consensus        89 ~~~~G~iDiLVNnAGi~~  106 (262)
T PRK06114         89 EAELGALTLAVNAAGIAN  106 (262)
T ss_pred             HHHCCCCCEEEECCCCCC
T ss_conf             998199989998998999


No 476
>TIGR00057 TIGR00057 Sua5/YciO/YrdC/YwlC family protein; InterPro: IPR004388   This entry includes the Sua5, YciO, YrdC and YwlC proteins. The yrdC family of genes codes for proteins that occur both independently and as a domain in proteins that have been implicated in regulation. An example for the latter case is the sua5 gene from yeast. Sua5 was identified as a suppressor of a translation initiation defect in cytochrome c and is required for normal growth in yeast . However, the function of the Sua5 protein remains unknown; Sua5 could act either at the transcriptional or the post-transcriptional levels to compensate for an aberrant translation start codon in the cyc gene. The crystal structure of the YrdC protein from Escherichia coli was determined at a resolution of 2.0 A. It structure suggests that YrdC may be a nucleic acid binding protein. An investigation of YrdC's binding affinities for single- and double-stranded RNA and DNA fragments as well as tRNAs demonstrates that YrdC binds preferentially to double-stranded RNA . .
Probab=32.49  E-value=8.3  Score=18.11  Aligned_cols=14  Identities=14%  Similarity=0.299  Sum_probs=6.4

Q ss_pred             CCCEEECCCCCCCC
Q ss_conf             25302004442353
Q gi|255764482|r   65 KRISLIEVDVTLVG   78 (225)
Q Consensus        65 ~~~~~~~~D~~~~~   78 (225)
                      ..+.+...|+....
T Consensus        59 kPl~v~v~d~~~i~   72 (215)
T TIGR00057        59 KPLIVLVSDLSEIE   72 (215)
T ss_pred             CCEEEEECCHHHHH
T ss_conf             97799973735644


No 477
>TIGR02207 lipid_A_htrB lipid A biosynthesis lauroyl (or palmitoleoyl) acyltransferase; InterPro: IPR011920   Bacterial lipopolysachharides (LPS) are glycolipids that make up the outer monolayer of the outer membranes of most Gram-negative bacteria. Though LPS moleculesare variable, they all show the same general features: an outer polysaccharide which is attached to the lipid component, termed lipid A . The polysaccharide component consists of a variable repeat-structure polysaccharide known as the O-antigen, and a highly conserved short core oligosaccharide which connects the O-antigen to lipid A. Lipid A is a glucosamine-based phospholipid that makes up the membrane anchor region of LPS . The structure of lipid A is relatively invariant between species, presumably reflecting its fundamental role in membrane integrity. Recognition of lipid A by the innate immune system can lead to a response even at picomolar levels. In some genera, such as Neisseria and Haemophilus, lipooligosaccharides (LOS) are the predominant glycolipids . These are analogous to LPS except that they lack O-antigens, with the LOS oligosaccharide structures limited to 10 saccharide units.    This entry represents a narrow clade of acyltransferases, nearly all of which transfer a lauroyl group to KDO2-lipid IV-A, a lipid A precursor; these proteins are termed lipid A biosynthesis lauroyl acyltransferase, HtrB. An exception is a closely related paralog of Escherichia coli HtrB, LpxP, which acts in cold shock conditions by transferring a palmitoleoyl rather than lauroyl group to the lipid A precursor. Members of this family are homologous to the family of acyltransferases responsible for the next step in lipid A biosynthesis .; GO: 0016747 transferase activity transferring groups other than amino-acyl groups, 0009276 1-2nm peptidoglycan-based cell wall, 0016021 integral to membrane.
Probab=32.05  E-value=29  Score=15.07  Aligned_cols=30  Identities=7%  Similarity=-0.059  Sum_probs=20.8

Q ss_pred             HHHCCCC--CCHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             6520566--89899999999862469837870
Q gi|255764482|r  115 EAHVMLE--DSFEKWIRTACAIMRSSGQLSLI  144 (225)
Q Consensus       115 ~a~~~~~--~~~~~~~~~a~~lLkpgG~~~~i  144 (225)
                      ..|+...  ....+=++.+.+.||.|..+++.
T Consensus       167 R~RsN~~slmidR~Dlr~m~~~Lk~Ge~~WYA  198 (308)
T TIGR02207       167 RLRSNKKSLMIDRKDLRGMIKALKNGERIWYA  198 (308)
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHHCCCCEEEEC
T ss_conf             11007720012542358999860489727855


No 478
>PRK06182 short chain dehydrogenase; Validated
Probab=31.34  E-value=37  Score=14.46  Aligned_cols=121  Identities=17%  Similarity=0.084  Sum_probs=62.8

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC---CC
Q ss_conf             55789995878438999999867--99889999889899998899999806645222530200444235310000---12
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL---AG   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~---~~   85 (225)
                      ++..+|=-||++|. +..+|.++  .+++|++...+.+.++....           ..+..+..|+.+.......   ..
T Consensus         2 k~Kv~lITGassGI-G~a~a~~la~~G~~V~~~~r~~~~l~~l~~-----------~~~~~~~~Dvt~~~~v~~~~~~i~   69 (273)
T PRK06182          2 KKKVALVTGASSGI-GKATARKLIAEGFTVYGAARRVDKMEDLAS-----------LGIHPLALDVTDEASMKAAVATIL   69 (273)
T ss_pred             CCCEEEEECCCHHH-HHHHHHHHHHCCCEEEEEECCHHHHHHHHH-----------CCCEEEEEECCCHHHHHHHHHHHH
T ss_conf             46989990632099-999999999879989999798999999996-----------799799985899999999999999


