BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|255764482|ref|YP_003065169.2| methyltransferase protein
[Candidatus Liberibacter asiaticus str. psy62]
         (225 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|255764482|ref|YP_003065169.2| methyltransferase protein [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254547833|gb|ACT57229.2| methyltransferase protein [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 225

 Score =  461 bits (1187), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 225/225 (100%), Positives = 225/225 (100%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN
Sbjct: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
           AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML
Sbjct: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI 180
           EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI
Sbjct: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI 180

Query: 181 LVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSLTRL 225
           LVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSLTRL
Sbjct: 181 LVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSLTRL 225


>gi|315121919|ref|YP_004062408.1| methyltransferase protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495321|gb|ADR51920.1| methyltransferase protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 262

 Score =  366 bits (939), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 193/225 (85%), Positives = 209/225 (92%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           MILASLV+A G FHLADLGAGAGAAGLA+ASRLHEAQILL E SPLMA+YARKTLALPAN
Sbjct: 36  MILASLVDAKGLFHLADLGAGAGAAGLAIASRLHEAQILLVELSPLMANYARKTLALPAN 95

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
           AQISKR+SLIEVDVTL G+ R+LAGLKNNFYDHVIMNPPFNERIGT+TPDK+KEEAHVML
Sbjct: 96  AQISKRVSLIEVDVTLTGKKRSLAGLKNNFYDHVIMNPPFNERIGTLTPDKVKEEAHVML 155

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI 180
           E SFEKWIRTACAIMR SGQLSLIARPQSLI++VNACARRIGSLEITPL+PR+GECA RI
Sbjct: 156 EGSFEKWIRTACAIMRPSGQLSLIARPQSLIEVVNACARRIGSLEITPLYPRKGECAIRI 215

Query: 181 LVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSLTRL 225
           LVTGRKGMRG+L FR PI LH+PNGQ YS FVTDLINGK ++ RL
Sbjct: 216 LVTGRKGMRGKLNFRSPIFLHEPNGQSYSHFVTDLINGKATIKRL 260


>gi|307309347|ref|ZP_07589010.1| methyltransferase small [Sinorhizobium meliloti BL225C]
 gi|307320083|ref|ZP_07599504.1| methyltransferase small [Sinorhizobium meliloti AK83]
 gi|306894298|gb|EFN25063.1| methyltransferase small [Sinorhizobium meliloti AK83]
 gi|306900216|gb|EFN30834.1| methyltransferase small [Sinorhizobium meliloti BL225C]
          Length = 256

 Score =  216 bits (551), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 125/224 (55%), Positives = 163/224 (72%), Gaps = 1/224 (0%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           M++ASLV+  G+  +ADLGAGAGAAG+AVASR+ EA++LL ERSP+MA +AR++LALP N
Sbjct: 33  MLVASLVSCRGACRVADLGAGAGAAGMAVASRIEEAEVLLVERSPVMADFARRSLALPEN 92

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
           A ++ R+S++E DV+L G+ R  AGL ++ +DHVIMNPPFN+     TPD++K EAH M 
Sbjct: 93  AHLADRVSVLEADVSLSGKARAAAGLPDDTFDHVIMNPPFNDAADRRTPDRLKAEAHAMS 152

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI 180
            D FE WI+TA AIM+  GQLSLIARP+S+  I+ AC RR G LEITPL PR GE A RI
Sbjct: 153 GDLFEAWIKTAGAIMKPGGQLSLIARPESIAGIIGACGRRFGGLEITPLLPRAGENAVRI 212

Query: 181 LVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSLTR 224
           LV+  K  R +L  R P+V+H   G  +S  V DL NG+ +  R
Sbjct: 213 LVSAIKQSRKRLALRAPLVMHG-EGHRFSPEVDDLNNGRAAYHR 255


>gi|222085055|ref|YP_002543584.1| methyltransferase protein [Agrobacterium radiobacter K84]
 gi|221722503|gb|ACM25659.1| methyltransferase protein [Agrobacterium radiobacter K84]
          Length = 258

 Score =  216 bits (550), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 104/194 (53%), Positives = 137/194 (70%)

Query: 31  SRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNF 90
           SRL +A+++L ERS  MA +ARK+LAL  NA+ + R+S+IE DVTL+G+ RN AGL ++ 
Sbjct: 64  SRLEQAEVVLFERSAEMAEFARKSLALMENARFADRVSVIEADVTLIGKERNAAGLIDDS 123

Query: 91  YDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSL 150
           + HVIMNPPFN+    +TPD +K EAH M +  FE+W+RTA AIM   GQLSLIARPQS+
Sbjct: 124 FHHVIMNPPFNDASDRLTPDALKAEAHAMTDGLFERWVRTAGAIMIPGGQLSLIARPQSI 183

Query: 151 IQIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSR 210
            +I+ AC RR G +EITP+HPR+GE A RILVT  KG R +L  R P+ +H      +S 
Sbjct: 184 GEIIAACGRRFGGIEITPIHPRDGENAVRILVTAIKGSRARLALRAPLTMHGEGVHKFSD 243

Query: 211 FVTDLINGKRSLTR 224
           FV  L NG+ +  R
Sbjct: 244 FVDYLNNGRAAYAR 257


>gi|15964601|ref|NP_384954.1| hypothetical protein SMc00858 [Sinorhizobium meliloti 1021]
 gi|15073779|emb|CAC45420.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021]
          Length = 278

 Score =  216 bits (549), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 125/224 (55%), Positives = 163/224 (72%), Gaps = 1/224 (0%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           M++ASLV+  G+  +ADLGAGAGAAG+AVASR+ EA++LL ERSP+MA +AR++LALP N
Sbjct: 55  MLVASLVSCRGACRVADLGAGAGAAGMAVASRIEEAEVLLVERSPVMADFARRSLALPEN 114

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
           A ++ R+S++E DV+L G+ R  AGL ++ +DHVIMNPPFN+     TPD++K EAH M 
Sbjct: 115 AHLADRVSVLEADVSLSGKARAAAGLPDDTFDHVIMNPPFNDAADRRTPDRLKAEAHAMS 174

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI 180
            D FE WI+TA AIM+  GQLSLIARP+S+  I+ AC RR G LEITPL PR GE A RI
Sbjct: 175 GDLFEAWIKTAGAIMKPGGQLSLIARPESIAGIIGACGRRFGGLEITPLLPRAGENAVRI 234

Query: 181 LVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSLTR 224
           LV+  K  R +L  R P+V+H   G  +S  V DL NG+ +  R
Sbjct: 235 LVSAIKQSRKRLALRAPLVMHG-EGHRFSPEVDDLNNGRAAYHR 277


>gi|116250713|ref|YP_766551.1| hypothetical protein RL0939 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115255361|emb|CAK06436.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 256

 Score =  215 bits (548), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 104/195 (53%), Positives = 133/195 (68%)

Query: 31  SRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNF 90
           SRL +A+++L ERS  MA YAR+++ LP NA ++ R+S++E DVTL  + RN AGL +  
Sbjct: 62  SRLADAEVVLFERSAEMADYARRSILLPDNAHVADRVSVVEADVTLTAKARNDAGLTDES 121

Query: 91  YDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSL 150
           + HVIMNPPFN+     TPD +K EAH M +  FE WIRTA AIM   GQ+SLIARPQS+
Sbjct: 122 FHHVIMNPPFNDAGDRRTPDALKAEAHAMTDGLFESWIRTAGAIMIPGGQMSLIARPQSI 181

Query: 151 IQIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSR 210
            +IV AC RR G +EIT +HPR GE A RILVTG KG R +L  R P+V+HK     +S 
Sbjct: 182 AEIVAACGRRFGGIEITAIHPRPGENAVRILVTGIKGSRARLSLRAPLVMHKEGSHKFSP 241

Query: 211 FVTDLINGKRSLTRL 225
            V D  NG+ +  RL
Sbjct: 242 LVDDFNNGRAAYARL 256


>gi|327192816|gb|EGE59743.1| putative methyltransferase protein [Rhizobium etli CNPAF512]
          Length = 264

 Score =  214 bits (544), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 134/195 (68%)

Query: 31  SRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNF 90
           SRL EAQ++L ERS  MA YAR+++ LP NA ++ R+S++E DV L  + RN AGL +  
Sbjct: 64  SRLAEAQVVLFERSAEMADYARRSILLPENAHLAARVSVVEADVALTAKARNDAGLTDES 123

Query: 91  YDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSL 150
           + HVIMNPPFN+     TPD +K EAH M +  FE WIRTA AIM  +GQLSLIARPQS+
Sbjct: 124 FHHVIMNPPFNDAGDRRTPDALKAEAHAMTDGLFESWIRTAGAIMIPAGQLSLIARPQSI 183

Query: 151 IQIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSR 210
            +I++AC RR G +E+T +HPREGE A RILVT  KG R +L  R P+++H+     +S 
Sbjct: 184 AEIIDACGRRFGGIEMTAIHPREGENAVRILVTAIKGSRARLSLRAPLIMHEEGSHRFSP 243

Query: 211 FVTDLINGKRSLTRL 225
            V D  NG+ +  RL
Sbjct: 244 LVDDFNNGRAAYARL 258


>gi|190890588|ref|YP_001977130.1| methyltransferase [Rhizobium etli CIAT 652]
 gi|190695867|gb|ACE89952.1| putative methyltransferase protein [Rhizobium etli CIAT 652]
          Length = 265

 Score =  213 bits (543), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 134/195 (68%)

Query: 31  SRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNF 90
           SRL +AQ++L ERS  MA YAR+++ LP NA ++ R+S++E DVTL  + RN AGL +  
Sbjct: 64  SRLAKAQVVLFERSAEMADYARRSILLPENAHLAARVSVVEADVTLTAKARNDAGLADES 123

Query: 91  YDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSL 150
           + HVIMNPPFN+     TPD +K EAH M +  FE WIRTA AIM   GQLSLIARPQS+
Sbjct: 124 FHHVIMNPPFNDAGDRRTPDALKAEAHAMTDGLFESWIRTAGAIMIPGGQLSLIARPQSI 183

Query: 151 IQIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSR 210
            +I++AC RR G +E+T +HPREGE A RILVT  KG R +L  R P+++H+     +S 
Sbjct: 184 AEIIDACGRRFGGIEMTAIHPREGENAVRILVTAIKGSRARLSLRAPLIMHEEGSHKFSP 243

Query: 211 FVTDLINGKRSLTRL 225
            V D  NG+ +  RL
Sbjct: 244 LVDDFNNGRAAYARL 258


>gi|15887977|ref|NP_353658.1| hypothetical protein Atu0636 [Agrobacterium tumefaciens str. C58]
 gi|15155585|gb|AAK86443.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 236

 Score =  212 bits (540), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 120/224 (53%), Positives = 154/224 (68%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           M+LASLV    +  +ADLGAGAGAAG+AVA+RL +A++ L ERS  MA +AR++L LP N
Sbjct: 4   MLLASLVADDRACRIADLGAGAGAAGMAVAARLEKAEVTLYERSQEMAEFARRSLELPDN 63

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
           A  S RI ++E DVTL  + R  AGL +  + HVIMNPP+N+     TPD +K EAH M 
Sbjct: 64  AAFSARIEVLEADVTLRAKARVEAGLPDEHFHHVIMNPPYNDAGDRRTPDALKAEAHAMT 123

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI 180
           E  FE WIRTA AIM S GQLSLI+RPQS+ +I+ AC  R G LEIT +HPR GE A R+
Sbjct: 124 EGLFEDWIRTASAIMVSGGQLSLISRPQSVAEIIAACGSRFGGLEITLIHPRPGEDAVRM 183

Query: 181 LVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSLTR 224
           LVT  KG R +L FR P+++H+     ++ FV DL NG+ +  R
Sbjct: 184 LVTAIKGSRARLTFRAPLIMHETGSHAFTPFVDDLNNGRAAYAR 227


>gi|86356523|ref|YP_468415.1| putative methyltransferase protein [Rhizobium etli CFN 42]
 gi|86280625|gb|ABC89688.1| putative methyltransferase protein [Rhizobium etli CFN 42]
          Length = 235

 Score =  211 bits (538), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 121/225 (53%), Positives = 156/225 (69%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           M+LA+LV    S  +ADLGAGAGAAGLAVASRL + Q++L ERS  MA YAR+++ LP N
Sbjct: 4   MLLAALVADDRSVRVADLGAGAGAAGLAVASRLAKTQVVLFERSAEMADYARRSILLPEN 63

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
           A ++ R+S++E DVTL  + RN AGL +  + HVIMNPPFN+     TPD +K EAH M 
Sbjct: 64  AHLAARVSVVEADVTLTAKARNDAGLADESFHHVIMNPPFNDAGDRRTPDALKAEAHAMT 123

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI 180
           +D FE WIRTA AIM   GQLSLIARP+S+ +I++AC RR G +EIT +HPR GE A RI
Sbjct: 124 DDLFESWIRTAGAIMIPGGQLSLIARPESIAEIIDACGRRFGGIEITAIHPRAGENAVRI 183

Query: 181 LVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSLTRL 225
           LVT  KG R +L  R  +++H+     +S  V D  NG+ +  RL
Sbjct: 184 LVTAIKGSRARLSLRAALIMHEEGSHKFSPLVDDFNNGRAAYARL 228


>gi|209548131|ref|YP_002280048.1| methyltransferase small [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209533887|gb|ACI53822.1| methyltransferase small [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 258

 Score =  210 bits (534), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 132/195 (67%)

Query: 31  SRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNF 90
           SRL +A+++L ERS  MA YAR+++ LP NA ++ R+ +IE DVTL  + RN AGL +  
Sbjct: 64  SRLAQAEVVLFERSAEMADYARRSILLPENAHLAARVGVIEADVTLTAKARNDAGLIDES 123

Query: 91  YDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSL 150
           + HVIMNPPFN      TPD +K EAH M +  FE WIRTA AIM   GQLSLIARPQS+
Sbjct: 124 FHHVIMNPPFNHVGDRRTPDALKAEAHAMTDGLFESWIRTAGAIMIPGGQLSLIARPQSI 183

Query: 151 IQIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSR 210
            +I+ AC RR G +EIT +HPR+GE A RILVTG KG R +L  R P+++H+     +S 
Sbjct: 184 AEIIAACGRRFGGIEITAIHPRQGENAVRILVTGIKGSRARLSLRAPLIMHEEGSHKFSP 243

Query: 211 FVTDLINGKRSLTRL 225
            V D  NG+ +  RL
Sbjct: 244 LVDDFNNGRAAYARL 258


>gi|227821039|ref|YP_002825009.1| putative methyltransferase protein [Sinorhizobium fredii NGR234]
 gi|227340038|gb|ACP24256.1| putative methyltransferase protein [Sinorhizobium fredii NGR234]
          Length = 257

 Score =  209 bits (531), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 119/224 (53%), Positives = 159/224 (70%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           M+LA+LV+      +ADLGAGAGAAG+AVASRL EA++LL ERS +MA +AR++LALP N
Sbjct: 33  MLLAALVSCERPCRVADLGAGAGAAGMAVASRLAEAEVLLVERSAIMADFARRSLALPEN 92

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
           A+ + R++++E DV+L G+ R   GL ++ +DHVIMNPPFN+     TPD +K EAH M 
Sbjct: 93  ARFASRVAVLEADVSLNGKARAAVGLPDDAFDHVIMNPPFNDAADRRTPDSLKAEAHAMS 152

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI 180
           +D FE WI+TA AIM+  GQLSLIARP+S+ +I+ AC RR G +EITPL PR GE A RI
Sbjct: 153 DDLFETWIKTAGAIMKPGGQLSLIARPESIAEIIAACGRRFGGIEITPLLPRAGENAVRI 212

Query: 181 LVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSLTR 224
           LVT  K  R +L  R P+++H      +S  + DL NG+ +  R
Sbjct: 213 LVTAIKQSRKRLVLRAPLIMHAEGTHRFSPEIDDLNNGREAYRR 256


>gi|222147713|ref|YP_002548670.1| hypothetical protein Avi_0945 [Agrobacterium vitis S4]
 gi|221734701|gb|ACM35664.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 242

 Score =  209 bits (531), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 130/195 (66%)

Query: 31  SRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNF 90
           SRL  A + L ERSP M  YA+KTL L  NA ++ R+ L+  DVTL G  R  AGL ++ 
Sbjct: 43  SRLPTAMVTLVERSPDMLSYAQKTLDLAENAHLAGRVQLVAADVTLTGRARRAAGLPDDA 102

Query: 91  YDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSL 150
           +DHVIMNPPFN+     TPD +K EAH M  D FE+W+RTA AIM+  GQLSLIARPQS+
Sbjct: 103 FDHVIMNPPFNDGRDRTTPDSLKAEAHAMDGDMFERWLRTAGAIMKPGGQLSLIARPQSV 162

Query: 151 IQIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSR 210
            +I+ AC +R G +EIT +HPREGE A R+L+T  KG R +L FR P+++H P G  +  
Sbjct: 163 AEIIAACGKRFGGIEITLIHPREGESAIRLLLTAIKGSRARLTFRSPLIMHGPEGHAFLP 222

