HHsearch alignment for GI: 255764482 and conserved domain: pfam05185

>pfam05185 PRMT5 PRMT5 arginine-N-methyltransferase. The human homologue of yeast Skb1 (Shk1 kinase-binding protein 1) is PRMT5, an arginine-N-methyltransferase. These proteins appear to be key mitotic regulators. They play a role in Jak signalling in higher eukaryotes.
Probab=97.54  E-value=0.0017  Score=38.87  Aligned_cols=103  Identities=16%  Similarity=0.164  Sum_probs=70.7

Q ss_pred             CEEEEECCCHHHH---HHHHHHHCC-CCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCC
Q ss_conf             7899958784389---999998679-988999988989999889999980664522253020044423531000012357
Q gi|255764482|r   13 FHLADLGAGAGAA---GLAVASRLH-EAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKN   88 (225)
Q Consensus        13 ~~VLDlGcG~G~~---~l~la~r~~-~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~   88 (225)
T Consensus       188 ~vI~VvGAGRGPLV~~~l~A~~~~~~~v~i~AVEKNpnA~vtL~~r~n~~---~W~~~V~ii~~DMR~w~~--------p  256 (447)
T pfam05185       188 LVILVVGAGRGPLVDRALRAAEETGRKVKIYAVEKNPNAVVTLQKRVNFE---EWGDKVTLISSDMREWKG--------P  256 (447)
T ss_pred             EEEEEECCCCCHHHHHHHHHHHHCCCCEEEEEEECCHHHHHHHHHHHHHH---HCCCCEEEEECCHHCCCC--------C
T ss_conf             69999858964899999999998199669999956877999999985054---317806999080005799--------8


Q ss_pred             CCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEE
Q ss_conf             652057722654464465478854556520566898999999998624698378
Q gi|255764482|r   89 NFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLS  142 (225)
Q Consensus        89 ~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~  142 (225)
T Consensus       257 ~k~Di~VSELLGSFGD----------------NELSPECLdg~q~~lk~~gIsI  294 (447)
T pfam05185       257 EKADILVSELLGSFGD----------------NELSPECLDGAQRFLKPDGISI  294 (447)
T ss_pred             CCCCEEEEECCCCCCC----------------CCCCHHHHHHHHHHCCCCCEEE
T ss_conf             7735897521166666----------------5579778778997468984682