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCH--HHHHHHHHHHCCC--CCEEEEE
Q ss_conf             357652057722654464465478854556520566898--9999999986246--9837870
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSF--EKWIRTACAIMRS--SGQLSLI  144 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~--~~~~~~a~~lLkp--gG~~~~i  144 (225)
                      ...+..|.++.|--+...+.....+... ..+....+..  ....+.+...++.  +|++..+
T Consensus        70 ~~~g~iDiLVNNAG~~~~~~~~~~~~~~-~~~~~~vN~~g~~~~~~~~lp~m~~~~~G~Ivni  131 (273)
T PRK06182         70 AEEGRIDVLVNNAGYGSYGAIEDVPIDE-ARAQFEVNLFGAARLTQLVLPHMRAQRSGRIINI  131 (273)
T ss_pred             HHHCCCCEEEECCCCCCCCCHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEE
T ss_conf             9839988775058677787488731999-9999998869999999985334214899589998


No 479
>PRK07588 hypothetical protein; Provisional
Probab=30.96  E-value=37  Score=14.42  Aligned_cols=33  Identities=33%  Similarity=0.295  Sum_probs=25.7

Q ss_pred             EEEEECCCHHHHHHHHHHHCCCCEEEEEECCHH
Q ss_conf             899958784389999998679988999988989
Q gi|255764482|r   14 HLADLGAGAGAAGLAVASRLHEAQILLAERSPL   46 (225)
Q Consensus        14 ~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~   46 (225)
                      ||+=+|+|.++++++++-+..+.+++=+|..+.
T Consensus         2 kVlIvGaGiaGLalA~~L~r~G~~v~V~Er~~~   34 (391)
T PRK07588          2 KIAISGAGIAGATLAHWLQRTGHEPTLIERAPK   34 (391)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCEEEEECCCC
T ss_conf             799999328999999999868999899903898


No 480
>PRK06179 short chain dehydrogenase; Provisional
Probab=30.55  E-value=38  Score=14.38  Aligned_cols=119  Identities=19%  Similarity=0.158  Sum_probs=63.3

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC---CC
Q ss_conf             55789995878438999999867--99889999889899998899999806645222530200444235310000---12
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL---AG   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~---~~   85 (225)
                      .+..+|=-||++| ++.++|+++  .+++|++++.+....+.             ...+.++..|+.+.......   ..
T Consensus         3 ~~KvalITGassG-IG~a~A~~la~~G~~V~~~~r~~~~~~~-------------~~~~~~~~~Dvtd~~~v~~~~~~~~   68 (270)
T PRK06179          3 NKKVALVTGASSG-IGRATAEALARAGYRVFGTSRNPARATP-------------IPGVELLELDVTDDASVQAAVQEVI   68 (270)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHC-------------CCCCEEEEEECCCHHHHHHHHHHHH
T ss_conf             9958999072469-9999999999879999999689777305-------------4897899910799999999999999


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCH--HHHHHHHHHHCCC--CCEEEEE
Q ss_conf             357652057722654464465478854556520566898--9999999986246--9837870
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSF--EKWIRTACAIMRS--SGQLSLI  144 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~--~~~~~~a~~lLkp--gG~~~~i  144 (225)
                      ...+..|..+.|--....+.....+... ..+....+..  ....+.+...++.  +|++..+
T Consensus        69 ~~~g~iDiLVNNAGi~~~~~~~~~~~~~-~~~~~~vN~~g~~~~~~~~lp~m~~~~~G~Ivni  130 (270)
T PRK06179         69 ARAGRIDVLVNNAGVGLLGAAEETSIAQ-AQALFDTNVFGILRMTNAVLPHMRAQGSGRIINI  130 (270)
T ss_pred             HHHCCCCEEEECCCCCCCCCHHHCCHHH-HHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEE
T ss_conf             9839988899898666788757598999-9999887448999999874202201799589998


No 481
>pfam05575 V_cholerae_RfbT Vibrio cholerae RfbT protein. This family consists of several RfbT proteins from Vibrio cholerae. It has been found that genetic alteration of the rfbT gene is responsible for serotype conversion of Vibrio cholerae O1 and determines the difference between the Ogawa and Inaba serotypes, in that the presence of rfbT is sufficient for Inaba-to-Ogawa serotype conversion.
Probab=29.80  E-value=30  Score=14.99  Aligned_cols=49  Identities=20%  Similarity=0.231  Sum_probs=39.2

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHH
Q ss_conf             8557899958784389999998679988999988989999889999980
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALP   58 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~   58 (225)
                      +....-.|+|+..|.+.=..|+.....+++++|--.+|-+-.|.|+.++
T Consensus        78 khdttyidiganvgtfcgiaarhitqgkiiaiepltemensirmnvqln  126 (286)
T pfam05575        78 KHDTTYIDIGANVGTFCGIAARHITQGKIIAIEPLTEMENSIRMNVQLN  126 (286)
T ss_pred             CCCCEEEEECCCCCCCHHHHHHHCCCCCEEEEECHHHHHHHEEEEEEEC
T ss_conf             5776389706662121105556404672699830055420236645607


No 482
>KOG2356 consensus
Probab=29.58  E-value=25  Score=15.43  Aligned_cols=73  Identities=10%  Similarity=0.107  Sum_probs=35.1

Q ss_pred             CCCEEECCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHH-HHHHHCCCCCEEEE
Q ss_conf             25302004442353100001235765205772265446446547885455652056689899999-99986246983787
Q gi|255764482|r   65 KRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIR-TACAIMRSSGQLSL  143 (225)
Q Consensus        65 ~~~~~~~~D~~~~~~~~~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~-~a~~lLkpgG~~~~  143 (225)
                      .+-.|..+|+......   .......+|+|+..|||+.......       .++-.....-.... -...++.|.|.+++
T Consensus       162 pkSsF~~gDv~~~~ql---l~~H~llpdlIIiDPPW~NKSVkRs-------~~Ysmlsnl~ql~~IPI~kl~~p~~lvA~  231 (366)
T KOG2356         162 PKSSFHVGDVKDIEQL---LRAHDLLPDLIIIDPPWFNKSVKRS-------RTYSMLSNLLQLLDIPIIKLHDPLCLVAF  231 (366)
T ss_pred             CCCCEECCCHHHHHHH---HHHHHHCCCEEEECCCCCCCCCCCC-------CCEECCCCHHHHHCCCCHHHCCCCCEEEE
T ss_conf             8550211537778887---5777636876996799877432412-------24000252466640870443387705999