Query: 211 FVTDLINGKRSLTRL 225
            V  L NG+    RL
Sbjct: 223 QVDALNNGRGGYPRL 237


>gi|241203316|ref|YP_002974412.1| methyltransferase small [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240857206|gb|ACS54873.1| methyltransferase small [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 256

 Score =  207 bits (528), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 101/195 (51%), Positives = 131/195 (67%)

Query: 31  SRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNF 90
           SRL   Q++L ERS  MA YAR+++ LP NA ++ R+S++E DVTL  + RN AGL +  
Sbjct: 62  SRLANTQVVLFERSAEMADYARRSILLPDNAHLAGRVSVVEADVTLTAKARNDAGLTDES 121

Query: 91  YDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSL 150
           + HVIMNPPFN+     TPD +K EAH M +  FE WIRTA AI+   GQLSLIARPQS+
Sbjct: 122 FHHVIMNPPFNDAGDRRTPDALKAEAHAMTDGLFESWIRTAGAIIIPGGQLSLIARPQSI 181

Query: 151 IQIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSR 210
            +IV AC RR G +EIT +HPR+GE A RILVTG KG R +L  R  +++H+     +S 
Sbjct: 182 AEIVAACGRRFGGIEITAIHPRQGENAVRILVTGIKGSRARLSLRAALIMHEEGSHKFSP 241

Query: 211 FVTDLINGKRSLTRL 225
            V D  NG+ +  RL
Sbjct: 242 LVDDFNNGRAAYARL 256


>gi|150395685|ref|YP_001326152.1| methyltransferase small [Sinorhizobium medicae WSM419]
 gi|150027200|gb|ABR59317.1| methyltransferase small [Sinorhizobium medicae WSM419]
          Length = 256

 Score =  207 bits (526), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 123/224 (54%), Positives = 158/224 (70%), Gaps = 1/224 (0%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           M+LASLV+     H+ADLGAGAGAAG+AVASR+  AQ+LL ERS +MA +AR++LAL  N
Sbjct: 33  MLLASLVSCRSRCHVADLGAGAGAAGMAVASRIEAAQVLLVERSEVMADFARRSLALSEN 92

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
           A  + R+S++E DVTL G+ R  AGL ++ +DHVIMNPPFN+     TPD++K EAH   
Sbjct: 93  AHFAGRVSVLEADVTLSGKARVAAGLPDDTFDHVIMNPPFNDAADRRTPDRLKAEAHARS 152

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI 180
            D FE WI+TA AIM+  GQLSLIARP+S+ +IV AC RR G +EITPL PR G+ A RI
Sbjct: 153 ADLFETWIKTAGAIMKPGGQLSLIARPESIAEIVVACGRRFGGIEITPLLPRAGDDAVRI 212

Query: 181 LVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSLTR 224
           LV+  K  R +L  R P+V+H   G  +S  V DL NG+ +  R
Sbjct: 213 LVSAIKQSRKRLTLRAPLVMHG-EGHRFSADVDDLNNGRAAYHR 255


>gi|325292018|ref|YP_004277882.1| methyltransferase protein [Agrobacterium sp. H13-3]
 gi|325059871|gb|ADY63562.1| methyltransferase protein [Agrobacterium sp. H13-3]
          Length = 266

 Score =  197 bits (500), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 117/224 (52%), Positives = 151/224 (67%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           M+LAS+V    +  +ADLGAGAGAAG AVA+RL +A++ L ERSP M  +A ++LALP N
Sbjct: 34  MLLASMVADERACRIADLGAGAGAAGFAVATRLEKAEVTLFERSPEMVEFACRSLALPEN 93

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
           A  S R+S+ E DVTL G+ R  AGL +  + HVIMNPP+N+     TPD ++ EAH M 
Sbjct: 94  AAFSARVSVREADVTLRGKARVEAGLPDGHFHHVIMNPPYNDAGDRRTPDALRAEAHAMT 153

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI 180
           E  FE WIRTA AI    GQLSLIARPQS+ +I+ AC  R G +EIT +HPR GE A R+
Sbjct: 154 EGLFEDWIRTAGAITVPGGQLSLIARPQSVAEIIAACGSRFGGIEITLIHPRPGEDAVRM 213

Query: 181 LVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSLTR 224
           LVT  KG R +L FR P+V+H+     ++  V DL NG+ +  R
Sbjct: 214 LVTAIKGSRARLSFRAPLVMHETGSHAFTPIVDDLNNGRTAYRR 257


>gi|145580343|pdb|2OZV|A Chain A, Crystal Structure Of A Predicted O-Methyltransferase,
           Protein Atu636 From Agrobacterium Tumefaciens.
 gi|145580344|pdb|2OZV|B Chain B, Crystal Structure Of A Predicted O-Methyltransferase,
           Protein Atu636 From Agrobacterium Tumefaciens
          Length = 260

 Score =  197 bits (500), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 115/223 (51%), Positives = 146/223 (65%)

Query: 2   ILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANA 61
           +LASLV    +  +ADLGAGAGAAG AVA+RL +A++ L ERS   A +AR++L LP NA
Sbjct: 27  LLASLVADDRACRIADLGAGAGAAGXAVAARLEKAEVTLYERSQEXAEFARRSLELPDNA 86

Query: 62  QISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLE 121
             S RI ++E DVTL  + R  AGL +  + HVI NPP+N+     TPD +K EAH   E
Sbjct: 87  AFSARIEVLEADVTLRAKARVEAGLPDEHFHHVIXNPPYNDAGDRRTPDALKAEAHAXTE 146

Query: 122 DSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRIL 181
             FE WIRTA AI  S GQLSLI+RPQS+ +I+ AC  R G LEIT +HPR GE A R L
Sbjct: 147 GLFEDWIRTASAIXVSGGQLSLISRPQSVAEIIAACGSRFGGLEITLIHPRPGEDAVRXL 206

Query: 182 VTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSLTR 224
           VT  KG R +L FR P++ H+     ++ FV DL NG+ +  R
Sbjct: 207 VTAIKGSRARLTFRAPLIXHETGSHAFTPFVDDLNNGRAAYAR 249


>gi|163761018|ref|ZP_02168096.1| hypothetical protein HPDFL43_03244 [Hoeflea phototrophica DFL-43]
 gi|162281799|gb|EDQ32092.1| hypothetical protein HPDFL43_03244 [Hoeflea phototrophica DFL-43]
          Length = 283

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 91/195 (46%), Positives = 124/195 (63%), Gaps = 1/195 (0%)

Query: 31  SRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNF 90
           SRL    +LL ER+P MA  AR+TL L  N  ++ R+ ++E DV+L G  R+ AGL +  
Sbjct: 81  SRLPALDVLLVERAPEMAGCARRTLLLAENVHLASRVRVLEADVSLRGNARSAAGLMDAS 140

Query: 91  YDHVIMNPPFNERIGTMTPDKIKEEAHVMLE-DSFEKWIRTACAIMRSSGQLSLIARPQS 149
           +D+VIMNPPFN      TPD +K +AH M   D FE+W+RTA AI++  GQ+S+IARP+S
Sbjct: 141 HDYVIMNPPFNSGRDRTTPDPLKAQAHAMDSPDLFEQWLRTASAILKPGGQVSVIARPES 200

Query: 150 LIQIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYS 209
           L  I+    RR G +EITP+ PR G+ A RIL+T  KG R +L  R  IV+H+   + +S
Sbjct: 201 LGDILTGFKRRFGGVEITPVCPRHGDDAIRILLTAIKGSRARLVLRDRIVIHEGEARDFS 260

Query: 210 RFVTDLINGKRSLTR 224
             + DL NG  S  R
Sbjct: 261 PLMNDLANGHGSWPR 275


>gi|121601931|ref|YP_988703.1| methyltransferase domain-containing protein [Bartonella
           bacilliformis KC583]
 gi|120614108|gb|ABM44709.1| methyltransferase domain protein [Bartonella bacilliformis KC583]
          Length = 263

 Score =  171 bits (433), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 107/225 (47%), Positives = 136/225 (60%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           M+LA LV +     + DLGAGAGAAGLAVASR  E  + L ERS  M  YA+KTL L  N
Sbjct: 37  MLLAGLVPSLFKGKIVDLGAGAGAAGLAVASRCFETHVTLVERSAFMLSYAQKTLLLKEN 96

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
            ++S RI L+  DVTL G+ R  AGL NN +D  IMNPPFN      TPD+ K EAHVM 
Sbjct: 97  KELSSRIFLLGADVTLRGKERIEAGLINNSFDFAIMNPPFNNSADRKTPDRQKSEAHVMP 156

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI 180
           E  FE W+R+A AI++  G L LIARPQSL  I++A  RR G + I P+H R    A RI
Sbjct: 157 EAMFENWLRSAAAIVKPGGYLGLIARPQSLTDILHALKRRFGDIRIIPVHSRAETAAIRI 216

Query: 181 LVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSLTRL 225
           L   ++G +  L     +++H+ N   +S  V  + NG  SL  +
Sbjct: 217 LFYAKRGSKTALSVLPALIMHEGNSHAFSPQVDAINNGHISLWEI 261


>gi|153007862|ref|YP_001369077.1| methyltransferase small [Ochrobactrum anthropi ATCC 49188]
 gi|151559750|gb|ABS13248.1| methyltransferase small [Ochrobactrum anthropi ATCC 49188]
          Length = 264

 Score =  169 bits (428), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 119/191 (62%)

Query: 32  RLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFY 91
           R  +A I L ERS  MA +AR+++A P NA ++ RIS+IE DV L G+ R  AGL +N +
Sbjct: 73  RCPDANITLVERSAFMAGFARRSVAHPLNAALAGRISVIEADVGLRGKARIAAGLVDNSF 132

Query: 92  DHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLI 151
           D VIMNPPFNE     TPD +K EAHVM E  FE+W+RTA AI++  G +++IARP S+ 
Sbjct: 133 DFVIMNPPFNEARDRSTPDPLKAEAHVMPEGMFEQWVRTAAAIVKPGGGIAIIARPGSIS 192

Query: 152 QIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRF 211
            I+ A + R G L I P+ PR    A RI+VTG +G R  L     +VLH  +G  ++  
Sbjct: 193 SILEALSGRFGGLRIIPVQPRPEAAAIRIVVTGTRGSRAGLSLMPALVLHGSDGHGFTPR 252

Query: 212 VTDLINGKRSL 222
              + NG  +L
Sbjct: 253 ANGINNGLDAL 263


>gi|49473967|ref|YP_032009.1| hypothetical protein BQ03210 [Bartonella quintana str. Toulouse]
 gi|49239470|emb|CAF25821.1| hypothetical protein BQ03210 [Bartonella quintana str. Toulouse]
          Length = 263

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 106/225 (47%), Positives = 137/225 (60%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           M+LA LV       + DLGAGAGAAGLAVASR  E  + L ERS  MA YA+KTL L  N
Sbjct: 37  MLLAGLVPNNFKGKVVDLGAGAGAAGLAVASRCLEVHVTLVERSAFMASYAQKTLMLKQN 96

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
            +++KR+ L+E DVT  G  R  AGL ++ +D  IMNPPFN      TPD+ K EAHVM 
Sbjct: 97  EKLAKRVCLVEADVTCKGRARLEAGLADHAFDFAIMNPPFNNPADRKTPDEQKFEAHVMP 156

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI 180
           E  F+ W+R+  AI++  G L LIARPQSL  I++A   R G++ I PLH R    A RI
Sbjct: 157 EAMFDDWLRSTAAIVKPGGYLGLIARPQSLNDILHALKGRFGNICIIPLHARVATAAIRI 216

Query: 181 LVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSLTRL 225
           L   ++G +  L    P+V+H+ NG  +S  +  + NG  SL  L
Sbjct: 217 LFYAKRGSKAALSLLPPLVMHEDNGHAFSPRMDAINNGHISLWEL 261


>gi|13476174|ref|NP_107744.1| hypothetical protein mll7427 [Mesorhizobium loti MAFF303099]
 gi|14026934|dbj|BAB53530.1| mll7427 [Mesorhizobium loti MAFF303099]
          Length = 385

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 103/222 (46%), Positives = 139/222 (62%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           M+LA+ V +     LAD GAGAGAAGLAV SR   A+ +L ER+P MA +A  TLA P N
Sbjct: 161 MMLAASVPSVFGGRLADFGAGAGAAGLAVLSRCPAARAVLVERAPEMAAFASATLAHPGN 220

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
           A +S R S++  DVT+ G+ R  AGL +N +D+VIMNPPFN      TPD++++EAHVM 
Sbjct: 221 AHLSDRASVLVADVTVSGQARVAAGLADNDFDYVIMNPPFNAARDRATPDRLRKEAHVME 280

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI 180
           +  FE WIR+A A++R  G L++IARP+ L  I++A + R G  E+  +HPR    A RI
Sbjct: 281 DGLFESWIRSAAAVVRPRGGLAVIARPEQLGAILDAMSGRFGDAEMLAVHPRPDAAAIRI 340

Query: 181 LVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSL 222
           +V    G RG+L  R P++LH   G         + NG  SL
Sbjct: 341 IVRAALGARGKLAIRPPLMLHAQAGNGPDERSEMITNGLASL 382


>gi|306842304|ref|ZP_07474964.1| methyltransferase small [Brucella sp. BO2]
 gi|306287561|gb|EFM59017.1| methyltransferase small [Brucella sp. BO2]
          Length = 260

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 87/191 (45%), Positives = 119/191 (62%)

Query: 32  RLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFY 91
           R  +A++ L ERS LMA +ARKT+A P NA ++ RI ++E DV L G+ R  AGL +N +
Sbjct: 69  RCPKARVTLVERSGLMAGFARKTIAHPLNAALAGRIDILEADVALKGKARVFAGLADNSF 128

Query: 92  DHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLI 151
           D  IMNPPFNE     TPD +K EAHVM E  FE+W+RTA AI++  G +++IARP S+ 
Sbjct: 129 DFAIMNPPFNEARDRTTPDPLKAEAHVMPEGMFEQWVRTAAAIVKPGGGIAIIARPGSIR 188

Query: 152 QIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRF 211
            I++A A R G L+I  + PR    A RI+VTG +G R  L     ++LH   G  ++  
Sbjct: 189 PILDALAGRFGGLKIVAVQPRADAPAIRIVVTGTRGSRAGLSLMPALILHGDEGHGFTAR 248

Query: 212 VTDLINGKRSL 222
              + NG  SL
Sbjct: 249 ADAINNGLSSL 259


>gi|254718579|ref|ZP_05180390.1| methyltransferase small [Brucella sp. 83/13]
 gi|265983555|ref|ZP_06096290.1| methyltransferase small [Brucella sp. 83/13]
 gi|264662147|gb|EEZ32408.1| methyltransferase small [Brucella sp. 83/13]
          Length = 260

 Score =  167 bits (424), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 119/191 (62%)

Query: 32  RLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFY 91
           R  +A++ L ERS LMA +ARKT+A P NA ++ RI ++E DV L G+ R LAGL +N +
Sbjct: 69  RCPKARVTLVERSGLMADFARKTIAHPLNAALAGRIDILEADVALKGKARVLAGLADNSF 128

Query: 92  DHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLI 151
           D  IMNPPFNE     TPD +K EAHVM E  FE+W+RTA AI++  G +++IARP S+ 
Sbjct: 129 DFAIMNPPFNEPRDRTTPDPLKAEAHVMPEGMFEQWVRTATAIVKPGGGIAIIARPGSIR 188

Query: 152 QIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRF 211
            I++A   R G L+I  + PR    A RI++TG +G R  L     ++LH   G  ++  
Sbjct: 189 PILDALGGRFGGLKIVAVQPRTDAPAIRIVITGTRGSRAGLSLMPALILHGDEGHGFTAR 248

Query: 212 VTDLINGKRSL 222
              + NG  SL
Sbjct: 249 ADAINNGLSSL 259


>gi|240850067|ref|YP_002971460.1| methyltransferase [Bartonella grahamii as4aup]
 gi|240267190|gb|ACS50778.1| methyltransferase [Bartonella grahamii as4aup]
          Length = 262

 Score =  167 bits (424), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 106/225 (47%), Positives = 133/225 (59%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           M+LASLV +     + DLGAGAGAAGLAVASR  +  + L ERS  M  YA+KTL L  N
Sbjct: 37  MLLASLVPSNLKGKVVDLGAGAGAAGLAVASRCLKVHVTLVERSAFMVSYAQKTLMLKQN 96

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
            Q + R+ L+E DVT  G  R  AGL +N +D  IMNPPFN      TPDK K EAHVM 
Sbjct: 97  KQFASRVCLLEADVTFKGNARIKAGLIDNSFDFAIMNPPFNNPTDRKTPDKQKSEAHVMS 156

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI 180
           E  F+ W+R+A AI++  G L LIARPQSL  I+ A   R G + I P+H R    A R+
Sbjct: 157 EAMFDNWLRSAAAIVKPGGYLGLIARPQSLTDILRALEGRFGGICIIPVHARAKTAAIRL 216

Query: 181 LVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSLTRL 225
           L   ++G R  L     +V+H+ N   +S  V  + NG  SL  L
Sbjct: 217 LFYAKRGSRAALSILPALVIHEGNDHTFSPRVDAINNGYISLWEL 261


