HHsearch alignment for GI: 255764482 and conserved domain: pfam06325

>pfam06325 PrmA Ribosomal protein L11 methyltransferase (PrmA). This family consists of several Ribosomal protein L11 methyltransferase (EC:2.1.1.-) sequences.
Probab=99.63  E-value=9e-15  Score=102.57  Aligned_cols=117  Identities=15%  Similarity=0.205  Sum_probs=84.5

Q ss_pred             CCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCC
Q ss_conf             98557899958784389999998679988999988989999889999980664522253020044423531000012357
Q gi|255764482|r    9 ATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKN   88 (225)
Q Consensus         9 ~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~   88 (225)
T Consensus       158 ~~~~~~vlD~GcGSGILaIaA~kl-Ga~~v~a~DiDp~Av~~a~eN~~~N~v~---~~~~~~~~-----------~~~~~  222 (294)
T pfam06325       158 VKPGETVLDVGCGSGILAIAALKL-GAKKVVGVDIDPVAVRAAKENAELNGVE---AQLEVYLP-----------GDLPE  222 (294)
T ss_pred             CCCCCEEEEECCCHHHHHHHHHHC-CCCCEEEEECCHHHHHHHHHHHHHCCCC---CCEEEECC-----------CCCCC
T ss_conf             036986785056508999999975-9996899988899999999999976998---31799644-----------31556


Q ss_pred             CCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEE-CCHHHHHHHHHHHHCCC
Q ss_conf             65205772265446446547885455652056689899999999862469837870-28888999999852178
Q gi|255764482|r   89 NFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLI-ARPQSLIQIVNACARRI  161 (225)
Q Consensus        89 ~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i-~~~~~l~~~l~~~~~~~  161 (225)
T Consensus       223 ~~~DlIvANIl---------------------a~~L~~l~~~~~~~l~~~G~lilSGil~~q~~~v~~a~~~g~  275 (294)
T pfam06325       223 GKADVVVANIL---------------------ADPLIELAPDIYALVKPGGYLILSGILEEQADDVAEAYSQGF  275 (294)
T ss_pred             CCCCEEEEHHC---------------------HHHHHHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHCCC
T ss_conf             64578984108---------------------999999999999973899899991782899999999998699