Q ss_pred             ECCH
Q ss_conf             0288
Q gi|255764482|r  144 IARP  147 (225)
Q Consensus       144 i~~~  147 (225)
                      =+..
T Consensus       232 WcTN  235 (366)
T KOG2356         232 WCTN  235 (366)
T ss_pred             EECC
T ss_conf             9718


No 483
>PRK05599 hypothetical protein; Provisional
Probab=29.00  E-value=41  Score=14.23  Aligned_cols=83  Identities=18%  Similarity=0.180  Sum_probs=52.1

Q ss_pred             EEEEECCCHHHHHHHHHHHC-CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---CCCCC
Q ss_conf             89995878438999999867-998899998898999988999998066452225302004442353100001---23576
Q gi|255764482|r   14 HLADLGAGAGAAGLAVASRL-HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---GLKNN   89 (225)
Q Consensus        14 ~VLDlGcG~G~~~l~la~r~-~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---~~~~~   89 (225)
                      .||=.|+.+|. +..+|.++ .+.+++.+..+++.++...+.++..+.    ..+.....|+.+........   ....+
T Consensus         2 tvlITGASsGI-G~a~A~~lA~G~~vvl~~R~~e~l~~l~~~l~~~g~----~~v~~~~~Dvtd~~~~~~~v~~~~~~~g   76 (246)
T PRK05599          2 SILILGGTSDI-AGEIATLLAHGEDVVLAARRPEAAGGLAEDLRQLGA----TSVHVLSFDATDLDSHRELVKQTQELAG   76 (246)
T ss_pred             EEEEECCCHHH-HHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHCC----CEEEEEECCCCCHHHHHHHHHHHHHHCC
T ss_conf             89998886899-999999998599499999999999999999986259----7189972899999999999999998619


Q ss_pred             CCCEEEECCCCC
Q ss_conf             520577226544
Q gi|255764482|r   90 FYDHVIMNPPFN  101 (225)
Q Consensus        90 ~fDlii~nPPy~  101 (225)
                      ..|.++.|--..
T Consensus        77 ~id~lv~naGi~   88 (246)
T PRK05599         77 EISLAVVAFGIL   88 (246)
T ss_pred             CCEEEEECCCCC
T ss_conf             843999877667


No 484
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional
Probab=28.96  E-value=41  Score=14.22  Aligned_cols=128  Identities=13%  Similarity=0.061  Sum_probs=64.0

Q ss_pred             CCCCEEEEECC-CHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC---
Q ss_conf             85578999587-8438999999867--99889999889899998899999806645222530200444235310000---
Q gi|255764482|r   10 TGSFHLADLGA-GAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL---   83 (225)
Q Consensus        10 ~~~~~VLDlGc-G~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~---   83 (225)
                      -+|+++|=-|. |+..+...+|+.+  .+++|.-.++++...+.+.+-....+.      ...+.+|+.+......+   
T Consensus         4 L~GK~~lVTG~a~~~GIG~aiA~~la~~Ga~V~~~~~~~~~~~~~~~~~~~~g~------~~~~~~Dv~~~~~v~~~v~~   77 (260)
T PRK06997          4 LAGKRILLTGLLSNRSIAYGIAKACKREGAELAFTYVGDRFKDRITEFAAEFGS------DLVFPCDVADDAQIDALFAS   77 (260)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHCCC------CEEEECCCCCHHHHHHHHHH
T ss_conf             999889998998872899999999998599999980880669999999986298------47998379999999999999


Q ss_pred             CCCCCCCCCEEEECCCCCCCCCCCC------CCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEE
Q ss_conf             1235765205772265446446547------88545565205668989999999986246983787
Q gi|255764482|r   84 AGLKNNFYDHVIMNPPFNERIGTMT------PDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSL  143 (225)
Q Consensus        84 ~~~~~~~fDlii~nPPy~~~~~~~~------~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~  143 (225)
                      .....+..|.++.|--+.+......      ...............+....+.+..+++++|....
T Consensus        78 ~~~~~g~iD~LVnNAG~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~k~~~~~~~~~g~iv~  143 (260)
T PRK06997         78 LGTRWDGLDGLVHSIGFAPREAIAGDFLDGLTRENFRIAHDISAYSFPALAKAALPMLSDDASLLT  143 (260)
T ss_pred             HHHHHCCCCEEEECCCCCCCCCCCCCHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             999849989896447767732235334665589999999998889999999999876316776323


No 485
>pfam08659 KR KR domain. This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain. It uses NADPH to reduce the keto group to a hydroxy group.
Probab=28.52  E-value=41  Score=14.18  Aligned_cols=87  Identities=21%  Similarity=0.139  Sum_probs=48.7

Q ss_pred             EEEEECCCHHHHHHHHHHHCC--CC-EEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCC---CC
Q ss_conf             899958784389999998679--98-8999988989999889999980664522253020044423531000012---35
Q gi|255764482|r   14 HLADLGAGAGAAGLAVASRLH--EA-QILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAG---LK   87 (225)
Q Consensus        14 ~VLDlGcG~G~~~l~la~r~~--~~-~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~---~~   87 (225)
                      .||=-|+..| ++..+|+++-  ++ .++-+..++...+.+++.+....  ....++.....|+.+.........   ..
T Consensus         2 tvlITGas~G-IG~aia~~la~~Ga~~vvl~~r~~~~~~~~~~~~~~l~--~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~   78 (181)
T pfam08659         2 TYLVTGGLGG-LGLELARWLAERGARHLVLLSRSGAPDPEAEALLAELE--ARGAEVTVVACDVSDRDAVAALLAEIRAD   78 (181)
T ss_pred             EEEEECCCCH-HHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHHH--HCCCEEEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             8999687878-99999999998799789998689766299999999999--65996999975689999999888657987