>gi|260545862|ref|ZP_05821603.1| methyltransferase [Brucella abortus NCTC 8038]
 gi|260566993|ref|ZP_05837463.1| methyltransferase [Brucella suis bv. 4 str. 40]
 gi|294851779|ref|ZP_06792452.1| methyltransferase [Brucella sp. NVSL 07-0026]
 gi|260097269|gb|EEW81144.1| methyltransferase [Brucella abortus NCTC 8038]
 gi|260156511|gb|EEW91591.1| methyltransferase [Brucella suis bv. 4 str. 40]
 gi|294820368|gb|EFG37367.1| methyltransferase [Brucella sp. NVSL 07-0026]
          Length = 226

 Score =  167 bits (423), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 85/191 (44%), Positives = 118/191 (61%)

Query: 32  RLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFY 91
           R  +A++ L ERS LMA +ARKT+A P NA ++ RI ++E DV L G+ R  AGL +N +
Sbjct: 35  RCPKARVTLVERSGLMAGFARKTIAHPLNAALAGRIDILEADVALKGKARVFAGLADNSF 94

Query: 92  DHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLI 151
           D  IMNPPFNE     TPD +K EAHVM E  FE+W+RTA AI++  G +++IARP S+ 
Sbjct: 95  DFAIMNPPFNEPRDRTTPDPLKAEAHVMPEGMFEQWVRTAAAIVKPGGGIAIIARPGSIR 154

Query: 152 QIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRF 211
            I++A   R G L+I  + PR    A RI++TG +G R  L     ++LH   G  ++  
Sbjct: 155 PILDALGGRFGGLKIVAIQPRADAPAIRIVITGTRGSRAGLSLMPALILHGDEGHGFTAR 214

Query: 212 VTDLINGKRSL 222
              + NG  SL
Sbjct: 215 ADAINNGLSSL 225


>gi|260168173|ref|ZP_05754984.1| methyltransferase small [Brucella sp. F5/99]
          Length = 231

 Score =  167 bits (423), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 85/191 (44%), Positives = 118/191 (61%)

Query: 32  RLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFY 91
           R  +A++ L ERS LMA +ARKT+A P NA ++ RI ++E DV L G+ R  AGL +N +
Sbjct: 40  RCPKARVTLVERSGLMAGFARKTIAHPLNAALAGRIDILEADVALKGKARVFAGLADNSF 99

Query: 92  DHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLI 151
           D  IMNPPFNE     TPD +K EAHVM E  FE+W+RTA AI++  G +++IARP S+ 
Sbjct: 100 DFAIMNPPFNEPRDRTTPDPLKAEAHVMPEGMFEQWVRTAAAIVKPGGGIAIIARPGSIR 159

Query: 152 QIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRF 211
            I++A   R G L+I  + PR    A RI++TG +G R  L     ++LH   G  ++  
Sbjct: 160 PILDALGGRFGGLKIVAIQPRADAPAIRIVITGTRGSRAGLSLMPALILHGDEGHGFTAR 219

Query: 212 VTDLINGKRSL 222
              + NG  SL
Sbjct: 220 ADAINNGLSSL 230


>gi|306845038|ref|ZP_07477619.1| methyltransferase small [Brucella sp. BO1]
 gi|306274670|gb|EFM56459.1| methyltransferase small [Brucella sp. BO1]
          Length = 260

 Score =  167 bits (423), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 119/191 (62%)

Query: 32  RLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFY 91
           R  +A++ L ERS LMA +ARKT+A P NA ++ RI ++E DV L G+ R LAGL +N +
Sbjct: 69  RCPKARVTLVERSGLMAGFARKTIAHPLNAALAGRIDILEADVALKGKARVLAGLADNSF 128

Query: 92  DHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLI 151
           D  IMNPPFNE     TPD +K EAHVM E  FE+W+RTA AI++  G +++IARP S+ 
Sbjct: 129 DFAIMNPPFNEARDRATPDPLKAEAHVMPEGMFEQWVRTAAAIVKPGGGIAIIARPGSIR 188

Query: 152 QIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRF 211
            I++A   R G L+I  + PR    A RI++TG +G R  L     ++LH   G  ++  
Sbjct: 189 PILDALGGRFGGLKIVAIQPRADAPAIRIVITGIRGSRAGLSLMPALILHGDEGHGFTAR 248

Query: 212 VTDLINGKRSL 222
              + NG  SL
Sbjct: 249 ADAINNGLSSL 259


>gi|254729732|ref|ZP_05188310.1| methyltransferase small [Brucella abortus bv. 4 str. 292]
          Length = 232

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 85/191 (44%), Positives = 118/191 (61%)

Query: 32  RLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFY 91
           R  +A++ L ERS LMA +ARKT+A P NA ++ RI ++E DV L G+ R  AGL +N +
Sbjct: 41  RCPKARVTLVERSGLMAGFARKTIAHPLNAALAGRIDILEADVALKGKARVFAGLADNSF 100

Query: 92  DHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLI 151
           D  IMNPPFNE     TPD +K EAHVM E  FE+W+RTA AI++  G +++IARP S+ 
Sbjct: 101 DFAIMNPPFNEPRDRTTPDPLKAEAHVMPEGMFEQWVRTAAAIVKPGGGIAIIARPGSIR 160

Query: 152 QIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRF 211
            I++A   R G L+I  + PR    A RI++TG +G R  L     ++LH   G  ++  
Sbjct: 161 PILDALGGRFGGLKIVAIQPRADAPAIRIVITGTRGSRAGLSLMPALILHGDEGHGFTAR 220

Query: 212 VTDLINGKRSL 222
              + NG  SL
Sbjct: 221 ADAINNGLSSL 231


>gi|265990529|ref|ZP_06103086.1| methyltransferase small [Brucella melitensis bv. 1 str. Rev.1]
 gi|263001313|gb|EEZ13888.1| methyltransferase small [Brucella melitensis bv. 1 str. Rev.1]
          Length = 233

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 85/191 (44%), Positives = 118/191 (61%)

Query: 32  RLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFY 91
           R  +A++ L ERS LMA +ARKT+A P NA ++ RI ++E DV L G+ R  AGL +N +
Sbjct: 42  RCPKARVTLVERSGLMAGFARKTIAHPLNAALAGRIDILEADVALKGKARVFAGLADNSF 101

Query: 92  DHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLI 151
           D  IMNPPFNE     TPD +K EAHVM E  FE+W+RTA AI++  G +++IARP S+ 
Sbjct: 102 DFAIMNPPFNEPRDRTTPDPLKAEAHVMPEGMFEQWVRTAAAIVKPGGGIAIIARPGSIR 161

Query: 152 QIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRF 211
            I++A   R G L+I  + PR    A RI++TG +G R  L     ++LH   G  ++  
Sbjct: 162 PILDALGGRFGGLKIVAIQPRADAPAIRIVITGTRGSRAGLSLMPALILHGDEGHGFTAR 221

Query: 212 VTDLINGKRSL 222
              + NG  SL
Sbjct: 222 ADAINNGLSSL 232


>gi|260757397|ref|ZP_05869745.1| methyltransferase small [Brucella abortus bv. 4 str. 292]
 gi|261757632|ref|ZP_06001341.1| methyltransferase [Brucella sp. F5/99]
 gi|260667715|gb|EEX54655.1| methyltransferase small [Brucella abortus bv. 4 str. 292]
 gi|261737616|gb|EEY25612.1| methyltransferase [Brucella sp. F5/99]
 gi|326538149|gb|ADZ86364.1| methyltransferase small [Brucella melitensis M5-90]
          Length = 223

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 85/191 (44%), Positives = 118/191 (61%)

Query: 32  RLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFY 91
           R  +A++ L ERS LMA +ARKT+A P NA ++ RI ++E DV L G+ R  AGL +N +
Sbjct: 32  RCPKARVTLVERSGLMAGFARKTIAHPLNAALAGRIDILEADVALKGKARVFAGLADNSF 91

Query: 92  DHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLI 151
           D  IMNPPFNE     TPD +K EAHVM E  FE+W+RTA AI++  G +++IARP S+ 
Sbjct: 92  DFAIMNPPFNEPRDRTTPDPLKAEAHVMPEGMFEQWVRTAAAIVKPGGGIAIIARPGSIR 151

Query: 152 QIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRF 211
            I++A   R G L+I  + PR    A RI++TG +G R  L     ++LH   G  ++  
Sbjct: 152 PILDALGGRFGGLKIVAIQPRADAPAIRIVITGTRGSRAGLSLMPALILHGDEGHGFTAR 211

Query: 212 VTDLINGKRSL 222
              + NG  SL
Sbjct: 212 ADAINNGLSSL 222


>gi|256044115|ref|ZP_05447026.1| methyltransferase small [Brucella melitensis bv. 1 str. Rev.1]
          Length = 238

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 85/191 (44%), Positives = 118/191 (61%)

Query: 32  RLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFY 91
           R  +A++ L ERS LMA +ARKT+A P NA ++ RI ++E DV L G+ R  AGL +N +
Sbjct: 47  RCPKARVTLVERSGLMAGFARKTIAHPLNAALAGRIDILEADVALKGKARVFAGLADNSF 106

Query: 92  DHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLI 151
           D  IMNPPFNE     TPD +K EAHVM E  FE+W+RTA AI++  G +++IARP S+ 
Sbjct: 107 DFAIMNPPFNEPRDRTTPDPLKAEAHVMPEGMFEQWVRTAAAIVKPGGGIAIIARPGSIR 166

Query: 152 QIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRF 211
            I++A   R G L+I  + PR    A RI++TG +G R  L     ++LH   G  ++  
Sbjct: 167 PILDALGGRFGGLKIVAIQPRADAPAIRIVITGTRGSRAGLSLMPALILHGDEGHGFTAR 226

Query: 212 VTDLINGKRSL 222
              + NG  SL
Sbjct: 227 ADAINNGLSSL 237


>gi|17987817|ref|NP_540451.1| methyltransferase [Brucella melitensis bv. 1 str. 16M]
 gi|161618373|ref|YP_001592260.1| methyltransferase small [Brucella canis ATCC 23365]
 gi|163842681|ref|YP_001627085.1| methyltransferase small [Brucella suis ATCC 23445]
 gi|189023637|ref|YP_001934405.1| methyltransferase [Brucella abortus S19]
 gi|225626908|ref|ZP_03784947.1| methyltransferase [Brucella ceti str. Cudo]
 gi|225851935|ref|YP_002732168.1| methyltransferase small [Brucella melitensis ATCC 23457]
 gi|237814872|ref|ZP_04593870.1| methyltransferase [Brucella abortus str. 2308 A]
 gi|254693182|ref|ZP_05155010.1| methyltransferase small [Brucella abortus bv. 3 str. Tulya]
 gi|254696826|ref|ZP_05158654.1| methyltransferase small [Brucella abortus bv. 2 str. 86/8/59]
 gi|254709547|ref|ZP_05171358.1| methyltransferase small [Brucella pinnipedialis B2/94]
 gi|256112917|ref|ZP_05453830.1| methyltransferase small [Brucella melitensis bv. 3 str. Ether]
 gi|256256946|ref|ZP_05462482.1| methyltransferase small [Brucella abortus bv. 9 str. C68]
 gi|260563476|ref|ZP_05833962.1| methyltransferase [Brucella melitensis bv. 1 str. 16M]
 gi|260754177|ref|ZP_05866525.1| methyltransferase small [Brucella abortus bv. 6 str. 870]
 gi|260761221|ref|ZP_05873564.1| methyltransferase small [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883202|ref|ZP_05894816.1| methyltransferase [Brucella abortus bv. 9 str. C68]
 gi|261213424|ref|ZP_05927705.1| methyltransferase small [Brucella abortus bv. 3 str. Tulya]
 gi|261218412|ref|ZP_05932693.1| methyltransferase small [Brucella ceti M13/05/1]
 gi|261221615|ref|ZP_05935896.1| methyltransferase [Brucella ceti B1/94]
 gi|261315358|ref|ZP_05954555.1| methyltransferase small [Brucella pinnipedialis M163/99/10]
 gi|261317075|ref|ZP_05956272.1| methyltransferase small [Brucella pinnipedialis B2/94]
 gi|261751745|ref|ZP_05995454.1| methyltransferase small [Brucella suis bv. 5 str. 513]
 gi|265988113|ref|ZP_06100670.1| methyltransferase [Brucella pinnipedialis M292/94/1]
 gi|265994357|ref|ZP_06106914.1| methyltransferase [Brucella melitensis bv. 3 str. Ether]
 gi|265997578|ref|ZP_06110135.1| methyltransferase small [Brucella ceti M490/95/1]
 gi|17983544|gb|AAL52715.1| methyltransferase [Brucella melitensis bv. 1 str. 16M]
 gi|161335184|gb|ABX61489.1| methyltransferase small [Brucella canis ATCC 23365]
 gi|163673404|gb|ABY37515.1| methyltransferase small [Brucella suis ATCC 23445]
 gi|189019209|gb|ACD71931.1| Methyltransferase [Brucella abortus S19]
 gi|225618565|gb|EEH15608.1| methyltransferase [Brucella ceti str. Cudo]
 gi|225640300|gb|ACO00214.1| methyltransferase small [Brucella melitensis ATCC 23457]
 gi|237789709|gb|EEP63919.1| methyltransferase [Brucella abortus str. 2308 A]
 gi|260153492|gb|EEW88584.1| methyltransferase [Brucella melitensis bv. 1 str. 16M]
 gi|260671653|gb|EEX58474.1| methyltransferase small [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674285|gb|EEX61106.1| methyltransferase small [Brucella abortus bv. 6 str. 870]
 gi|260872730|gb|EEX79799.1| methyltransferase [Brucella abortus bv. 9 str. C68]
 gi|260915031|gb|EEX81892.1| methyltransferase small [Brucella abortus bv. 3 str. Tulya]
 gi|260920199|gb|EEX86852.1| methyltransferase [Brucella ceti B1/94]
 gi|260923501|gb|EEX90069.1| methyltransferase small [Brucella ceti M13/05/1]
 gi|261296298|gb|EEX99794.1| methyltransferase small [Brucella pinnipedialis B2/94]
 gi|261304384|gb|EEY07881.1| methyltransferase small [Brucella pinnipedialis M163/99/10]
 gi|261741498|gb|EEY29424.1| methyltransferase small [Brucella suis bv. 5 str. 513]
 gi|262552046|gb|EEZ08036.1| methyltransferase small [Brucella ceti M490/95/1]
 gi|262765470|gb|EEZ11259.1| methyltransferase [Brucella melitensis bv. 3 str. Ether]
 gi|264660310|gb|EEZ30571.1| methyltransferase [Brucella pinnipedialis M292/94/1]
 gi|326408433|gb|ADZ65498.1| Methyltransferase [Brucella melitensis M28]
          Length = 260

 Score =  166 bits (421), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 85/191 (44%), Positives = 118/191 (61%)

Query: 32  RLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFY 91
           R  +A++ L ERS LMA +ARKT+A P NA ++ RI ++E DV L G+ R  AGL +N +
Sbjct: 69  RCPKARVTLVERSGLMAGFARKTIAHPLNAALAGRIDILEADVALKGKARVFAGLADNSF 128

Query: 92  DHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLI 151
           D  IMNPPFNE     TPD +K EAHVM E  FE+W+RTA AI++  G +++IARP S+ 
Sbjct: 129 DFAIMNPPFNEPRDRTTPDPLKAEAHVMPEGMFEQWVRTAAAIVKPGGGIAIIARPGSIR 188

Query: 152 QIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRF 211
            I++A   R G L+I  + PR    A RI++TG +G R  L     ++LH   G  ++  
Sbjct: 189 PILDALGGRFGGLKIVAIQPRADAPAIRIVITGTRGSRAGLSLMPALILHGDEGHGFTAR 248

Query: 212 VTDLINGKRSL 222
              + NG  SL
Sbjct: 249 ADAINNGLSSL 259


>gi|23501303|ref|NP_697430.1| hypothetical protein BR0399 [Brucella suis 1330]
 gi|62289386|ref|YP_221179.1| hypothetical protein BruAb1_0422 [Brucella abortus bv. 1 str.
           9-941]
 gi|82699313|ref|YP_413887.1| cytosine-N4-specific DNA-methyltransferase [Brucella melitensis
           biovar Abortus 2308]
 gi|148558914|ref|YP_001258423.1| hypothetical protein BOV_0408 [Brucella ovis ATCC 25840]
 gi|254688699|ref|ZP_05151953.1| methyltransferase small [Brucella abortus bv. 6 str. 870]
 gi|254701206|ref|ZP_05163034.1| methyltransferase small [Brucella suis bv. 5 str. 513]
 gi|254707868|ref|ZP_05169696.1| methyltransferase small [Brucella pinnipedialis M163/99/10]
 gi|254716611|ref|ZP_05178422.1| methyltransferase small [Brucella ceti M13/05/1]
 gi|256031041|ref|ZP_05444655.1| methyltransferase small [Brucella pinnipedialis M292/94/1]
 gi|256159105|ref|ZP_05456926.1| methyltransferase small [Brucella ceti M490/95/1]
 gi|256254444|ref|ZP_05459980.1| methyltransferase small [Brucella ceti B1/94]
 gi|256368855|ref|YP_003106361.1| hypothetical protein BMI_I403 [Brucella microti CCM 4915]
 gi|23347191|gb|AAN29345.1| conserved hypothetical protein [Brucella suis 1330]
 gi|62195518|gb|AAX73818.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941]
 gi|82615414|emb|CAJ10383.1| SAM (and some other nucleotide) binding motif:Site-specific
           DNA-methyltransferase (cytosine-N4-specific):N-6
           Adenine-specific [Brucella melitensis biovar Abortus
           2308]
 gi|148370171|gb|ABQ60150.1| conserved hypothetical protein [Brucella ovis ATCC 25840]
 gi|255999013|gb|ACU47412.1| hypothetical protein BMI_I403 [Brucella microti CCM 4915]
          Length = 252

