HHsearch alignment for GI: 255764482 and conserved domain: pfam10354

>pfam10354 DUF2431 Domain of unknown function (DUF2431). This is the N-terminal domain of a family of proteins found from plants to humans. The function is not known.
Probab=96.83  E-value=0.018  Score=33.19  Aligned_cols=117  Identities=17%  Similarity=0.262  Sum_probs=69.2

Q ss_pred             ECCCHHHHHHHHHHHCC-CCEEEEEECCHHH--HH---HHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             58784389999998679-9889999889899--99---889999980664522253020044423531000012357652
Q gi|255764482|r   18 LGAGAGAAGLAVASRLH-EAQILLAERSPLM--AH---YARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFY   91 (225)
Q Consensus        18 lGcG~G~~~l~la~r~~-~~~v~gvD~~~~~--~~---~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~f   91 (225)
T Consensus         3 VGeGdFSFS~aL~~~~~~~~~l~ATs~ds~~~l~~kY~~~~~nl~~L~~~g~---~V~~gVDAt~l~~~~---~~~~~~f   76 (166)
T pfam10354         3 VGEGDFSFSLSLATAFGSPTNLTATSLDSREELEEKYGDAEENLEELEELGV---TVLHGVDATKLKKHF---SLKKNRF   76 (166)
T ss_pred             EECCCHHHHHHHHHHCCCCCCEEEEECCCHHHHHHHCCCHHHHHHHHHHCCC---EEEEEEECCCCCCCC---CCCCCCC
T ss_conf             6664328999999962999838997458999998767559999999985899---599857445366684---4347835


Q ss_pred             CEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             057722654464465478854556520566898999999998624698378702
Q gi|255764482|r   92 DHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIA  145 (225)
Q Consensus        92 Dlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~  145 (225)
T Consensus        77 D~IiFNFPH~G~-~~--~~~~~~i~--~nr~Ll~~Ff~sa~~~l~~~G~i~vTl  125 (166)
T pfam10354        77 DRIIFNFPHAGG-KI--KDSDRNIR--LNRELLRGFFKNASELLKPGGEIHVTL  125 (166)
T ss_pred             CEEEECCCCCCC-CC--CCHHHHHH--HHHHHHHHHHHHHHHHHCCCCEEEEEE
T ss_conf             789987998888-77--41255589--999999999999999827998999995