Q ss_pred             CCCCCEEEECCCCCCC
Q ss_conf             7652057722654464
Q gi|255764482|r   88 NNFYDHVIMNPPFNER  103 (225)
Q Consensus        88 ~~~fDlii~nPPy~~~  103 (225)
                      .+..|.++.|......
T Consensus        79 ~g~id~lvnnAG~~~~   94 (181)
T pfam08659        79 GPPLRGVIHAAGVLRD   94 (181)
T ss_pred             CCCEEEEEEECCCCCC
T ss_conf             3984899954466788


No 486
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=27.59  E-value=43  Score=14.08  Aligned_cols=74  Identities=11%  Similarity=0.084  Sum_probs=38.1

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             55789995878438999999867998899998898999988999998066452225302004442353100001235765
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNF   90 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~   90 (225)
                      +|.+|+=+|-|--+.+.+-.-...+.+|++.|.++..-..+...-       ....+.+..+....         .....
T Consensus         4 ~~k~v~viGlG~sG~s~a~~L~~~G~~v~~~D~~~~~~~~~~~~~-------~~~~i~~~~g~~~~---------~~~~~   67 (445)
T PRK04308          4 QNKKILVAGLGGTGISMIAYLRKNGAEVAAYDAELKAERVAQIGK-------MFDGLVFYTGRLKD---------ALDNG   67 (445)
T ss_pred             CCCEEEEEEECHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHH-------CCCCCEEEECCCHH---------HHCCC
T ss_conf             999899999899999999999978991999979999531899974-------36996899378636---------50159


Q ss_pred             CCEEEECCCC
Q ss_conf             2057722654
Q gi|255764482|r   91 YDHVIMNPPF  100 (225)
Q Consensus        91 fDlii~nPPy  100 (225)
                      +|+|+..|-.
T Consensus        68 ~d~vV~SPgI   77 (445)
T PRK04308         68 FDILALSPGI   77 (445)
T ss_pred             CCEEEECCCC
T ss_conf             9999989953


No 487
>pfam00106 adh_short short chain dehydrogenase. This family contains a wide variety of dehydrogenases.
Probab=27.22  E-value=44  Score=14.04  Aligned_cols=83  Identities=22%  Similarity=0.185  Sum_probs=43.5

Q ss_pred             EEEEECCCHHHHHHHHHHHC--CCCE-EEEEECCH--HHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---C
Q ss_conf             89995878438999999867--9988-99998898--999988999998066452225302004442353100001---2
Q gi|255764482|r   14 HLADLGAGAGAAGLAVASRL--HEAQ-ILLAERSP--LMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---G   85 (225)
Q Consensus        14 ~VLDlGcG~G~~~l~la~r~--~~~~-v~gvD~~~--~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---~   85 (225)
                      .+|=-|++.| ++..+|+++  .++. ++....++  +.++.....+..     ...++.+...|+.+........   .
T Consensus         2 T~lITGas~G-IG~aia~~la~~Ga~~vv~~~r~~~~~~~~~~~~~~~~-----~g~~~~~~~~Dv~~~~~v~~~~~~~~   75 (167)
T pfam00106         2 TVLITGGTGG-LGLALARWLAAEGARHLVLVSRRGDAPGAAELVAELEA-----LGAEVTVAACDVADRDALAALLAALP   75 (167)
T ss_pred             EEEEECCCCH-HHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHH-----CCCEEEEEECCCCCHHHHHHHHHHHH
T ss_conf             8999897878-99999999998799489996599676899999999995-----59859999846999999999999999


Q ss_pred             CCCCCCCEEEECCCCCC
Q ss_conf             35765205772265446
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNE  102 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~  102 (225)
                      ...+..|.++.|.-...
T Consensus        76 ~~~g~iD~linnAG~~~   92 (167)
T pfam00106        76 AALGPLDGVVHNAGVLD   92 (167)
T ss_pred             HHCCCCCEEEECCCCCC
T ss_conf             97599739998871268


No 488
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional
Probab=26.79  E-value=45  Score=14.00  Aligned_cols=87  Identities=15%  Similarity=0.116  Sum_probs=53.0

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC---C
Q ss_conf             55789995878438999999867--998899998898999988999998066452225302004442353100001---2
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA---G   85 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~---~   85 (225)
                      +|..+|=-|++.| ++..+|.++  .+++|+.++.++..  ...+.++.     ...++.++.+|+.+........   .
T Consensus         7 ~gKvalVTGas~G-IG~aia~~la~~Ga~Vv~~~~~~~~--~~~~~~~~-----~g~~~~~~~~Dv~~~~~~~~~~~~~~   78 (251)
T PRK12481          7 NGKVAIITGCNTG-LGQGMAIGLAKAGADIVGVGVAEAP--ETQAQVEA-----LGRKFHFITADLIQQKDIDSIVSQAV   78 (251)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEECCCCHH--HHHHHHHH-----CCCCEEEEEECCCCHHHHHHHHHHHH
T ss_conf             9998999486768-9999999999869999997898719--99999997-----59947999912799999999999999


Q ss_pred             CCCCCCCEEEECCCCCCCCC
Q ss_conf             35765205772265446446
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIG  105 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~  105 (225)
                      ..-+..|..+.|.-......
T Consensus        79 ~~~g~iDilVNNAG~~~~~~   98 (251)
T PRK12481         79 EVMGHIDILINNAGIIRRQD   98 (251)
T ss_pred             HHCCCCCEEEECCCCCCCCC
T ss_conf             98199989998998999999


No 489
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional
Probab=26.54  E-value=45  Score=13.97  Aligned_cols=68  Identities=18%  Similarity=0.112  Sum_probs=37.2