 Score =  166 bits (421), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 85/191 (44%), Positives = 118/191 (61%)

Query: 32  RLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFY 91
           R  +A++ L ERS LMA +ARKT+A P NA ++ RI ++E DV L G+ R  AGL +N +
Sbjct: 61  RCPKARVTLVERSGLMAGFARKTIAHPLNAALAGRIDILEADVALKGKARVFAGLADNSF 120

Query: 92  DHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLI 151
           D  IMNPPFNE     TPD +K EAHVM E  FE+W+RTA AI++  G +++IARP S+ 
Sbjct: 121 DFAIMNPPFNEPRDRTTPDPLKAEAHVMPEGMFEQWVRTAAAIVKPGGGIAIIARPGSIR 180

Query: 152 QIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRF 211
            I++A   R G L+I  + PR    A RI++TG +G R  L     ++LH   G  ++  
Sbjct: 181 PILDALGGRFGGLKIVAIQPRADAPAIRIVITGTRGSRAGLSLMPALILHGDEGHGFTAR 240

Query: 212 VTDLINGKRSL 222
              + NG  SL
Sbjct: 241 ADAINNGLSSL 251


>gi|254703752|ref|ZP_05165580.1| methyltransferase small [Brucella suis bv. 3 str. 686]
 gi|261754399|ref|ZP_05998108.1| methyltransferase small [Brucella suis bv. 3 str. 686]
 gi|261744152|gb|EEY32078.1| methyltransferase small [Brucella suis bv. 3 str. 686]
          Length = 204

 Score =  166 bits (421), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 85/191 (44%), Positives = 118/191 (61%)

Query: 32  RLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFY 91
           R  +A++ L ERS LMA +ARKT+A P NA ++ RI ++E DV L G+ R  AGL +N +
Sbjct: 13  RCPKARVTLVERSGLMAGFARKTIAHPLNAALAGRIDILEADVALKGKARVFAGLADNSF 72

Query: 92  DHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLI 151
           D  IMNPPFNE     TPD +K EAHVM E  FE+W+RTA AI++  G +++IARP S+ 
Sbjct: 73  DFAIMNPPFNEPRDRTTPDPLKAEAHVMPEGMFEQWVRTAAAIVKPGGGIAIIARPGSIR 132

Query: 152 QIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRF 211
            I++A   R G L+I  + PR    A RI++TG +G R  L     ++LH   G  ++  
Sbjct: 133 PILDALGGRFGGLKIVAIQPRADAPAIRIVITGTRGSRAGLSLMPALILHGDEGHGFTAR 192

Query: 212 VTDLINGKRSL 222
              + NG  SL
Sbjct: 193 ADAINNGLSSL 203


>gi|297247799|ref|ZP_06931517.1| cytosine-N4-specific DNA-methyltransferase [Brucella abortus bv. 5
           str. B3196]
 gi|297174968|gb|EFH34315.1| cytosine-N4-specific DNA-methyltransferase [Brucella abortus bv. 5
           str. B3196]
          Length = 203

 Score =  166 bits (421), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 85/191 (44%), Positives = 118/191 (61%)

Query: 32  RLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFY 91
           R  +A++ L ERS LMA +ARKT+A P NA ++ RI ++E DV L G+ R  AGL +N +
Sbjct: 12  RCPKARVTLVERSGLMAGFARKTIAHPLNAALAGRIDILEADVALKGKARVFAGLADNSF 71

Query: 92  DHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLI 151
           D  IMNPPFNE     TPD +K EAHVM E  FE+W+RTA AI++  G +++IARP S+ 
Sbjct: 72  DFAIMNPPFNEPRDRTTPDPLKAEAHVMPEGMFEQWVRTAAAIVKPGGGIAIIARPGSIR 131

Query: 152 QIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRF 211
            I++A   R G L+I  + PR    A RI++TG +G R  L     ++LH   G  ++  
Sbjct: 132 PILDALGGRFGGLKIVAIQPRADAPAIRIVITGTRGSRAGLSLMPALILHGDEGHGFTAR 191

Query: 212 VTDLINGKRSL 222
              + NG  SL
Sbjct: 192 ADAINNGLSSL 202


>gi|256264555|ref|ZP_05467087.1| methyltransferase [Brucella melitensis bv. 2 str. 63/9]
 gi|263094918|gb|EEZ18626.1| methyltransferase [Brucella melitensis bv. 2 str. 63/9]
          Length = 208

 Score =  166 bits (421), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 85/191 (44%), Positives = 118/191 (61%)

Query: 32  RLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFY 91
           R  +A++ L ERS LMA +ARKT+A P NA ++ RI ++E DV L G+ R  AGL +N +
Sbjct: 17  RCPKARVTLVERSGLMAGFARKTIAHPLNAALAGRIDILEADVALKGKARVFAGLADNSF 76

Query: 92  DHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLI 151
           D  IMNPPFNE     TPD +K EAHVM E  FE+W+RTA AI++  G +++IARP S+ 
Sbjct: 77  DFAIMNPPFNEPRDRTTPDPLKAEAHVMPEGMFEQWVRTAAAIVKPGGGIAIIARPGSIR 136

Query: 152 QIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRF 211
            I++A   R G L+I  + PR    A RI++TG +G R  L     ++LH   G  ++  
Sbjct: 137 PILDALGGRFGGLKIVAIQPRADAPAIRIVITGTRGSRAGLSLMPALILHGDEGHGFTAR 196

Query: 212 VTDLINGKRSL 222
              + NG  SL
Sbjct: 197 ADAINNGLSSL 207


>gi|254713036|ref|ZP_05174847.1| hypothetical protein BcetM6_06649 [Brucella ceti M644/93/1]
          Length = 202

 Score =  166 bits (421), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 85/191 (44%), Positives = 118/191 (61%)

Query: 32  RLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFY 91
           R  +A++ L ERS LMA +ARKT+A P NA ++ RI ++E DV L G+ R  AGL +N +
Sbjct: 11  RCPKARVTLVERSGLMAGFARKTIAHPLNAALAGRIDILEADVALKGKARVFAGLADNSF 70

Query: 92  DHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLI 151
           D  IMNPPFNE     TPD +K EAHVM E  FE+W+RTA AI++  G +++IARP S+ 
Sbjct: 71  DFAIMNPPFNEPRDRTTPDPLKAEAHVMPEGMFEQWVRTAAAIVKPGGGIAIIARPGSIR 130

Query: 152 QIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRF 211
            I++A   R G L+I  + PR    A RI++TG +G R  L     ++LH   G  ++  
Sbjct: 131 PILDALGGRFGGLKIVAIQPRADAPAIRIVITGTRGSRAGLSLMPALILHGDEGHGFTAR 190

Query: 212 VTDLINGKRSL 222
              + NG  SL
Sbjct: 191 ADAINNGLSSL 201


>gi|261324530|ref|ZP_05963727.1| methyltransferase [Brucella neotomae 5K33]
 gi|261300510|gb|EEY04007.1| methyltransferase [Brucella neotomae 5K33]
          Length = 260

 Score =  165 bits (417), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 84/191 (43%), Positives = 118/191 (61%)

Query: 32  RLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFY 91
           R  +A++ L ERS LMA +ARKT+A P NA ++ RI ++E DV L G+ R  AGL +N +
Sbjct: 69  RCPKARVTLVERSGLMAGFARKTIAHPLNAALAGRIDILEADVALKGKARVFAGLADNSF 128

Query: 92  DHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLI 151
           D  I+NPPFNE     TPD +K EAHVM E  FE+W+RTA AI++  G +++IARP S+ 
Sbjct: 129 DFAIINPPFNEPRDRTTPDPLKAEAHVMPEGMFEQWVRTAAAIVKPGGGIAIIARPGSIR 188

Query: 152 QIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRF 211
            I++A   R G L+I  + PR    A RI++TG +G R  L     ++LH   G  ++  
Sbjct: 189 PILDALGGRFGGLKIVAIQPRADAPAIRIVITGTRGSRAGLSLMPALILHGDEGHGFTAR 248

Query: 212 VTDLINGKRSL 222
              + NG  SL
Sbjct: 249 ADAINNGLSSL 259


>gi|256060535|ref|ZP_05450703.1| methyltransferase small [Brucella neotomae 5K33]
          Length = 252

 Score =  164 bits (416), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 84/191 (43%), Positives = 118/191 (61%)

Query: 32  RLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFY 91
           R  +A++ L ERS LMA +ARKT+A P NA ++ RI ++E DV L G+ R  AGL +N +
Sbjct: 61  RCPKARVTLVERSGLMAGFARKTIAHPLNAALAGRIDILEADVALKGKARVFAGLADNSF 120

Query: 92  DHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLI 151
           D  I+NPPFNE     TPD +K EAHVM E  FE+W+RTA AI++  G +++IARP S+ 
Sbjct: 121 DFAIINPPFNEPRDRTTPDPLKAEAHVMPEGMFEQWVRTAAAIVKPGGGIAIIARPGSIR 180

Query: 152 QIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRF 211
            I++A   R G L+I  + PR    A RI++TG +G R  L     ++LH   G  ++  
Sbjct: 181 PILDALGGRFGGLKIVAIQPRADAPAIRIVITGTRGSRAGLSLMPALILHGDEGHGFTAR 240

Query: 212 VTDLINGKRSL 222
              + NG  SL
Sbjct: 241 ADAINNGLSSL 251


>gi|49475217|ref|YP_033258.1| hypothetical protein BH04190 [Bartonella henselae str. Houston-1]
 gi|49238022|emb|CAF27228.1| hypothetical protein BH04190 [Bartonella henselae str. Houston-1]
          Length = 263

 Score =  163 bits (413), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 102/225 (45%), Positives = 137/225 (60%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           M+LASLV       + DLGAGAGA GLAVA+R  +  + L ERS  M  YA+KTL L  N
Sbjct: 37  MLLASLVPNNFKGKVVDLGAGAGAVGLAVAARCLDVHVTLVERSAFMVSYAQKTLMLKQN 96

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
             +SKR+ L++ DVTL G +R  AGL +N +D  IMNPPFN  +   TPD+ K EAHVM 
Sbjct: 97  ENLSKRVCLLKADVTLKGRSRLEAGLVDNAFDFAIMNPPFNNPVDRKTPDEKKFEAHVMP 156

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI 180
           E  F+ W+R+A AI++  G L LIARPQSL  I+ A   R G++ + P+H R  + A R+
Sbjct: 157 ESMFDDWLRSAAAIVKPGGYLGLIARPQSLTDILCALEGRFGNICVIPIHARTEKAAIRV 216

Query: 181 LVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSLTRL 225
           L   ++G R  L    P+V+H+     +S  +  + NG  SL  L
Sbjct: 217 LFYAKRGSRAALSLLRPLVIHEDGCHIFSPKIDAINNGHISLWEL 261


>gi|110633066|ref|YP_673274.1| methyltransferase small [Mesorhizobium sp. BNC1]
 gi|110284050|gb|ABG62109.1| methyltransferase small [Chelativorans sp. BNC1]
          Length = 286

 Score =  163 bits (412), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 101/222 (45%), Positives = 136/222 (61%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           M+LA  V    S  +ADLGAGAGAAG AVA+R   A +LL E +  M   AR++  LPAN
Sbjct: 62  MLLAGAVPKGFSGRVADLGAGAGAAGFAVAARCPAASVLLVEHAAEMVGCARQSRDLPAN 121

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
             ++ RI +++ DV L G  R  AGL +  +D +IMNPPFN      TPD++K  AHVM 
Sbjct: 122 TGLAGRIDVLQADVELSGPARKSAGLADRSFDFIIMNPPFNAARDRATPDQLKRAAHVMT 181

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI 180
           E  FE+WIRTA AI R+  ++++IARP SL  I+ A   R GS    P+HPR    A RI
Sbjct: 182 EGLFERWIRTASAIGRARAEVAIIARPASLADILAALEGRFGSPRCLPIHPRPDAEAIRI 241

Query: 181 LVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSL 222
           +V  RKG RG L    P++LH+  G+ ++     +ING+ +L
Sbjct: 242 IVRARKGARGALTLAAPLILHEGGGRDFTMRSDAIINGRETL 283


>gi|319404557|emb|CBI78163.1| methyltransferase [Bartonella rochalimae ATCC BAA-1498]
          Length = 262

 Score =  163 bits (412), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 106/222 (47%), Positives = 133/222 (59%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           M+LA LV +     + DLGAGAGAAGLAVASR  EA I L ERS  M  YA+KTL L  N
Sbjct: 37  MLLAGLVPSGFKGKVVDLGAGAGAAGLAVASRCDEAHITLVERSSFMISYAQKTLMLQQN 96

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
            +++ R+ L++VD+TL G+ R  AGL +N +D  IMNPPFN      TPD+ K EAHVM 
Sbjct: 97  EKLASRVCLLKVDITLRGKERLKAGLMDNAFDFAIMNPPFNSSEDRKTPDEEKLEAHVMS 156

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI 180
           E  FE W R A AI+R  G L LIARPQSL  I+ A   R G++ I P+H      A RI
Sbjct: 157 EAMFENWFRCASAIVRPGGYLGLIARPQSLNDILYALKGRFGNVCIVPVHSHAETAAIRI 216

Query: 181 LVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSL 222
           L   ++G R  L    P+V+H+     +   V  + NG  SL
Sbjct: 217 LFYAKRGSRAGLSILPPLVMHESGSHVFLPRVNAINNGYISL 258


>gi|239831274|ref|ZP_04679603.1| methyltransferase small [Ochrobactrum intermedium LMG 3301]
 gi|239823541|gb|EEQ95109.1| methyltransferase small [Ochrobactrum intermedium LMG 3301]
          Length = 260

 Score =  162 bits (411), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 84/192 (43%), Positives = 115/192 (59%)

Query: 32  RLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFY 91
           R   A + L ERS  MA +ARK++  P NA ++ R+++IE DV L G+ R  AGL +N +
Sbjct: 69  RCAGATVTLVERSAFMAGFARKSIDHPLNAALADRVNVIEADVALRGKARIAAGLADNSF 128

Query: 92  DHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLI 151
           D  IMNPPFNE     TPD +K EAHVM E  FE+W+RTA AI++  G +++IARP S+ 
Sbjct: 129 DFAIMNPPFNEARDRSTPDPLKAEAHVMPEGMFEQWVRTAAAIVKPGGGIAIIARPGSIS 188

Query: 152 QIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRF 211
            I+ A + R G L I P+ PR    A RI+VTG +G R  L     +VLH   G  ++  
Sbjct: 189 PILEALSGRFGGLRIVPVQPRPDAAAIRIVVTGIRGSRAGLSLMPALVLHGSEGHGFTPR 248

Query: 212 VTDLINGKRSLT 223
              + NG  +L 
Sbjct: 249 ADGINNGLDALV 260


>gi|319406066|emb|CBI79696.1| methyltransferase [Bartonella sp. AR 15-3]
          Length = 262

 Score =  162 bits (411), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 104/222 (46%), Positives = 135/222 (60%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           M+LA LV +     + DLGAGAGAAGLAVASR  EA I L ERSP M  YA+KTL L  N
Sbjct: 37  MLLAGLVPSGFKGKVVDLGAGAGAAGLAVASRCVEAHITLVERSPFMISYAQKTLMLKQN 96

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
            ++++R+ L++VD+TL G+ R  AGL +N +D  IMNPPFN      TPD+ K EAHVM 
Sbjct: 97  EKLARRVCLLKVDITLKGKERLKAGLMDNAFDFAIMNPPFNSSADRKTPDEEKLEAHVMP 156

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI 180
           E  FE W R A AI++  G L LIARP+SL  I+ A   R G++ I P+H      A RI
Sbjct: 157 EAMFENWFRCASAIVKPGGYLGLIARPRSLNDILYALKGRFGNVCIIPVHSHAETAAIRI 216

Query: 181 LVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSL 222
           L   ++G R  L    P+V H+ +   +   +  + NG  SL
Sbjct: 217 LFYAKRGSRAGLSILPPLVTHESDSHVFLPRINAINNGYISL 258


>gi|319407550|emb|CBI81200.1| methyltransferase [Bartonella sp. 1-1C]
          Length = 262

