HHsearch alignment for GI: 255764482 and conserved domain: pfam01234

>pfam01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family.
Probab=97.54  E-value=0.0011  Score=39.97  Aligned_cols=119  Identities=19%  Similarity=0.144  Sum_probs=64.9

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHH-CCCCCCCCCE--------------------
Q ss_conf             8557899958784389999998679988999988989999889999980-6645222530--------------------
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALP-ANAQISKRIS--------------------   68 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~-~~~~~~~~~~--------------------   68 (225)
T Consensus        55 ~kg~~LiDvG~GPtiy~~lsA~~~-f~~I~lsDy~~~Nr~el~kWl~~ep~afDWs~~~~~v~~lEG~~~~~~e~ee~lR  133 (261)
T pfam01234        55 VKGDTLIDIGSGPTIYQLLSACEV-FKEIHLSDYLPQNRDELIKWLKKEPGAFDWSPVLKHICELEGDRECWQEKEEKLR  133 (261)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHH-CCEEEECCCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHH
T ss_conf             466689984789458888767765-0717860255767999999970699866661999999862267641578889999


Q ss_pred             -----EECCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEE
Q ss_conf             -----200444235310000123576520577226544644654788545565205668989999999986246983787
Q gi|255764482|r   69 -----LIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSL  143 (225)
Q Consensus        69 -----~~~~D~~~~~~~~~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~  143 (225)
T Consensus       134 ~~Ik~Vl~cDV~~~~pl~--~~~~lp~~D~v~S~---~c-----------LE~ac~d~~~Y~~av~ni~~LLkpGG~Lil  197 (261)
T pfam01234       134 ALVKRVLKCDVHQSPPLG--AGVQLPPADCVVTI---FC-----------LEYACPDLEEYCRALRNLASLLKPGGHLVL  197 (261)
T ss_pred             HHHHEEEECCCCCCCCCC--CCCCCCCCCEEEEE---EE-----------HHHHCCCHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             886448876556888888--86667885588476---22-----------556619999999999999864788846999


Q ss_pred             EC
Q ss_conf             02
Q gi|255764482|r  144 IA  145 (225)
Q Consensus       144 i~  145 (225)
T Consensus       198 ~g  199 (261)
T pfam01234       198 GG  199 (261)
T ss_pred             EE
T ss_conf             98