Q ss_pred             EEEEECCCHHHHHHHHHHH---CCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             8999587843899999986---7998899998898999988999998066452225302004442353100001235765
Q gi|255764482|r   14 HLADLGAGAGAAGLAVASR---LHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNF   90 (225)
Q Consensus        14 ~VLDlGcG~G~~~l~la~r---~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~   90 (225)
                      +||=.| |+|.++-.|+.+   ..+.+|+++|.+........          ...+++++++|+......   .......
T Consensus         3 kILVTG-gaGFIGs~Lv~~Ll~~~~~~V~~~d~~~~~~~~~~----------~~~~~~~~~gDi~~~~~~---~~~~~~~   68 (347)
T PRK11908          3 KVLILG-VNGFIGHHLTKRILETTDWEVYGMDMQTDRLGDLV----------NHPRMHFFEGDITINKEW---IEYHVKK   68 (347)
T ss_pred             EEEEEC-CCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHC----------CCCCEEEEECCCCCCHHH---HHHHHCC
T ss_conf             899975-74389999999999828978999979976367755----------799859997754469999---9976605


Q ss_pred             CCEEE
Q ss_conf             20577
Q gi|255764482|r   91 YDHVI   95 (225)
Q Consensus        91 fDlii   95 (225)
                      +|.|+
T Consensus        69 ~D~V~   73 (347)
T PRK11908         69 CDVVL   73 (347)
T ss_pred             CCEEE
T ss_conf             98897


No 490
>PRK07660 consensus
Probab=26.18  E-value=46  Score=13.93  Aligned_cols=45  Identities=11%  Similarity=0.145  Sum_probs=33.5

Q ss_pred             CEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHH
Q ss_conf             789995878438999999867998899998898999988999998
Q gi|255764482|r   13 FHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLAL   57 (225)
Q Consensus        13 ~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~   57 (225)
                      .+|.=+|+|+=+.+++...-..+.+|+-+|.+++.++.++.++..
T Consensus         4 k~VaViGaG~MG~gIA~~~a~~G~~V~l~D~~~~~l~~~~~~i~~   48 (283)
T PRK07660          4 QKIVVIGAGQMGSGIAQVCAMAGYDVKVQDLKQEQLDRGLAIITK   48 (283)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHH
T ss_conf             889998969899999999996698189997988999999999999


No 491
>PRK07578 short chain dehydrogenase; Provisional
Probab=25.77  E-value=47  Score=13.89  Aligned_cols=106  Identities=18%  Similarity=0.134  Sum_probs=55.3

Q ss_pred             EEEEECCCHHHHHHHHHHHCC-CCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             899958784389999998679-9889999889899998899999806645222530200444235310000123576520
Q gi|255764482|r   14 HLADLGAGAGAAGLAVASRLH-EAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFYD   92 (225)
Q Consensus        14 ~VLDlGcG~G~~~l~la~r~~-~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~fD   92 (225)
                      |||=.|...| ++.++|+++. +.+++.+..+...                      ++.|+.+......+.. ..+.+|
T Consensus         2 rVlVTGas~G-IG~aia~~la~~~~vv~~~r~~~~----------------------~~~Dvtd~~~v~~~~~-~~G~iD   57 (199)
T PRK07578          2 KILVIGASGT-IGRAVVAELSARHEVITAGRSSGD----------------------VQVDITDPASIRALFE-KVGKVD   57 (199)
T ss_pred             EEEEECCCCH-HHHHHHHHHHCCCCEEEEECCCCC----------------------EEEECCCHHHHHHHHH-HHCCCC
T ss_conf             7999998748-999999999679998998368677----------------------5685889999999999-629998


Q ss_pred             EEEECCCCCCCCCCCCCCHHHHHHHCCCCCC--HHHHHHHHHHHCCCCCEEEEE
Q ss_conf             5772265446446547885455652056689--899999999862469837870
Q gi|255764482|r   93 HVIMNPPFNERIGTMTPDKIKEEAHVMLEDS--FEKWIRTACAIMRSSGQLSLI  144 (225)
Q Consensus        93 lii~nPPy~~~~~~~~~~~~~~~a~~~~~~~--~~~~~~~a~~lLkpgG~~~~i  144 (225)
                      .++.|.-....+.....+....... ...+.  ....++.+..+++.+|.+.++
T Consensus        58 ~lVnnAG~~~~~~~~~~~~e~~~~~-~~~nl~g~~~l~~~~~~~l~~gGsIv~i  110 (199)
T PRK07578         58 AVVSAAGKVHFAPLTEMTDEDFQLG-LQSKLMGQINLVLIGQEYLNDGGSFTLT  110 (199)
T ss_pred             EEEECCCCCCCCCHHHCCHHHHHHH-HHHHHHHHHHHHHHHHHHHHCCCCCEEE
T ss_conf             9998872267989487999897778-7200138999999999987608985688


No 492
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional
Probab=25.70  E-value=47  Score=13.88  Aligned_cols=128  Identities=15%  Similarity=0.122  Sum_probs=61.8

Q ss_pred             CCCCEEEEECC-CHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC--
Q ss_conf             85578999587-8438999999867--998899998898999988999998066452225302004442353100001--
Q gi|255764482|r   10 TGSFHLADLGA-GAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA--   84 (225)
Q Consensus        10 ~~~~~VLDlGc-G~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~--   84 (225)
                      -+|+++|=-|+ |...+...+|+.+  .+++|+-.+.+...+..  +-.+.     .......++.|+.+........  
T Consensus         5 L~GK~~lVTG~~~~~GIG~a~A~~la~~GA~Vvi~~~~~~~~~~--~~~~~-----~~~~~~~i~~Dv~~~~~v~~~~~~   77 (256)
T PRK07889          5 LEGKRILVTGVITDSSIAFHIARVAQEQGAEVVLTGFRRLRLTE--RIAKR-----LPEPAPVLELDVTNEEHLASLADR   77 (256)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHHCCCEEEEEECCCHHHHH--HHHHH-----CCCCCEEEEEECCCHHHHHHHHHH
T ss_conf             49997999899885689999999999879999998389358999--99986-----588875999428899999999999