 Score =  161 bits (408), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 105/222 (47%), Positives = 133/222 (59%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           M+LA LV +     + DLGAGAGAAGLAVASR  E+ I L ERS  M  YA+KTL L  N
Sbjct: 37  MLLAGLVPSGFKGKVVDLGAGAGAAGLAVASRCTESHITLVERSSFMISYAQKTLMLQQN 96

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
            +++ R+ L++VD+TL G+ R  AGL +N +D  IMNPPFN      TPD+ K EAHVM 
Sbjct: 97  EKLASRVCLLKVDITLRGKERLKAGLMDNAFDFAIMNPPFNSSEDRKTPDEEKLEAHVMS 156

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI 180
           E  FE W R A AI+R  G L LIARPQSL  I+ A   R G++ I P+H      A RI
Sbjct: 157 EAMFENWFRCASAIVRPGGYLGLIARPQSLNDILCALKGRFGNVCIVPVHSHAETAAIRI 216

Query: 181 LVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSL 222
           L   ++G R  L    P+V+H+     +   V  + NG  SL
Sbjct: 217 LFYAKRGSRAGLSILSPLVMHESGSHVFLPRVNAINNGCISL 258


>gi|163867859|ref|YP_001609063.1| methyltransferase [Bartonella tribocorum CIP 105476]
 gi|161017510|emb|CAK01068.1| methyltransferase [Bartonella tribocorum CIP 105476]
          Length = 262

 Score =  161 bits (407), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 107/225 (47%), Positives = 135/225 (60%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           M+LASLV       +ADLGAGAGAAGLA+ASR  +  + L ERS  M  YA+KTL L  N
Sbjct: 37  MLLASLVPTDLKGKVADLGAGAGAAGLAIASRCPQVHVTLVERSSFMVSYAQKTLMLKQN 96

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
            Q + RI L+E DVTL G  R  AGL +N +D  IMNPPFN      TPDK K EAHVM 
Sbjct: 97  KQFTGRICLLEADVTLKGNARITAGLIDNSFDFAIMNPPFNNPTDRKTPDKQKSEAHVMP 156

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI 180
           E  F+ W+R+A AI++  G L LIARPQSL  I++A   R G + I P+H R    A R+
Sbjct: 157 EAMFDNWLRSAAAIVKPGGYLGLIARPQSLTDILHALEGRFGGICIIPIHARATTPAIRL 216

Query: 181 LVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSLTRL 225
           L   R+G R  L     +++H+ N   +S  +  + NG  SL  L
Sbjct: 217 LFYARRGSRAALSILPALIIHEGNSHIFSPRIDAINNGYISLWEL 261


>gi|319408200|emb|CBI81853.1| methyltransferase [Bartonella schoenbuchensis R1]
          Length = 262

 Score =  160 bits (405), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 101/225 (44%), Positives = 137/225 (60%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           M+LA LV       + DLGAGAGAAGLAVA+R  E  + L ERS  M  YA+KTLAL  N
Sbjct: 37  MLLAGLVPDNFKGKVVDLGAGAGAAGLAVAARCLETHVTLVERSAFMISYAQKTLALKQN 96

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
            +++ R+ L+E D+ L G  R  AGL +N +D  IMNPPFN  +   TPD+ K EAHVM 
Sbjct: 97  KELASRVCLLEADIALKGNARLKAGLMDNVFDFAIMNPPFNNPMDRKTPDEQKSEAHVMP 156

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI 180
           E  F+ W+R+A AI++  G L LIARPQSL  I++A   R G++ + P+H R    A+R+
Sbjct: 157 EAMFDNWLRSAAAIVKPGGYLGLIARPQSLNDILHALEGRFGNICVIPVHSRAKAAATRM 216

Query: 181 LVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSLTRL 225
           L   ++G R  L     +++H+  G  +S  V  + NG  SL  L
Sbjct: 217 LFYAKRGSRAALSILPALIVHEDEGHAFSPRVDAINNGCISLWEL 261


>gi|319899202|ref|YP_004159295.1| methyltransferase [Bartonella clarridgeiae 73]
 gi|319403166|emb|CBI76725.1| methyltransferase [Bartonella clarridgeiae 73]
          Length = 262

 Score =  160 bits (405), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 103/222 (46%), Positives = 132/222 (59%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           M+LA LV +     + DLGAGAGAAGLAVASR  EA I L ERS  M  YA+KTLAL  N
Sbjct: 37  MLLAGLVPSGFKGKVVDLGAGAGAAGLAVASRCIEAHITLVERSSFMISYAQKTLALKQN 96

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
            ++  R+ L++ D+TL G+ R  AGL NN +D  IMNPPFN      TPD+ K +AHVM 
Sbjct: 97  EKLVSRVCLLKADITLKGKERLKAGLMNNVFDFAIMNPPFNSSADRKTPDEEKLKAHVMP 156

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI 180
           E  FE W R A AI++  G L LIARPQSL  I+ A   R G++ I P+H      A RI
Sbjct: 157 ESMFENWFRCASAIVKPGGYLGLIARPQSLTDILYALEGRFGNVFIIPIHSHVETSAIRI 216

Query: 181 LVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSL 222
           L   ++G R  L     +++H+     +S  +  + NG  SL
Sbjct: 217 LFYAKRGSRAGLSILPALIVHESGSHVFSPRIDAINNGYISL 258


>gi|260460357|ref|ZP_05808609.1| methyltransferase small [Mesorhizobium opportunistum WSM2075]
 gi|259034002|gb|EEW35261.1| methyltransferase small [Mesorhizobium opportunistum WSM2075]
          Length = 271

 Score =  155 bits (393), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 102/222 (45%), Positives = 138/222 (62%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           MILA+ V ++ S  LAD GAGAGAAGLAV SR   A  +L ER+P MA +A  TLA P N
Sbjct: 47  MILAASVPSSFSGRLADFGAGAGAAGLAVLSRCPGAAAVLVERAPEMAAFAAATLAHPGN 106

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
           A +S R S++  DVT+ G  R  +GL +N +D VIMNPPFN      TP  +++EAHVM 
Sbjct: 107 AHLSDRASVLVADVTMSGRARAASGLADNDFDFVIMNPPFNAPRDRATPAPLRKEAHVME 166

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI 180
           +  FE WIR+A A++R  G+L++IARP+ L  +++A + R G  E+  +HPR    A RI
Sbjct: 167 DGLFESWIRSAAAVVRPRGRLAVIARPEQLGALLDAISGRFGDAEMLAVHPRPDAAAIRI 226

Query: 181 LVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSL 222
           +V    G RG+L  R P++LH  +G         + NG  SL
Sbjct: 227 VVRATLGARGKLAIRPPLMLHALSGNGPDERSEMITNGLASL 268


>gi|261320739|ref|ZP_05959936.1| methyltransferase small [Brucella ceti M644/93/1]
 gi|261293429|gb|EEX96925.1| methyltransferase small [Brucella ceti M644/93/1]
          Length = 177

 Score =  155 bits (393), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 108/176 (61%)

Query: 47  MAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGT 106
           MA +ARKT+A P NA ++ RI ++E DV L G+ R  AGL +N +D  IMNPPFNE    
Sbjct: 1   MAGFARKTIAHPLNAALAGRIDILEADVALKGKARVFAGLADNSFDFAIMNPPFNEPRDR 60

Query: 107 MTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEI 166
            TPD +K EAHVM E  FE+W+RTA AI++  G +++IARP S+  I++A   R G L+I
Sbjct: 61  TTPDPLKAEAHVMPEGMFEQWVRTAAAIVKPGGGIAIIARPGSIRPILDALGGRFGGLKI 120

Query: 167 TPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSL 222
             + PR    A RI++TG +G R  L     ++LH   G  ++     + NG  SL
Sbjct: 121 VAIQPRADAPAIRIVITGTRGSRAGLSLMPALILHGDEGHGFTARADAINNGLSSL 176


>gi|319784753|ref|YP_004144229.1| methyltransferase small [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317170641|gb|ADV14179.1| methyltransferase small [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 266

 Score =  149 bits (375), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 103/222 (46%), Positives = 140/222 (63%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           M+LA+ V ++ +  LAD GAGAGAAGLAV SR   A+ +L ER+P MA +A  TLA P N
Sbjct: 42  MMLAASVPSSLAGRLADFGAGAGAAGLAVLSRCPAAEAVLVERAPEMAAFAAATLAHPGN 101

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
           A +S R S++  DVT+ G  R  AGL +N +D VIMNPPFN      +PD++++EAHVM 
Sbjct: 102 AHLSDRASVLVADVTVSGRARAAAGLADNDFDFVIMNPPFNAPRDRASPDRLRKEAHVME 161

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI 180
           +  FE WIR+A A++R  G L++IARP+ L  I++A A R G  E+  +HPR    A RI
Sbjct: 162 DGVFESWIRSAAAVVRPRGGLAVIARPEQLGAILDAIAGRFGDAEMLAVHPRPDAAAIRI 221

Query: 181 LVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSL 222
           +V    G RG+L  R P++LH  +G         + NG  SL
Sbjct: 222 VVRAALGARGKLAIRPPLMLHAQSGNGPDERSEMITNGLASL 263


>gi|328543226|ref|YP_004303335.1| methyltransferase small domain family [polymorphum gilvum
           SL003B-26A1]
 gi|326412972|gb|ADZ70035.1| Methyltransferase small domain family [Polymorphum gilvum
           SL003B-26A1]
          Length = 265

 Score =  148 bits (373), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 79/209 (37%), Positives = 120/209 (57%), Gaps = 2/209 (0%)

Query: 2   ILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANA 61
           + A+L +AT   H+ DLGAG G AG+ VA+RL    + L +R P++   AR++LA P NA
Sbjct: 39  LAAALPDAT-CGHVVDLGAGVGTAGMCVAARLPSVTVTLVDRDPVVLDLARRSLADPLNA 97

Query: 62  QISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIG-TMTPDKIKEEAHVML 120
             + R++++EVD+   G  R+ AGL     DH IMNPP+ +R     +P   +  AHV+ 
Sbjct: 98  AFADRVAVLEVDIAARGSLRHAAGLTPGLADHAIMNPPYYDRARFRASPADARAGAHVLG 157

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI 180
           E   + W RTA  I+R  G L++I R   L +I++    R G++++ PL PR    A+RI
Sbjct: 158 EHGLDPWARTATDIVREGGTLTVIFRADGLREILDVLDGRFGAIDVIPLRPRPDAAATRI 217

Query: 181 LVTGRKGMRGQLRFRYPIVLHKPNGQPYS 209
           LV   +  R  LR     VLH+ +G  ++
Sbjct: 218 LVRAVRASRAPLRLMPGFVLHEGDGSDFT 246


>gi|307945558|ref|ZP_07660894.1| methyltransferase small [Roseibium sp. TrichSKD4]
 gi|307771431|gb|EFO30656.1| methyltransferase small [Roseibium sp. TrichSKD4]
          Length = 268

 Score =  138 bits (348), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 75/210 (35%), Positives = 116/210 (55%), Gaps = 3/210 (1%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           + LA+ +    + H+ DLGAG G AG   ASRL    + L +  P++ + AR  L+ P N
Sbjct: 40  VYLAAALPDDTTGHVVDLGAGVGTAGYCAASRLENISVSLVDIDPVVLNLARHGLSDPEN 99

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNE--RIGTMTPDKIKEEAHV 118
           A  + RI ++E D+T  G  R+ +GL  N  DHVIMNPP+ E  R    +P   K  AH+
Sbjct: 100 ASFAGRIKILEADITAKGNIRHSSGLTPNLADHVIMNPPYYEADRF-RASPKTDKVGAHM 158

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECAS 178
           + E   + W +TA  I+R  G L++I R   L  ++   ++R G+++I P+HPR G  A+
Sbjct: 159 LDERGLDPWAKTATDIVRDGGSLTMIFRADGLQDVLQVLSKRFGAIDILPMHPRPGAPAT 218

Query: 179 RILVTGRKGMRGQLRFRYPIVLHKPNGQPY 208
           RIL+   +  +  L+    +VLH   G  +
Sbjct: 219 RILLRAIRASKAPLQLLPGLVLHTSEGSEF 248


>gi|254505022|ref|ZP_05117173.1| Methyltransferase small domain family [Labrenzia alexandrii DFL-11]
 gi|222441093|gb|EEE47772.1| Methyltransferase small domain family [Labrenzia alexandrii DFL-11]
          Length = 275

 Score =  137 bits (344), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 76/213 (35%), Positives = 114/213 (53%), Gaps = 3/213 (1%)

Query: 12  SFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIE 71
           S H+ DLGAG G AG   A+RL E  +   E    +   AR+ L  PAN+  + RI L+E
Sbjct: 58  SGHIVDLGAGVGTAGFCAAARLPEISVTAVELDQTVLDLAREGLTDPANSAFADRIHLLE 117

Query: 72  VDVTLVGENRNLAGLKNNFYDHVIMNPPFNE--RIGTMTPDKIKEEAHVMLEDSFEKWIR 129
            D+T  G  R+ AGLK++  DHVIMNPP+ E  R    +P   +  AH++ E   E W++
Sbjct: 118 ADITAKGRMRHAAGLKSSMADHVIMNPPYYEANRF-RASPKTARAGAHMLDERGLEPWVK 176

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRILVTGRKGMR 189
           TA  I++  G L++I R   L +I+N  + R G++++ PL PR    A+R+LV   +  +
Sbjct: 177 TATDIVKVGGTLTIIFRADGLSEILNVLSGRFGAIDVIPLRPRPDAAATRVLVRAVRASK 236

Query: 190 GQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSL 222
             L      VLH   G  ++     ++   R L
Sbjct: 237 APLTLLPGFVLHDGPGNEFTPEAKTILRDGRGL 269


>gi|118593446|ref|ZP_01550826.1| methyltransferase [Stappia aggregata IAM 12614]
 gi|118433925|gb|EAV40583.1| methyltransferase [Stappia aggregata IAM 12614]
          Length = 269

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 70/198 (35%), Positives = 109/198 (55%), Gaps = 3/198 (1%)

Query: 14  HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVD 73
           H+ DLGAG G AG   A+RL E ++ L +    +   AR+ L  PAN   S R+SL+E D
Sbjct: 55  HVVDLGAGVGTAGFCAAARLPEIKVTLVDIDETVLALARRGLEDPANRAFSDRVSLLEAD 114

Query: 74  VTLVGENRNLAGLKNNFYDHVIMNPPFNE--RIGTMTPDKIKEEAHVMLEDSFEKWIRTA 131
           +T  G  R+ AGL     DH IMNPP+ E  R    +P+  +  AH++ +   E W +TA
Sbjct: 115 ITAKGSVRHAAGLTPALADHAIMNPPYYEADRF-RASPNSARAGAHMLDDRGLEPWAKTA 173

Query: 132 CAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQ 191
             I++  G L++I R   L ++++    R G++E+ PL PR    A+R+L+   +  +  
Sbjct: 174 TDIVKEGGSLTVIFRADGLQELLSVLKGRFGAIEVIPLRPRPEAAATRVLLRAIRASKAP 233

Query: 192 LRFRYPIVLHKPNGQPYS 209
           LR     VLH+ +G  ++
Sbjct: 234 LRLMPGFVLHEGDGSDFT 251


>gi|254470119|ref|ZP_05083523.1| conserved hypothetical protein [Pseudovibrio sp. JE062]
 gi|211960430|gb|EEA95626.1| conserved hypothetical protein [Pseudovibrio sp. JE062]
          Length = 267

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 74/222 (33%), Positives = 115/222 (51%), Gaps = 2/222 (0%)

Query: 2   ILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANA 61
           + ASL  +T    L DLG G G A    A RL   + +  E  P+ A  ARK L+LP NA
Sbjct: 42  LAASLPESTAG-TLYDLGTGVGTAAFCAAHRLPAIKAVGVEVDPVTAALARKGLSLPENA 100

Query: 62  QISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIG-TMTPDKIKEEAHVML 120
             + R+S++E ++T  G  R+ +GL ++  DHVIMNPP+ +     +TP   +  AH + 
Sbjct: 101 SFADRVSILEANLTAKGSIRHQSGLGSSIADHVIMNPPYYDSTRFRVTPQSDRAPAHALD 160

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI 180
           E   E WI+TA  +++  G LS+I R   L  ++    RR G+++I P+ P     A+RI
Sbjct: 161 ERGIEPWIKTAKDLLKDGGTLSIIFRADGLQDLLGPMQRRFGAIDIIPIRPTADAPATRI 220

Query: 181 LVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSL 222
           +V      R  L+      LH+  G  ++   T ++   + L
Sbjct: 221 IVRAVAASRAPLQILPGFTLHEEAGGAFTAQATTVMRDGKGL 262


>gi|218678761|ref|ZP_03526658.1| putative methyltransferase protein [Rhizobium etli CIAT 894]
          Length = 112

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 73/111 (65%)

Query: 115 EAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREG 174
           EAH M +  FE WIRTA AIM   GQLSLIARP+S+ +IV+AC RR G +E+T +HPR G
Sbjct: 2   EAHAMTDGLFESWIRTAGAIMIPGGQLSLIARPESIAEIVDACGRRFGGIEVTAIHPRPG 61

