HHsearch alignment for GI: 255764482 and conserved domain: pfam01269

>pfam01269 Fibrillarin Fibrillarin.
Probab=97.86  E-value=0.0011  Score=40.07  Aligned_cols=139  Identities=17%  Similarity=0.158  Sum_probs=84.4

Q ss_pred             HCCCCCCCEEEEECCCHHHHHHHHHHHC-CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC
Q ss_conf             3899855789995878438999999867-998899998898999988999998066452225302004442353100001
Q gi|255764482|r    6 LVNATGSFHLADLGAGAGAAGLAVASRL-HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA   84 (225)
Q Consensus         6 ~~~~~~~~~VLDlGcG~G~~~l~la~r~-~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~   84 (225)
T Consensus        68 ~~~i~~gskVLYLGAasGTTVSHvsDIvg~~G~VyAVE~spr~~RdL~~la------~~R~NIvPIl~DAr~P~~Y~~l-  140 (229)
T pfam01269        68 DIPIKPGSKVLYLGAASGTTVSHVSDIVGPEGVVYAVEFSPRVGRELINVA------KKRPNIVPILEDARHPQKYRML-  140 (229)
T ss_pred             CCCCCCCCEEEEECCCCCCCHHHHHHHCCCCCEEEEEECCCHHHHHHHHHH------HCCCCCEEEECCCCCHHHHHHH-
T ss_conf             568589987999447779857678872288953999971735578999997------4279944576677875676542-


Q ss_pred             CCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCH----------HHHHHHH
Q ss_conf             235765205772265446446547885455652056689899999999862469837870288----------8899999
Q gi|255764482|r   85 GLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARP----------QSLIQIV  154 (225)
Q Consensus        85 ~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~----------~~l~~~l  154 (225)
T Consensus       141 ---v~~VD~ifqDva--------Q~------------~Qa~i~~~Na~~FLk~gG~~~l~iKA~Sid~t~~p~~vf~~e~  197 (229)
T pfam01269       141 ---VEMVDVIFADVA--------QP------------DQARILALNAKYFLKNGGYFMISIKARSIDVTKEPEEVFAREV  197 (229)
T ss_pred             ---CCCCCEEEECCC--------CH------------HHHHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCHHHHHHHHH
T ss_conf             ---556668996278--------77------------7899999999986126988999997134216789899999999


Q ss_pred             HHHH-CCCCCEEEEEECCCCC
Q ss_conf             9852-1788469998145896
Q gi|255764482|r  155 NACA-RRIGSLEITPLHPREG  174 (225)
Q Consensus       155 ~~~~-~~~~~~~i~~v~~~~~  174 (225)
T Consensus       198 ~~L~~~~~~~~e~i~L~py~~  218 (229)
T pfam01269       198 EKLKEEGFKPKEQVTLEPYER  218 (229)
T ss_pred             HHHHHCCCCEEEEECCCCCCC
T ss_conf             999876996589980577778