Q ss_pred             -CCCCCCCCEEEECCCCCCCCCC---CCCCHHHHHH-HCCCCC--CHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             -2357652057722654464465---4788545565-205668--9899999999862469837870
Q gi|255764482|r   85 -GLKNNFYDHVIMNPPFNERIGT---MTPDKIKEEA-HVMLED--SFEKWIRTACAIMRSSGQLSLI  144 (225)
Q Consensus        85 -~~~~~~fDlii~nPPy~~~~~~---~~~~~~~~~a-~~~~~~--~~~~~~~~a~~lLkpgG~~~~i  144 (225)
                       ....+..|.++.|--+......   ...+...... .....+  ......+.+..+++++|....+
T Consensus        78 ~~~~~G~lD~lVnnag~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gg~Iv~~  144 (256)
T PRK07889         78 VREHIGGLDGVVHSIGFAPQTALGGNPFLDAPWEDVATALHISAYSLASLAKALLPLMNPGGSIVGL  144 (256)
T ss_pred             HHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             9998689787974213477443467652003588888899899999999999976542168874674


No 493
>PRK08268 3-hydroxybutyryl-CoA dehydrogenase; Validated
Probab=25.70  E-value=47  Score=13.88  Aligned_cols=46  Identities=30%  Similarity=0.304  Sum_probs=35.3

Q ss_pred             CEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHH
Q ss_conf             7899958784389999998679988999988989999889999980
Q gi|255764482|r   13 FHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALP   58 (225)
Q Consensus        13 ~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~   58 (225)
                      .+|.=+|+|+=+.+++......+..|+-+|++++.++.++.+++.+
T Consensus         4 ~~VaViGaGtMG~gIA~~~a~aG~~V~l~D~~~~~l~~a~~~i~~~   49 (503)
T PRK08268          4 ATVAVIGAGAMGAGIAQVAAQAGHTVLLYDARAGAAAAARDGIAAT   49 (503)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHH
T ss_conf             7899979688999999999938990899979989999999999999


No 494
>COG4301 Uncharacterized conserved protein [Function unknown]
Probab=25.36  E-value=47  Score=13.84  Aligned_cols=120  Identities=13%  Similarity=0.060  Sum_probs=60.1

Q ss_pred             CCCCCCEEEEECCCHHHHHHHH----HHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC
Q ss_conf             9985578999587843899999----986799889999889899998899999806645222530200444235310000
Q gi|255764482|r    8 NATGSFHLADLGAGAGAAGLAV----ASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL   83 (225)
Q Consensus         8 ~~~~~~~VLDlGcG~G~~~l~l----a~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~   83 (225)
                      ...-+....|+|+|+-.-+-.+    +++..-.+.+.||++...+.-.-+-+...   ...-.+.-+.+|......    
T Consensus        75 ~~~g~~~lveLGsGns~Ktr~Llda~~~~~~~~ryvpiDv~a~iL~~ta~ai~~~---y~~l~v~~l~~~~~~~La----  147 (321)
T COG4301          75 SITGACTLVELGSGNSTKTRILLDALAHRGSLLRYVPIDVSASILRATATAILRE---YPGLEVNALCGDYELALA----  147 (321)
T ss_pred             HHHCCCEEEEECCCCCHHHHHHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHHH---CCCCEEEEHHHHHHHHHH----
T ss_conf             7608654897168962889999997521377403554022289999899999986---799767631256888875----


Q ss_pred             CCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEE----ECCHHHH
Q ss_conf             123576520577226544644654788545565205668989999999986246983787----0288889
Q gi|255764482|r   84 AGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSL----IARPQSL  150 (225)
Q Consensus        84 ~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~----i~~~~~l  150 (225)
                       ..+.+.-.+++     |.++..-+..+          ..-..|+......+.||-.+.+    +.+++++
T Consensus       148 -~~~~~~~Rl~~-----flGStlGN~tp----------~e~~~Fl~~l~~a~~pGd~~LlGvDl~k~Ae~L  202 (321)
T COG4301         148 -ELPRGGRRLFV-----FLGSTLGNLTP----------GECAVFLTQLRGALRPGDYFLLGVDLRKPAERL  202 (321)
T ss_pred             -CCCCCCEEEEE-----EECCCCCCCCH----------HHHHHHHHHHHHCCCCCCEEEEECCCCCHHHHH
T ss_conf             -15688728999-----83653368886----------789999999984289766699812126878887


No 495
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated
Probab=24.93  E-value=48  Score=13.80  Aligned_cols=45  Identities=22%  Similarity=0.200  Sum_probs=32.8

Q ss_pred             CEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHH
Q ss_conf             789995878438999999867998899998898999988999998
Q gi|255764482|r   13 FHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLAL   57 (225)
Q Consensus        13 ~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~   57 (225)
                      .+|.=+|+|+=+.+++......+.+|+-+|.+++.++.++..+..
T Consensus         5 k~VaViGAG~MG~giA~~~a~~G~~V~l~D~~~e~~~~~~~~i~~   49 (292)
T PRK07530          5 KKVGVIGAGQMGNGIAHVCALAGYDVLLNDVSADRLESGMATING   49 (292)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHH
T ss_conf             889998966999999999996799689997988999999999999


No 496
>pfam07101 DUF1363 Protein of unknown function (DUF1363). This family consists of several Trypanosoma brucei putative variant specific antigen proteins of around 80 residues in length.
Probab=24.80  E-value=22  Score=15.73  Aligned_cols=32  Identities=19%  Similarity=0.266  Sum_probs=18.7