Query: 175 ECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSLTRL 225
           E A RILVT  KG R +L  R  +++H+     +S  V D  NG+ +  RL
Sbjct: 62  ENAVRILVTAIKGSRARLSLRAALIMHEEGSHKFSPLVDDFNNGRAAYARL 112


>gi|304393459|ref|ZP_07375387.1| methyltransferase small [Ahrensia sp. R2A130]
 gi|303294466|gb|EFL88838.1| methyltransferase small [Ahrensia sp. R2A130]
          Length = 253

 Score =  112 bits (279), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 71/225 (31%), Positives = 115/225 (51%), Gaps = 10/225 (4%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+ V+A+ +  +ADLGAG G AG+AVA R  E Q+ + E  P      R+T+ALP N
Sbjct: 35  VLLAACVSASETGAVADLGAGTGVAGMAVAQRCAEVQVEMFENDPASVTLLRRTVALPRN 94

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
             ++ R+ + E DV  +   R         + HVI NPP+N      +P   +  AH+  
Sbjct: 95  THLAGRLIVTEADVVALDGAR---------FSHVIANPPYNASGRQASPHARRAAAHMAT 145

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI 180
           +   + W+  A  I   + +L++I RP +L  I  A   + G   + P+  +      RI
Sbjct: 146 DGLLKNWVEAAARICLPNSRLTMILRPDNLDDIRQAMTGKFGESFVLPIAAKNESAPIRI 205

Query: 181 LVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSLTRL 225
           L+T R G     R    +VLHKP+G  ++  V D++ G++ +  L
Sbjct: 206 LITARLGAEDGERELPLLVLHKPDGA-FTDPVEDILRGRKGIDLL 249


>gi|154251180|ref|YP_001412004.1| O-methyltransferase [Parvibaculum lavamentivorans DS-1]
 gi|154155130|gb|ABS62347.1| O-methyltransferase [Parvibaculum lavamentivorans DS-1]
          Length = 260

 Score =  111 bits (277), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 69/223 (30%), Positives = 117/223 (52%), Gaps = 5/223 (2%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+ V A       + GAG G A L +ASR+   ++   E  P +A  A + +A    
Sbjct: 36  VLLAASVPAREGERALEAGAGVGVASLCLASRVSGLEVAGIELQPELARLASENIA---R 92

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNE-RIGTMTPDKIKEEAHVM 119
             +++R+S++  D+     N    GL+ N + HV  NPPF++       PD  K +AH+ 
Sbjct: 93  NGLAERVSIVTGDIGHPVRNLAAMGLEPNGWHHVFANPPFHDPATSPAPPDASKAQAHLT 152

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASR 179
           L    + W+R AC + +  G ++ I R  +L  +++A A  +G +EI PL P  G+ ASR
Sbjct: 153 LGSDLDDWVRFACVMAKPKGTVTFIHRADALGALLSAMAGHLGGIEIFPLWPAAGKPASR 212

Query: 180 ILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSL 222
           +++ G +G R  L  R  +VLH  +G+ ++     L+ G  +L
Sbjct: 213 VIMRGIRGSRAPLTLRSGLVLHGRDGR-FTERTEALLRGGEAL 254


>gi|90420151|ref|ZP_01228059.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335485|gb|EAS49235.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 299

 Score =  111 bits (277), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 102/187 (54%), Gaps = 2/187 (1%)

Query: 37  QILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIM 96
            + L E SP+MA  AR+ L LPAN++++ R+ L+E D+   G  R  AGL +  + HV+ 
Sbjct: 112 DVTLVENSPVMADLARRGLELPANSELAGRLRLVEADILAGGTARAAAGLGDGTFGHVLT 171

Query: 97  NPPFNERIGTMTPDKIKEEAHVMLEDSF-EKWIRTACAIMRSSGQLSLIARPQSLIQIVN 155
           NPP++     ++PD ++  A    +  F  +W+R   A++   G+ + I R  +L  ++ 
Sbjct: 172 NPPYHPHDHRISPDPLRAAAMSAADGDFLARWVRACAALLCHGGRFATIVRTDALPTLLA 231

Query: 156 ACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDL 215
           AC  RIG+L +  +H R    A R+LV GRKG R  L      +LH+P+G   + F T +
Sbjct: 232 ACDGRIGALRLLAIHARAEAPAPRLLVLGRKGSRAPLSLLPARILHRPDGT-LTEFATAV 290

Query: 216 INGKRSL 222
             G   L
Sbjct: 291 AEGTADL 297


>gi|218531357|ref|YP_002422173.1| methyltransferase small [Methylobacterium chloromethanicum CM4]
 gi|218523660|gb|ACK84245.1| methyltransferase small [Methylobacterium chloromethanicum CM4]
          Length = 250

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 72/208 (34%), Positives = 103/208 (49%), Gaps = 6/208 (2%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA L+       L DLGA  GA GLAVA      +++L ER P +   AR+  A  AN
Sbjct: 30  VLLARLLAPAPGATLYDLGAATGAVGLAVARLCEVGRVVLVERDPDLVALARENAA--AN 87

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKI--KEEAHV 118
             +  R+++IE D+   G  R  AG++ +  D V+ NPPF E  G   P  +  K  AH 
Sbjct: 88  G-LDARVAVIEADILAPGAQRRAAGMEPDSADIVLTNPPFFEE-GAHRPSPVPQKASAHS 145

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECAS 178
                 + W+RT   ++R  G+L LI R  +L   ++A   R G   + P+H R    A 
Sbjct: 146 FAAGGLDLWLRTCADLLRPGGRLGLIHRADALPACLDALRGRFGDCAVRPVHGRADRPAI 205

Query: 179 RILVTGRKGMRGQLRFRYPIVLHKPNGQ 206
           R+LV   KG R   R   P+VL    G+
Sbjct: 206 RVLVAAVKGSRAPFRLLPPLVLQDEAGR 233


>gi|240139856|ref|YP_002964333.1| putative methyltransferase small [Methylobacterium extorquens AM1]
 gi|254562275|ref|YP_003069370.1| methyltransferase small [Methylobacterium extorquens DM4]
 gi|240009830|gb|ACS41056.1| putative methyltransferase small [Methylobacterium extorquens AM1]
 gi|254269553|emb|CAX25519.1| putative methyltransferase small [Methylobacterium extorquens DM4]
          Length = 250

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 73/208 (35%), Positives = 103/208 (49%), Gaps = 6/208 (2%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA L+       L DLGA  GA GLAVA      +++L ER P +   AR+  A  AN
Sbjct: 30  VLLARLLAPAPGATLYDLGAATGAVGLAVARLTEVGRVVLVERDPDLVALARENAA--AN 87

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKI--KEEAHV 118
             +  R+++IE D+   G  R  AGL+ +  D V+ NPPF E  G   P  +  K  AH 
Sbjct: 88  G-LDGRVAVIEADLLAPGVQRRAAGLEPDSADIVLTNPPFFEE-GAHRPSPVPQKASAHT 145

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECAS 178
                 + W+RT   ++R  G+L LI R  +L   ++A   R G   + P+H R    A 
Sbjct: 146 FAAGGLDLWLRTCADLLRPGGRLGLIHRADALPTCLDALRGRFGDCAVRPVHGRADRPAI 205

Query: 179 RILVTGRKGMRGQLRFRYPIVLHKPNGQ 206
           R+LV   KG R   R   P+VL    G+
Sbjct: 206 RVLVAAVKGSRAPFRLLPPLVLQDEAGR 233


>gi|188582540|ref|YP_001925985.1| methyltransferase small [Methylobacterium populi BJ001]
 gi|179346038|gb|ACB81450.1| methyltransferase small [Methylobacterium populi BJ001]
          Length = 250

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 71/208 (34%), Positives = 104/208 (50%), Gaps = 6/208 (2%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA LV       L DLGA  GA GLA A      +++L ER P +A  AR+  +  AN
Sbjct: 30  VLLARLVVPAPGDTLYDLGASTGAVGLAAARMSEACRVVLVERDPDLAALARENAS--AN 87

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKI--KEEAHV 118
             +++R+++I  DV   G  R  AGL+    D V+ NPPF E +G   P  +  K  AH 
Sbjct: 88  G-LAERVAVIAADVLAPGAQRRAAGLQAGCADIVLTNPPFFE-VGGHRPSPVPQKASAHA 145

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECAS 178
                 + W+RT   ++R  G+L LI R  +L   ++A   R G   + P+H R    A 
Sbjct: 146 FAAGGLDLWLRTCADLLRPGGRLGLIHRADALPACLDALRGRFGDCAVRPVHARSDRPAI 205

Query: 179 RILVTGRKGMRGQLRFRYPIVLHKPNGQ 206
           R+L+   KG R   +   P+VL    G+
Sbjct: 206 RVLIAAVKGSRAPCQLLPPLVLQDEAGR 233


>gi|300024372|ref|YP_003756983.1| methyltransferase small [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526193|gb|ADJ24662.1| methyltransferase small [Hyphomicrobium denitrificans ATCC 51888]
          Length = 266

 Score =  108 bits (271), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 61/189 (32%), Positives = 102/189 (53%), Gaps = 4/189 (2%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           D+GAG G  GL VA R   A+ +L ER P++A  AR  +      +++ R+S++E D+  
Sbjct: 58  DVGAGVGVIGLCVARRCPSARAVLLERDPVLAALARDNVQ---RNELTGRVSVVETDLAR 114

Query: 77  VGENRNLAGLKNNFYDHVIMNPPF-NERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIM 135
                  A +K+  +  V+ NPP+ ++R  T+    +K  +H M +D  + W R  C + 
Sbjct: 115 ATAALEAAEIKSESFPVVLANPPYHDDRRSTLAESPLKAVSHQMPDDLLDVWARFMCRMA 174

Query: 136 RSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFR 195
              G++++I +  +L +I+     R GS+ + P+H R GE A R++V G KG R  +  R
Sbjct: 175 APGGRVAMIHKADALSRILETFEGRFGSIAVLPIHARAGEPAIRVIVEGIKGSRAPMSIR 234

Query: 196 YPIVLHKPN 204
             +VLH P 
Sbjct: 235 PGLVLHTPE 243


>gi|170751715|ref|YP_001757975.1| methyltransferase small [Methylobacterium radiotolerans JCM 2831]
 gi|170658237|gb|ACB27292.1| methyltransferase small [Methylobacterium radiotolerans JCM 2831]
          Length = 252

 Score =  108 bits (271), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 72/207 (34%), Positives = 100/207 (48%), Gaps = 6/207 (2%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA L+       L D+GAG GA GLA A+     +  L ER P +A  AR    L   
Sbjct: 34  VLLARLLAPRAGDRLCDVGAGTGAVGLACAALAPGLRPTLVERDPALAGQARANATL--- 90

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF-NERIGTMTPDKIKEEAHVM 119
             I  R+  +  DV      R  AGL  + +D V+ NPPF        +P   +  AH  
Sbjct: 91  NGIDARV--LVADVLASAAERRAAGLLPDSFDVVLTNPPFFAAGAHRASPHPGRAAAHTF 148

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASR 179
                + WIRT  AI+R+ G+L LI R  +L   ++A   R G L I P+HPR    A R
Sbjct: 149 AGGDLDSWIRTCTAILRAGGRLGLIHRADALPACLDALRGRYGGLAIRPVHPRGDAPAIR 208

Query: 180 ILVTGRKGMRGQLRFRYPIVLHKPNGQ 206
           +L+   +G R       P+VLH P+G+
Sbjct: 209 VLIAATRGSRAAPTLLPPLVLHGPDGR 235


>gi|84683977|ref|ZP_01011879.1| hypothetical protein 1099457000262_RB2654_16051 [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84667730|gb|EAQ14198.1| hypothetical protein RB2654_16051 [Rhodobacterales bacterium
           HTCC2654]
          Length = 253

 Score =  108 bits (270), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 66/202 (32%), Positives = 103/202 (50%), Gaps = 10/202 (4%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           + LA+ V A     + DLG GAGAAGL +A+R+   +++  ER    A  ARK      +
Sbjct: 34  VFLAASVAAHDGESVLDLGCGAGAAGLCLATRVPGIRLVGVERQADYADLARKN-----S 88

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
                 + ++E D++ +        +K   YDHVIMNPP++ R  + T D     A +  
Sbjct: 89  FDNDIDMDVVEADISDLPSE-----VKEESYDHVIMNPPYHLRERSTTSDDAGRAAALFE 143

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI 180
           +     WI      ++  G +++I + + L +I+     R+GS+ + PL PREG  A  I
Sbjct: 144 DTPLATWIDVGTRRLKQRGYMTIIQKAERLPEILRGFDDRMGSILVKPLLPREGRAAVLI 203

Query: 181 LVTGRKGMRGQLRFRYPIVLHK 202
           LV  RKG RG+ R   P++LH 
Sbjct: 204 LVQARKGGRGEFRLASPLILHD 225


>gi|163852522|ref|YP_001640565.1| methyltransferase small [Methylobacterium extorquens PA1]
 gi|163664127|gb|ABY31494.1| methyltransferase small [Methylobacterium extorquens PA1]
          Length = 250

 Score =  107 bits (267), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 76/209 (36%), Positives = 106/209 (50%), Gaps = 8/209 (3%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEA-QILLAERSPLMAHYARKTLALPA 59
           ++LA L+       L DLGA  GA GLAVA RL EA +++L ER   +   AR+  +  A
Sbjct: 30  VLLARLLAPAPGATLYDLGAATGAVGLAVA-RLSEAGRVVLVERDTDLVALARENAS--A 86

Query: 60  NAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKI--KEEAH 117
           N  +  R+++IE D+   G  R  AGL+ +  D V+ NPPF E  G   P  I  K  AH
Sbjct: 87  NG-LDGRVAVIEADLLAPGAQRRAAGLEPDSADIVLTNPPFFEE-GAHRPSPIPQKASAH 144

Query: 118 VMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECA 177
                  + W+RT   ++R  G+L LI R  +L   ++A   R G   + P+H R    A
Sbjct: 145 TFAAGGLDLWLRTCADLLRPGGRLGLIHRADALPACLDALRGRFGDCAVRPVHGRADRPA 204

Query: 178 SRILVTGRKGMRGQLRFRYPIVLHKPNGQ 206
            R+LV   KG R   R   P+VL    G+
Sbjct: 205 IRVLVAAVKGSRAPFRLLPPLVLQDEAGR 233


>gi|146339071|ref|YP_001204119.1| hypothetical protein BRADO2025 [Bradyrhizobium sp. ORS278]
 gi|146191877|emb|CAL75882.1| conserved hypothetical protein; putative
           S-adenosyl-L-methionine-dependent methyltransferase
           domain [Bradyrhizobium sp. ORS278]
          Length = 257

 Score =  106 bits (265), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 71/198 (35%), Positives = 104/198 (52%), Gaps = 8/198 (4%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISK-RISLIEVDVT 75
           DLGAG G AGLA+A R+    ++L ER P +A  AR       NA+ +  +  +I +DVT
Sbjct: 49  DLGAGVGTAGLALARRVDGLALMLVEREPHLAELARD------NARANDLQADVIALDVT 102

Query: 76  LVGENRNLAGLKNNFYDHVIMNPPFNERI-GTMTPDKIKEEAHVMLEDSFEKWIRTACAI 134
                   AGL ++  D V+MNPPF++      +PD  +  AH+    + E W   A  +
Sbjct: 103 SEAAAFAAAGLGSDSVDVVLMNPPFHDAARHRASPDTARAGAHMAKATTLELWTHAARRM 162

Query: 135 MRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRF 194
           ++S G L+LI R   L  ++ A AR  GSL + P+H + G+ A RILV   KG R   + 
Sbjct: 163 LKSGGALTLIWRADGLSDVLAALARGYGSLALQPVHGQAGKPAIRILVRAVKGGRAPTQI 222

Query: 195 RYPIVLHKPNGQPYSRFV 212
              +VL++  G P    V
Sbjct: 223 LPGVVLNEAAGVPNDEVV 240


>gi|91975696|ref|YP_568355.1| methyltransferase small [Rhodopseudomonas palustris BisB5]
 gi|91682152|gb|ABE38454.1| methyltransferase small [Rhodopseudomonas palustris BisB5]
          Length = 259

 Score =  106 bits (264), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 71/209 (33%), Positives = 112/209 (53%), Gaps = 7/209 (3%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + + GAG G AGLAVA+R+ +  + L E  P +A  AR   A  AN     R + I +DV
Sbjct: 52  VVEFGAGVGTAGLAVAARIADLDLALVELDPGLADLARGNAA--ANGL---RATAIALDV 106

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNE-RIGTMTPDKIKEEAHVMLEDSFEKWIRTACA 133
               E    AGL  +  D V+MNPPFN+      +PD+ ++ AHV  + + + W+  A  
Sbjct: 107 AAGAEAFAAAGLAPDSVDVVLMNPPFNDPSRHRGSPDEARQIAHVATQSTLQSWVHAARR 166

Query: 134 IMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLR 193
           +++S G+L+LI R   L  ++ A  R  G + + P+H    E A R+LV   KG R  LR
Sbjct: 167 VLKSGGELTLIWRADGLADVLAALGRGFGGVALIPVHGNPNEPAIRVLVRAVKGSRAPLR 226

Query: 194 FRYPIVLHKPNGQPYSRFVTDLINGKRSL 222
               ++L++ +G P +     ++ GK++L
Sbjct: 227 IHAALILNEASGAPTA-VARSVLAGKQTL 254


>gi|220924245|ref|YP_002499547.1| methyltransferase small [Methylobacterium nodulans ORS 2060]
 gi|219948852|gb|ACL59244.1| methyltransferase small [Methylobacterium nodulans ORS 2060]
          Length = 249

 Score =  106 bits (264), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 65/178 (36%), Positives = 93/178 (52%), Gaps = 3/178 (1%)

Query: 29  VASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKN 88
           VA R    +++L ER    A  AR  +AL     +S+R +L+E DVT     R  AGL  
Sbjct: 59  VALRAPACRVVLVEREAEAASLARANIAL---NGLSERATLLEADVTAPASVRRAAGLLP 115

Query: 89  NFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQ 148
           +  D V+ NPPF       +P   K  AH M E S + W+RT   ++R  G+L LI R  
Sbjct: 116 DSGDLVLTNPPFFAGGHRPSPVAAKAVAHAMPEGSLDAWLRTCADLLRPGGRLVLIHRAD 175

Query: 149 SLIQIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQ 206
           +L   + A A R GSL + P+  R  E A R+L++G +G R     R  ++LH P+G+
Sbjct: 176 ALPACLRALAGRFGSLAVRPIQARAEEPAIRVLISGIRGSRAAFALRPALILHGPDGR 233


>gi|158422529|ref|YP_001523821.1| putative O-methyltransferase [Azorhizobium caulinodans ORS 571]
 gi|158329418|dbj|BAF86903.1| putative O-methyltransferase [Azorhizobium caulinodans ORS 571]
          Length = 235

 Score =  106 bits (264), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 69/193 (35%), Positives = 97/193 (50%), Gaps = 4/193 (2%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DLGAG G AGLAV  RL EA   L E  P  A  AR+  A      +S R +++E DV
Sbjct: 29  IVDLGAGVGTAGLAVLVRLREASAHLVELDPATAALARQNAA---GNGMSDRCAIVEADV 85

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMT-PDKIKEEAHVMLEDSFEKWIRTACA 133
             +G+    A       D VI NPPFN R    T P   +  AH+   ++   W+  A  
Sbjct: 86  RTLGKPAGPAEPAAQAADLVIANPPFNARAAHQTSPHARRATAHMADGETLMDWVLAAYR 145

Query: 134 IMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLR 193
            ++  GQ+ LI RP  L  +++A A R G+ E+ P+H R    A R+LV   KG R    
Sbjct: 146 CLKPGGQVGLILRPADLATLLDALAGRFGAAELLPVHARADAPAVRLLVRAVKGRRTPPA 205

Query: 194 FRYPIVLHKPNGQ 206
            R  ++L + +G+
Sbjct: 206 IRPGLILAEADGR 218


>gi|170740972|ref|YP_001769627.1| methyltransferase small [Methylobacterium sp. 4-46]
 gi|168195246|gb|ACA17193.1| methyltransferase small [Methylobacterium sp. 4-46]
          Length = 250

 Score =  105 bits (263), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 71/191 (37%), Positives = 102/191 (53%), Gaps = 4/191 (2%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DLGAG GA GLAVA R    +++L ER       A    A  A   ++ R++++E DVT 
Sbjct: 47  DLGAGTGAVGLAVALRAPLCRVVLVERD---GEAAALARANAAANGLAGRVAVLEADVTA 103

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNERIG-TMTPDKIKEEAHVMLEDSFEKWIRTACAIM 135
               R  AGL  +  D V+ NPPF E  G   +P   +  AH + E   + W+RT   ++
Sbjct: 104 PAAARRAAGLMPDAADLVLTNPPFFEGAGHRPSPVAARAAAHALPEGGLDAWLRTCADLL 163

Query: 136 RSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFR 195
           R  G+L LI R  +L   + A A R G++ + P+ PR    ASR+L+ GR+G R      
Sbjct: 164 RPGGRLVLIHRADALPTCLRALAGRFGAVAVRPVQPRAETPASRVLIAGRRGSRAPFALL 223

Query: 196 YPIVLHKPNGQ 206
            P+VLH P+G+
Sbjct: 224 PPLVLHGPDGR 234


>gi|323136701|ref|ZP_08071782.1| methyltransferase small [Methylocystis sp. ATCC 49242]
 gi|322398018|gb|EFY00539.1| methyltransferase small [Methylocystis sp. ATCC 49242]
          Length = 245

 Score =  104 bits (260), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 109/208 (52%), Gaps = 9/208 (4%)

Query: 2   ILASLVNATGSFHLA-DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           +L S V   G   L  D+GAGAGA GL  A R   A I L E  P  A  AR+ +A  AN
Sbjct: 29  VLLSAVTPPGETGLILDVGAGAGAVGLMAAVRAPGAAIGLVEIDPGAAALARENVA--AN 86

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTM--TPDKIKEEAHV 118
             ++ R+S+ E DVT  G  R  AGL +     V+ NPPF E +G +  TPD  K  AHV
Sbjct: 87  G-LADRVSVFEADVTAPGARRA-AGLSDEKAALVLTNPPFYE-VGRVRVTPDAAKALAHV 143

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECAS 178
                   W R   A++   G  ++I R ++L   + A   R+G++ I P+ PR G  AS
Sbjct: 144 AAV-PLAGWTRACLALLAPGGTFAMIHRAEALADCLAAVEARLGAVSILPILPRAGAPAS 202

Query: 179 RILVTGRKGMRGQLRFRYPIVLHKPNGQ 206
           RIL+ G KG R  L    P+VLH  +G+
Sbjct: 203 RILLCGVKGSRAPLSLLAPLVLHGADGR 230


>gi|27377644|ref|NP_769173.1| hypothetical protein blr2533 [Bradyrhizobium japonicum USDA 110]
 gi|27350789|dbj|BAC47798.1| blr2533 [Bradyrhizobium japonicum USDA 110]
          Length = 253

 Score =  102 bits (255), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 78/223 (34%), Positives = 118/223 (52%), Gaps = 7/223 (3%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+   A     + DLGAG G AGLA+  R+   ++ L E  P +A  AR   A  A 
Sbjct: 32  ILLAAATEARAGDRVVDLGAGIGTAGLALGRRVAGIRLSLVEIDPELAELARANAAANAI 91

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERI-GTMTPDKIKEEAHVM 119
           A  +     I +DVT   +     GL  +  D V+MNPPFN+ +    +PD+ +  AHV 
Sbjct: 92  AAET-----IVLDVTADAQAFVAHGLVPDSVDSVLMNPPFNDPVRHRGSPDQARHIAHVA 146

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASR 179
            E++   W+  A  I+RS+G L+LI R   + +I+ A +R  GSL I P+H   G  A R
Sbjct: 147 TEETLHAWVHAARRILRSNGVLTLIWRADGIAEILAALSRGFGSLAILPVHGEAGRPAIR 206

Query: 180 ILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSL 222
           +LV   KG R   R    ++L++ +  P  + VTD++ G+  L
Sbjct: 207 VLVRAIKGGRAPTRLLPGLMLNEESHVP-KKEVTDILEGRAVL 248


>gi|209964970|ref|YP_002297885.1| methyltransferase small domain protein [Rhodospirillum centenum SW]
 gi|209958436|gb|ACI99072.1| methyltransferase small domain protein [Rhodospirillum centenum SW]
          Length = 254

 Score = 99.4 bits (246), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 72/207 (34%), Positives = 104/207 (50%), Gaps = 9/207 (4%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+ V A     + +LGAGAGAA L +A+R    ++   ER P  A   R+ +AL   
Sbjct: 39  VLLAAAVPARAGEAVLELGAGAGAATLCLAARAPGCRLTALERQPAAAAALRQGVAL--- 95

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERI-GTMTPDKIKEEAHVM 119
                RIS++E D+          GL  N +D V+MNPPF E    T +P   K  +H  
Sbjct: 96  NGWQDRISVLEGDL-----RAPPPGLPLNGFDRVLMNPPFYEEGRHTPSPAPGKAASHGE 150

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASR 179
            E +   W+R A   ++  G L+L+ R   L  I+ A   R G + + PL PR G+ A R
Sbjct: 151 GEATLADWVRAALRHLKGRGILTLVHRADRLDAILAALHGRFGGIVVFPLWPRAGQPAKR 210

Query: 180 ILVTGRKGMRGQLRFRYPIVLHKPNGQ 206
           +LV   +  RG LR    +VLH   G+
Sbjct: 211 VLVQAVRDGRGPLRLAAGLVLHGEEGR 237


>gi|110680570|ref|YP_683577.1| hypothetical protein RD1_3399 [Roseobacter denitrificans OCh 114]
 gi|109456686|gb|ABG32891.1| conserved hypothetical protein [Roseobacter denitrificans OCh 114]
          Length = 246

 Score = 98.2 bits (243), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 65/229 (28%), Positives = 108/229 (47%), Gaps = 20/229 (8%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+ V+A     + DLG G GAA L + +R+    +   ER P+ A  AR+      N
Sbjct: 31  VLLAATVDARAGDRVLDLGCGVGAAALCLGARVPGLVLTGVERQPVYADLARR------N 84

Query: 61  AQISKRISLIEV-DVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVM 119
              +  +   ++ D+ L         ++   +DHV+ NPP+ +R  +     +  EA + 
Sbjct: 85  GGAAFEVVTADIADLPL--------HIRERQFDHVLANPPYYKRSDSRAARDLTREAALG 136

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASR 179
            E     WI+TA   +   G    I R + L +I+    +R+GS+E+ PL PR G     
Sbjct: 137 EETPLADWIKTAAKRLAPKGHAHFIHRVERLPEILTEMGKRLGSIEVLPLSPRAGRMPEL 196

Query: 180 ILVTGRKGMRGQLRFRYPIVL-----HKPNGQPYSRFVTDLINGKRSLT 223
           ++V GRK  RG  +   P+VL     H+ +G  Y   V  ++    +LT
Sbjct: 197 VIVRGRKNGRGAFKLHAPLVLHEGQRHEKDGDSYVPVVKAVLRDGAALT 245


>gi|154245322|ref|YP_001416280.1| methyltransferase small [Xanthobacter autotrophicus Py2]
 gi|154159407|gb|ABS66623.1| methyltransferase small [Xanthobacter autotrophicus Py2]
          Length = 256

 Score = 97.1 bits (240), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 64/196 (32%), Positives = 101/196 (51%), Gaps = 4/196 (2%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DLG G G+ GLA  +R+ +A  +L E +P +A  AR+  AL     +S R+ ++  DV
Sbjct: 49  MVDLGTGVGSCGLAFLTRVPQASSVLVEIAPELADLARENAAL---NDLSARVEVVTADV 105

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERI-GTMTPDKIKEEAHVMLEDSFEKWIRTACA 133
           T +         +    D V+ NPPFN+     ++PD  +  AH+      E+W+R A  
Sbjct: 106 TRLCRPSGPDVPQVGAADLVLTNPPFNDTARHRISPDAARARAHMADGTLLEEWVRAADR 165

Query: 134 IMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLR 193
            + + G + LI RPQ+L  ++ A   R G++EI P+HPR    A R+LV   KG R    
Sbjct: 166 CLAARGVICLIHRPQALADLLAALDGRFGAVEILPVHPRPDRPAVRLLVRAVKGRRTPPA 225

Query: 194 FRYPIVLHKPNGQPYS 209
               ++L   +G P +
Sbjct: 226 LLPGLILTDADGNPTA 241


>gi|312115017|ref|YP_004012613.1| methyltransferase type 11 [Rhodomicrobium vannielii ATCC 17100]
 gi|311220146|gb|ADP71514.1| Methyltransferase type 11 [Rhodomicrobium vannielii ATCC 17100]
          Length = 255

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 72/221 (32%), Positives = 103/221 (46%), Gaps = 6/221 (2%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           + LA+   A     + + G GAGAA L + +R+    +   E    +A  AR+       
Sbjct: 33  VFLAAACPAQAGERVLEAGCGAGAASLCLLARVPGVSVTGVEIDAGLAALARENAT---E 89

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEE--AHV 118
             ++ + ++   D+T        AGL    YDHVI NPPF E  G   P K      A  
Sbjct: 90  NDLAAQFTIANADLTASWTELEAAGLFREAYDHVIANPPFFEH-GRTRPSKDARNGRARA 148

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECAS 178
           M E  FE W R   A  R S   ++I    +L QI+ A  RR G+L I PLHP+ G  A 
Sbjct: 149 MAEGGFEDWARFLAAAARPSASATVIHTADALPQILAAFDRRFGALSILPLHPKAGAPAI 208

Query: 179 RILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
           R++V+G KG R        +VLH+ +G P +     L +G+
Sbjct: 209 RVIVSGIKGSRAPASILPGVVLHEADGAPTAAATAILRHGQ 249


>gi|114705277|ref|ZP_01438185.1| SAM (and some other nucleotide) binding motif:Site-specific
           DNA-methyltransferase (cytosine-N4-specific):N-6
           [Fulvimarina pelagi HTCC2506]
 gi|114540062|gb|EAU43182.1| SAM (and some other nucleotide) binding motif:Site-specific
           DNA-methyltransferase (cytosine-N4-specific):N-6
           [Fulvimarina pelagi HTCC2506]
          Length = 294

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 74/220 (33%), Positives = 115/220 (52%), Gaps = 2/220 (0%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+ V    S +L D+GAGAGA G A A R    ++ L E   LMA  ARK LA   N
Sbjct: 46  LLLAATVGENASGNLLDIGAGAGAVGFAAAVRAPGLRVALLENDVLMAECARKGLADTGN 105

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
           A  + R S+IE D+  +   +    +++  +D V+ NPPF       + D ++  A V  
Sbjct: 106 AAFADRASVIEADLFTIRRAKAGHPMRDQLFDFVVTNPPFYLPGQRPSSDPVRAAAMVAP 165

Query: 121 EDSF-EKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASR 179
           +  F  +W++T+ A ++  G+ + I  P +L   + A + RIG   +TP+H   GE A R
Sbjct: 166 DADFLRRWVQTSLAFLKDGGRFAAILSPAALAICLPALSGRIGGPAVTPIHGHRGEPAIR 225

Query: 180 ILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
           +++TGRK  R  L F  P+     +G+  S F   L  G+
Sbjct: 226 LILTGRKSSRESLSF-LPLRYLFDSGRAPSDFTGRLSRGQ 264


>gi|192289644|ref|YP_001990249.1| methyltransferase small [Rhodopseudomonas palustris TIE-1]
 gi|192283393|gb|ACE99773.1| methyltransferase small [Rhodopseudomonas palustris TIE-1]
          Length = 259

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 72/223 (32%), Positives = 112/223 (50%), Gaps = 7/223 (3%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+   A     + + G+G GAAGLAVA R+     +L E  P +A  A     L  N
Sbjct: 38  ILLAASTRAKAGDRVVEFGSGVGAAGLAVARRVEGIDPVLVEIDPSLAALACDNARL--N 95

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERI-GTMTPDKIKEEAHVM 119
             +++ + L   DVT   E    AGL  +  D V+MNPPF++      +PD  ++ AH+ 
Sbjct: 96  GLVAETVCL---DVTGPAEAFAAAGLGPDTADAVLMNPPFHDAARHRGSPDPARQSAHLA 152

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASR 179
              + E W+  A  +++S G L+LI R   L  ++    R  GS+ I P+H    + A R
Sbjct: 153 TPTTLEAWVHAARRLLKSGGTLTLIWRADGLADVLGVLGRGFGSVMIQPVHGNADKPAIR 212

Query: 180 ILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSL 222
           ILV   KG R  L     ++L+ P+G   S  V  ++ G++ L
Sbjct: 213 ILVRATKGGRAPLMLLPSLLLNDPSGH-QSPMVRAVLAGEQIL 254


>gi|217977297|ref|YP_002361444.1| methyltransferase small [Methylocella silvestris BL2]
 gi|217502673|gb|ACK50082.1| methyltransferase small [Methylocella silvestris BL2]
          Length = 257

 Score = 96.3 bits (238), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 95/193 (49%), Gaps = 8/193 (4%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           D+GAG GAA +A+A+    A+I L E     A  ARK L L     I++R  + E D  L
Sbjct: 52  DIGAGVGAASIALAATRPGARIGLVEIDAEAAELARKNLDLNG---IAQRGRVFEAD-AL 107

Query: 77  VGENRNLAGLKNNFYDHVIMNPPF-NERIGTMTPDKIKEEAHVMLEDS---FEKWIRTAC 132
              +R  AGL +   D VI NPPF +      +PD+ +  AHVM E        W+    
Sbjct: 108 SPPSRRAAGLADETADLVISNPPFLDPARSRASPDEGRRRAHVMREGGPAGVVAWLAACL 167

Query: 133 AIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQL 192
           A+ R  G   +I RP SL  ++ +   R G   + P+HPR G  A RIL+  RKG R  L
Sbjct: 168 ALTRPGGSCIVIHRPDSLAALLASLEGRAGEAVLMPIHPRAGAAAIRILLRARKGSRAPL 227