Q ss_pred             EEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHH
Q ss_conf             9995878438999999867--99889999889899
Q gi|255764482|r   15 LADLGAGAGAAGLAVASRL--HEAQILLAERSPLM   47 (225)
Q Consensus        15 VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~   47 (225)
                      -+|+|||.|.. +..+.|.  +....+-+-++-+.
T Consensus         6 nidigcg~gnt-~~a~frsct~h~s~yy~s~nhdl   39 (124)
T pfam07101         6 NIDIGCGAGNT-MDATFRSCTPHESFYYLSINHDL   39 (124)
T ss_pred             CCCCCCCCCCH-HHHHHHCCCCCCCEEEEEECCCH
T ss_conf             63334588850-45565346766316898634532


No 497
>COG3510 CmcI Cephalosporin hydroxylase [Defense mechanisms]
Probab=24.64  E-value=49  Score=13.77  Aligned_cols=63  Identities=16%  Similarity=0.093  Sum_probs=40.8

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHH---C-CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCC
Q ss_conf             85578999587843899999986---7-998899998898999988999998066452225302004442353100
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASR---L-HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENR   81 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r---~-~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~   81 (225)
                      .+...|.|.|+--|+.++.-|..   . ...+|.++|||-..++.+-..         ..++.+++++-.+.....
T Consensus        68 ~~P~lvIE~Gs~~GGSal~fA~~m~s~Gq~~kvl~vdIdi~~~~p~a~e---------~p~i~f~egss~dpai~e  134 (237)
T COG3510          68 LQPSLVIEFGSRHGGSALFFANMMISIGQPFKVLGVDIDIKPLDPAARE---------VPDILFIEGSSTDPAIAE  134 (237)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHCCCCCEEEEEECCCCCCCHHHHC---------CCCEEEEECCCCCHHHHH
T ss_conf             2975067642325740112067698649973289974566758865631---------797389837988878999


No 498
>TIGR01082 murC UDP-N-acetylmuramate--alanine ligase; InterPro: IPR005758   The bacterial cell wall provides strength and rigidity to counteract internal osmotic pressure, and protection against the environment. The peptidoglycan layer gives the cell wall its strength, and helps maintain the overall shape of the cell. The basic peptidoglycan structure of both Gram-positive and Gram-negative bacteria is comprised of a sheet of glycan chains connected by short cross-linking polypeptides. Biosynthesis of peptidoglycan is a multi-step (11-12 steps) process comprising three main stages:    (1) formation of UDP-N-acetylmuramic acid (UDPMurNAc) from N-acetylglucosamine (GlcNAc). (2) addition of a short polypeptide chain to the UDPMurNAc. (3) addition of a second GlcNAc to the disaccharide-pentapeptide building block and transport of this unit through the cytoplasmic membrane and incorporation into the growing peptidoglycan layer.    Stage two involves four key Mur ligase enzymes: MurC (6.3.2.8 from EC) , MurD (6.3.2.9 from EC) , MurE (6.3.2.13 from EC)  and MurF (6.3.2.10 from EC) . These four Mur ligases are responsible for the successive additions of L-alanine, D-glutamate, meso-diaminopimelate or L-lysine, and D-alanyl-D-alanine to UDP-N-acetylmuramic acid. All four Mur ligases are topologically similar to one another, even though they display low sequence identity. They are each composed of three domains: an N-terminal Rossmann-fold domain responsible for binding the UDPMurNAc substrate; a central domain (similar to ATP-binding domains of several ATPases and GTPases); and a C-terminal domain (similar to dihydrofolate reductase fold) that appears to be associated with binding the incoming amino acid. The conserved sequence motifs found in the four Mur enzymes also map to other members of the Mur ligase family, including folylpolyglutamate synthetase, cyanophycin synthetase and the capB enzyme from Bacillales .    This entry represents UDP-N-acetylmuramate-alanine ligase (MurC). MurC is an essential, cytoplasmic peptidoglycan biosynthetic enzyme, catalyzes the ATP-dependent ligation of L-alanine (Ala) and UDP-N-acetylmuramic acid (UNAM) to form UDP-N-acetylmuramyl-L-alanine (UNAM-Ala). The enzyme is a nonribosomal peptide ligase which utilises ATP to form an amide bond between L-alanine and UNAM.1 Mechanistic studies on the Escherichia coli MurC enzyme using oxygen isotope analyses demonstrated that the enzyme-catalyzed reaction proceeds through an acyl phosphate UNAM intermediate prior to L-alanine addition.; GO: 0005524 ATP binding, 0008763 UDP-N-acetylmuramate-L-alanine ligase activity, 0008360 regulation of cell shape, 0009252 peptidoglycan biosynthetic process, 0009273 peptidoglycan-based cell wall biogenesis, 0051301 cell division, 0005737 cytoplasm.
Probab=24.35  E-value=50  Score=13.73  Aligned_cols=158  Identities=11%  Similarity=0.102  Sum_probs=74.5

Q ss_pred             CCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCC-CCCCCCCCCCCCCCCEEEEC
Q ss_conf             87843899999986799889999889899998899999806645222530200444235-31000012357652057722
Q gi|255764482|r   19 GAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLV-GENRNLAGLKNNFYDHVIMN   97 (225)
Q Consensus        19 GcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~-~~~~~~~~~~~~~fDlii~n   97 (225)
                      |.|-.+++..|..+  |.+|.|.|+.+.....  +.++..+.       .+     ... -....+...+.++.|+|+..
T Consensus         9 G~GMSglA~~L~~~--G~~VsGSD~~~~~y~t--~~L~~~Gi-------~I-----~~g~h~~~n~~~~p~g~~~vVv~S   72 (491)
T TIGR01082         9 GIGMSGLAEILLNR--GYKVSGSDIAENAYTT--KRLEALGI-------KI-----YIGEHSAENLDDLPTGAADVVVVS   72 (491)
T ss_pred             HHCHHHHHHHHHHC--CCCEEEEECCCCCCHH--HHHHHCCC-------EE-----CCCCCCHHHHCCCCCCCCCEEEEE
T ss_conf             20344899999857--8908772033563158--99986787-------66-----279967798203678974379986


Q ss_pred             CCCCCCCCCCCCCHHHHHHHCCCCC--CHHHHHHHHHHHCCCC-CEEEEE--C----CHHHHHHHHHHHHCCCCCEEEE-
Q ss_conf             6544644654788545565205668--9899999999862469-837870--2----8888999999852178846999-
Q gi|255764482|r   98 PPFNERIGTMTPDKIKEEAHVMLED--SFEKWIRTACAIMRSS-GQLSLI--A----RPQSLIQIVNACARRIGSLEIT-  167 (225)
Q Consensus        98 PPy~~~~~~~~~~~~~~~a~~~~~~--~~~~~~~~a~~lLkpg-G~~~~i--~----~~~~l~~~l~~~~~~~~~~~i~-  167 (225)
                      .++.+     ..++....|+...-.  ...+.+   ..++|.. =.+.+.  |    -..++..++..+  ++.|.-+- 
T Consensus        73 ~~Ai~-----~~NpEi~~A~~~~IPv~~R~~~L---ael~~~~k~~iaVaGtHGKTTTTamia~~~~~a--GLdPt~~~G  142 (491)
T TIGR01082        73 AAAIK-----EDNPEIVEAKERGIPVIRRAEML---AELMRKRKESIAVAGTHGKTTTTAMIAVILKEA--GLDPTVIVG  142 (491)
T ss_pred             EECCC-----CCCHHHHHHHHCCCCEECHHHHH---HHHHHHHCCEEEEECCCCCHHHHHHHHHHHHHC--CCCCCEEEC
T ss_conf             40337-----88888999996488813378999---999862087079983687256899999999844--999768986


Q ss_pred             ----EECCC--CCCCCEEEEEEEEECC--CCCCEEECCE-EEEC
Q ss_conf             ----81458--9698309999999778--8874770756-8983
Q gi|255764482|r  168 ----PLHPR--EGECASRILVTGRKGM--RGQLRFRYPI-VLHK  202 (225)
Q Consensus       168 ----~v~~~--~~~~~~~vlv~~~k~~--~~~~~~~~~l-~l~~  202 (225)
                          -.-.+  .+......+.|+--..  +.-+.+.|.. |+-+
T Consensus       143 G~~~~~~~Na~~g~~~~~lvaEaDESd~~~sFl~~~P~~ai~TN  186 (491)
T TIGR01082       143 GEVKEAGTNARLGSSGEYLVAEADESDRSASFLHLQPEVAIVTN  186 (491)
T ss_pred             CCCCCCCCCEEECCCCCEEEEEEEECCCCCCHHCCCCCEEEECC
T ss_conf             64366577435714686799998723776401206985799747


No 499
>TIGR02734 crtI_fam phytoene desaturase; InterPro: IPR014105   Phytoene is converted to lycopene by desaturation at four (two symmetrical pairs of) sites. This is achieved by two enzymes (crtP and crtQ) in cyanobacteria (Gloeobacter being an exception) and plants, but by a single enzyme in most other bacteria and in fungi. This single enzyme is called the bacterial-type phytoene desaturase, or CrtI. Most members of this family are CrtI and are part of flavin containing amine oxidoreductase family. It is likely that all members act on either phytoene or on related compounds such as dehydrosqualene, for carotenoid biosynthesis..
Probab=24.30  E-value=50  Score=13.73  Aligned_cols=25  Identities=28%  Similarity=0.481  Sum_probs=9.2

Q ss_pred             ECCCHHHHHHHHHHHCCCCEEEEEE
Q ss_conf             5878438999999867998899998
Q gi|255764482|r   18 LGAGAGAAGLAVASRLHEAQILLAE   42 (225)
Q Consensus        18 lGcG~G~~~l~la~r~~~~~v~gvD   42 (225)
                      ||+|.|++++++--.-.|++|+=+|
T Consensus         4 IGAG~gGLA~A~rL~~~G~~vtv~E   28 (526)
T TIGR02734         4 IGAGFGGLALAIRLQAAGIRVTVVE   28 (526)
T ss_pred             ECCCHHHHHHHHHHHHCCCEEEEEE
T ss_conf             5777689999999973795289986


No 500
>PRK07060 short chain dehydrogenase; Provisional
Probab=23.74  E-value=51  Score=13.66  Aligned_cols=81  Identities=17%  Similarity=0.106  Sum_probs=48.9

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCC
Q ss_conf             55789995878438999999867--9988999988989999889999980664522253020044423531000012357
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKN   88 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~   88 (225)
                      +|..+|=-|++.| ++..+|+++  .+++|+.+|.+...++......          ....+..|+......... ....
T Consensus         8 ~gK~~lVTG~~~G-IG~aia~~la~~Ga~V~~~~r~~~~~~~~~~~~----------~~~~~~~Dv~~~~~v~~~-~~~~   75 (245)
T PRK07060          8 SGKSVLVTGASSG-IGRACAVALAARGARVVAAARNQADLDRLAGET----------GCEPLRLDVGDDAAIRAA-LAGA   75 (245)
T ss_pred             CCCEEEEECCCCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHH----------CCEEEEEECCCHHHHHHH-HHHC
T ss_conf             9998999477768-999999999987999999979989999999863----------987999807999999999-9965


Q ss_pred             CCCCEEEECCCCCCC
Q ss_conf             652057722654464
Q gi|255764482|r   89 NFYDHVIMNPPFNER  103 (225)
Q Consensus        89 ~~fDlii~nPPy~~~  103 (225)
                      +..|.++.|--....
T Consensus        76 g~iDilVnnAG~~~~   90 (245)
T PRK07060         76 GAFDGLVNCAGIASL   90 (245)
T ss_pred             CCCCEEEECCCCCCC
T ss_conf             999899989887999


Done!