Query: 193 RFRYPIVLHKPNG 205
                ++LH   G
Sbjct: 228 SIVPGLILHDDAG 240


>gi|39934117|ref|NP_946393.1| methyltransferase small [Rhodopseudomonas palustris CGA009]
 gi|39647965|emb|CAE26485.1| conserved unknown protein [Rhodopseudomonas palustris CGA009]
          Length = 259

 Score = 95.9 bits (237), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 71/223 (31%), Positives = 112/223 (50%), Gaps = 7/223 (3%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+   A     + + G+G GAAGLAVA R+     +L E  P +A  A     L  N
Sbjct: 38  ILLAASTRAKAGDRVVEFGSGVGAAGLAVARRVEGIDPVLVEIDPNLAALACDNARL--N 95

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERI-GTMTPDKIKEEAHVM 119
             +++ + L   DVT   E    AGL  +  D V+MNPPF++      +PD  ++ AH+ 
Sbjct: 96  GLVAETVCL---DVTGPAEAFAAAGLGPDTADAVLMNPPFHDAARHRGSPDPARQSAHLA 152

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASR 179
              + E W+  A  +++S G L+LI R   L  ++    R  GS+ + P+H    + A R
Sbjct: 153 TPTTLEAWVHAARRLLKSGGTLTLIWRADGLADVLGVLGRGFGSVMVQPVHGHADKPAIR 212

Query: 180 ILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSL 222
           ILV   KG R  L     ++L+ P+G   S  V  ++ G++ L
Sbjct: 213 ILVRATKGGRAPLMLLPSLLLNDPSGH-QSAMVRAVLAGEQIL 254


>gi|163792422|ref|ZP_02186399.1| Predicted O-methyltransferase [alpha proteobacterium BAL199]
 gi|159182127|gb|EDP66636.1| Predicted O-methyltransferase [alpha proteobacterium BAL199]
          Length = 253

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 64/219 (29%), Positives = 107/219 (48%), Gaps = 10/219 (4%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+ V       + DLG GAGA  L + +R  +  ++  ER P MA  AR  +A    
Sbjct: 37  VLLAASVPVRAEQRVLDLGCGAGAVFLCLLARFPQLSVVAVERDPTMAGLARDNVA---R 93

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF-NERIGTMTPDKIKEEAHVM 119
             +++R +++  D++ +  +  +A      +D V+ NPPF        +P   +  A V 
Sbjct: 94  NGVAERATVVTADLSALPASWEMAA-----FDQVVTNPPFLPANRADPSPQPGRASAGVE 148

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASR 179
                  WI  A   ++  G++S+I R   L  ++ A A R G + + PL P+ G  A R
Sbjct: 149 ATADLGVWIDRAHRCLKPKGRISVIHRVDRLDDLLAALAGRFGGIVVFPLWPKAGRDAKR 208

Query: 180 ILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLING 218
           ++VT RKG+R  LR    +VLH   G  Y++    ++ G
Sbjct: 209 LIVTARKGVRSPLRLSAGLVLHDEAGG-YTKEADAVLRG 246


>gi|316932583|ref|YP_004107565.1| methyltransferase small [Rhodopseudomonas palustris DX-1]
 gi|315600297|gb|ADU42832.1| methyltransferase small [Rhodopseudomonas palustris DX-1]
          Length = 259

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 65/209 (31%), Positives = 106/209 (50%), Gaps = 8/209 (3%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+   A     + + GAG G AGLA+A R+     +L E    +   AR       N
Sbjct: 38  ILLAASTRARAGDRVVEFGAGVGTAGLALARRVDGIAPVLVEIDSTLVAIARD------N 91

Query: 61  AQISKRIS-LIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERI-GTMTPDKIKEEAHV 118
           A+++   + ++ +DVT   E    AGL  +  D V+MNPPF++      +PD +++ AH+
Sbjct: 92  ARLNGLAAEVVCLDVTGPAETFAAAGLGPDTADTVLMNPPFHDAARHRGSPDPLRQAAHL 151

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECAS 178
               + E W+  A  +++S G L+LI R   L  ++ A  R  GS+ +  +H   G+ A 
Sbjct: 152 ATGATLEAWVHAARRLLKSGGALTLIWRADGLADVLAALGRGFGSVALQAVHGNAGKPAI 211

Query: 179 RILVTGRKGMRGQLRFRYPIVLHKPNGQP 207
           RILV   KG R  L     ++L   +G+P
Sbjct: 212 RILVRAIKGGRAPLVMLPSLMLSDTSGEP 240


>gi|260431563|ref|ZP_05785534.1| methyltransferase small [Silicibacter lacuscaerulensis ITI-1157]
 gi|260415391|gb|EEX08650.1| methyltransferase small [Silicibacter lacuscaerulensis ITI-1157]
          Length = 257

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 67/228 (29%), Positives = 108/228 (47%), Gaps = 17/228 (7%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+ V A+    + +LG GAGAA L +  R+ +  +   E  P  A  AR+      N
Sbjct: 35  VLLAAAVPASPGQSVLELGCGAGAAVLCLGIRVPDLHLTGVELQPAYADLARR------N 88

Query: 61  AQISK-RISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVM 119
           A+ ++  +S+   D+  +  +     L+   +DHVI NPP+                 + 
Sbjct: 89  ARENRIALSVHAADLAHLPPD-----LRQAQFDHVIANPPYYRAGAHSAAADAGRRIALG 143

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASR 179
            +     W+  A   +   G L +I R   L  ++ ACA R+GSLEI PL PR G  A  
Sbjct: 144 EQTPLAAWVEVAARRLAPRGYLHMIQRADRLPDMMAACADRLGSLEILPLAPRVGRAAEL 203

Query: 180 ILVTGRKGMRGQLRFRYPIVLHKP-----NGQPYSRFVTDLINGKRSL 222
           ++V  RKG R   R   P++LH+      +G+ Y+  V D++   R+L
Sbjct: 204 VIVRARKGGRAAFRLHAPLILHQGDRHERDGESYAPAVADVLRNGRAL 251


>gi|288960113|ref|YP_003450453.1| methyltransferase [Azospirillum sp. B510]
 gi|288912421|dbj|BAI73909.1| methyltransferase [Azospirillum sp. B510]
          Length = 256

 Score = 93.2 bits (230), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 61/207 (29%), Positives = 105/207 (50%), Gaps = 11/207 (5%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           + LA++  A+    + D+G G GAA L +A R+    ++  E+      +AR+  AL   
Sbjct: 41  VFLAAITAASAGERVLDVGTGTGAAALCLAVRVPGVAVVGLEQRADACAFARRNAAL--- 97

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMT--PDKIKEEAHV 118
             +++R++++E D+    E     G     +D V+MNPP+  R GT +  PD  K  A+V
Sbjct: 98  TGVAERVTVVEGDLLAPPETVGGGG-----FDRVMMNPPYL-RAGTASVPPDDWKAAANV 151

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECAS 178
             +     W+R A  +++  G L+++ R   +  I++A   R G L + PL P+ G  A 
Sbjct: 152 EGKAGLADWVRFADRMLKPRGTLTMVHRADRIDDILHALRGRFGGLVLVPLWPKPGVEAK 211

Query: 179 RILVTGRKGMRGQLRFRYPIVLHKPNG 205
           R+L+T RKG +   R    + +H   G
Sbjct: 212 RLLLTARKGGKAPTRLTAGLTVHTAEG 238


>gi|92118680|ref|YP_578409.1| methyltransferase small [Nitrobacter hamburgensis X14]
 gi|91801574|gb|ABE63949.1| methyltransferase small [Nitrobacter hamburgensis X14]
          Length = 288

 Score = 92.8 bits (229), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 79/222 (35%), Positives = 111/222 (50%), Gaps = 6/222 (2%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           M+LA+         + D GAG GAAGLAVA+R+    ++L ER   +A  AR+   L A 
Sbjct: 60  MLLAAATPGKPGDRIVDFGAGVGAAGLAVATRVAGIDLVLVERDETLADLARRNAVLNAI 119

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNE-RIGTMTPDKIKEEAHVM 119
           A       +  +DVT   E    AGL  +  D V+MNPPFN+      +PD+ +  AHV 
Sbjct: 120 AA-----QICTLDVTGRAETFASAGLGPDSADVVLMNPPFNDSERHRPSPDEGRRAAHVA 174

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASR 179
              + E W+  A  +++S G LSLI R   L +++ A  R  G L I P+HP   + A R
Sbjct: 175 EPATLEAWVHAARRLLKSGGVLSLIWRSDGLAEVLAALGRGFGGLAIRPVHPDARKPAIR 234

Query: 180 ILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRS 221
           +LV   KG R  LR    ++L    G+P       L  G+ S
Sbjct: 235 VLVRAVKGSRAPLRLCPGLMLSDETGRPGKEAQDALAGGQGS 276


>gi|148253844|ref|YP_001238429.1| hypothetical protein BBta_2351 [Bradyrhizobium sp. BTAi1]
 gi|146406017|gb|ABQ34523.1| hypothetical protein BBta_2351 [Bradyrhizobium sp. BTAi1]
          Length = 257

 Score = 92.4 bits (228), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 69/199 (34%), Positives = 102/199 (51%), Gaps = 14/199 (7%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMA----HYARKTLALPANAQISKRISLI 70
           + DLGAG G AGLA+A R+    + L ER P +A    H AR    LPA+        ++
Sbjct: 47  VVDLGAGVGTAGLALACRIGGVALTLVEREPELARLAQHNARAN-QLPAD--------VV 97

Query: 71  EVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERI-GTMTPDKIKEEAHVMLEDSFEKWIR 129
            +DV         AGL  +  D V+MNPPF++      +PD  +  AH+    + E W  
Sbjct: 98  TLDVGADAAAFAAAGLGPDSVDVVLMNPPFHDAARHRASPDVARATAHMATATTLEVWTH 157

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRILVTGRKGMR 189
            A  +++S G L+LI R   L +++ A AR  GS  + P+H + G  A RILV   KG R
Sbjct: 158 AARRMLKSGGVLTLIWRADGLGEVLAALARGFGSFGVQPVHGQAGRPAIRILVRAVKGGR 217

Query: 190 GQLRFRYPIVLHKPNGQPY 208
             L+    ++L++  G P+
Sbjct: 218 APLQIWPGVMLNEAAGVPH 236


>gi|254511958|ref|ZP_05124025.1| methyltransferase small [Rhodobacteraceae bacterium KLH11]
 gi|221535669|gb|EEE38657.1| methyltransferase small [Rhodobacteraceae bacterium KLH11]
          Length = 256

 Score = 91.7 bits (226), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 62/203 (30%), Positives = 102/203 (50%), Gaps = 12/203 (5%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+ + A     + +LG GAGAA L + +R+ + Q    E  P  A  AR+       
Sbjct: 35  VLLAAAIPANPGQSVLELGCGAGAAILCLLARVPDLQATGVEIQPAYAALARRN-----A 89

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
            + +  ++++E D+  + ++     L+   +DHVI NPP+  R G  +P +       + 
Sbjct: 90  TRNAAPLTVVEADLKALPDD-----LRQKQFDHVIANPPYY-RPGAHSPAEDPGRRMALG 143

Query: 121 EDS-FEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASR 179
           E++    WI  A   +   G L +I +   L  ++ ACA R+GSLEI PL  R G  A  
Sbjct: 144 EETPLADWINVAARRLAPRGYLHMIQKADRLPDMLAACAGRLGSLEILPLSARTGRSAEL 203

Query: 180 ILVTGRKGMRGQLRFRYPIVLHK 202
           +++  RKG R   R   P+VLH+
Sbjct: 204 VILRARKGGRAAFRLHAPLVLHE 226


>gi|86139017|ref|ZP_01057588.1| hypothetical protein MED193_10698 [Roseobacter sp. MED193]
 gi|85824248|gb|EAQ44452.1| hypothetical protein MED193_10698 [Roseobacter sp. MED193]
          Length = 268

 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 101/203 (49%), Gaps = 12/203 (5%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+ + A     + +LG G G A L +A R+    I   E   L + YA   LA    
Sbjct: 46  VLLAAAIPARAGERVLELGCGGGQAFLCLAERVPGLAITGVE---LQSDYA--VLARRNA 100

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTP-DKIKEEAHVM 119
           A   + + ++E D+  + ++     L+   +D V+ NPP+  R G  +P + +  +  + 
Sbjct: 101 AHNGQSVEVVEADLAALPKD-----LRQRQFDQVLANPPYY-RAGAHSPAEDVGRQIALG 154

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASR 179
            +   E WI TA   +   G L +I R   L  I++AC  R+GSLE+ PL PR+   A  
Sbjct: 155 GDTPLEIWIDTAARRLTHKGYLHMIQRADRLPDILSACMGRLGSLEVLPLAPRQNRPAEL 214

Query: 180 ILVTGRKGMRGQLRFRYPIVLHK 202
           IL+  RKG R   R   P++LH+
Sbjct: 215 ILLRARKGGRADFRLHAPLILHE 237


>gi|99078711|ref|YP_611969.1| methyltransferase small [Ruegeria sp. TM1040]
 gi|99035849|gb|ABF62707.1| methyltransferase small [Ruegeria sp. TM1040]
          Length = 262

 Score = 90.1 bits (222), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 66/225 (29%), Positives = 105/225 (46%), Gaps = 14/225 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+ VNA     + +LG GAG A L +A+R+    I+  E  P  A  AR+  A    
Sbjct: 38  VLLAAAVNAKSGDSVLELGCGAGQAFLCLAARVSGLSIVGVELQPAYAELARRNAA---- 93

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
                 ++ +  +V +   +   A L+   + HVI NPP+  R G  +  K       + 
Sbjct: 94  ------VNAVPAEVVVADLSNLPATLRQRRFSHVIANPPYY-RAGAHSQAKDPGRRTALG 146

Query: 121 EDS-FEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASR 179
           E +  E W   A   +   G L +I R + L  ++ A   R+GSLE+ PL PR G     
Sbjct: 147 EGTPLELWFDVAARRLTPKGYLHMIQRVERLPDMIAAAQGRLGSLEVLPLSPRVGRATEL 206

Query: 180 ILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSLTR 224
           +++  RKG R + R   P+V+H+  G  + R   D     R++ R
Sbjct: 207 VILRARKGGRAEFRLHAPLVMHQ--GDAHHRDGEDYSPAVRAVLR 249


>gi|83941377|ref|ZP_00953839.1| hypothetical protein EE36_04073 [Sulfitobacter sp. EE-36]
 gi|83847197|gb|EAP85072.1| hypothetical protein EE36_04073 [Sulfitobacter sp. EE-36]
          Length = 249

 Score = 90.1 bits (222), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 56/202 (27%), Positives = 96/202 (47%), Gaps = 14/202 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+ V A    H+ +LG G GAA L + +R+   Q+   E  P  A  AR+       
Sbjct: 35  VLLAATVPAQAGQHVLELGCGVGAASLCLGARVPGLQLTGVEIQPAYAALARRN------ 88

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
              +    ++E D+    +   LA L+   +DHV+ NPP+ +R  ++       E  +  
Sbjct: 89  ---NPAFEVVEADI----DAMPLA-LRQRQFDHVLANPPYFDRHASVAATNSGRETALGE 140

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI 180
               E W++ A   +   GQ   I R + L  ++ A    +GS+E+ P+ PR G  A  +
Sbjct: 141 ATPLETWVKIAAKRLAPKGQTHFIHRAERLPDLIRALPHDMGSIEVLPIAPRIGRMAELV 200

Query: 181 LVTGRKGMRGQLRFRYPIVLHK 202
           ++  RK  RG  R   P+++H+
Sbjct: 201 ILRARKSGRGAFRLNAPLIVHE 222


>gi|85714242|ref|ZP_01045230.1| methyltransferase small [Nitrobacter sp. Nb-311A]
 gi|85698689|gb|EAQ36558.1| methyltransferase small [Nitrobacter sp. Nb-311A]
          Length = 261

 Score = 89.0 bits (219), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 61/194 (31%), Positives = 99/194 (51%), Gaps = 7/194 (3%)

Query: 31  SRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNF 90
           +R+    ++L ER  ++A  AR+   L     ++ R+ ++  DVT   E     GL  + 
Sbjct: 64  TRIDNVDLVLVERDEILAVLARRNAVL---NSLAARVCIL--DVTAEAEAFARLGLGPDT 118

Query: 91  YDHVIMNPPFNERI-GTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQS 149
            D V+MNPPFN+ +    +PD+ +  AHV    S + W   A  +++S G LSLI R   
Sbjct: 119 ADVVLMNPPFNDVLRHRPSPDQGRRAAHVGEPSSLDIWTHAARRMLKSGGVLSLIWRSDG 178

Query: 150 LIQIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYS 209
           L +++ A  R  G + I P+HP   + A R+LV   KG R  LR    ++L    G+P +
Sbjct: 179 LAEVLGALGRGFGGIAIRPVHPDPRKPAIRVLVRAVKGSRAPLRLCPGLMLIDEAGRP-A 237

Query: 210 RFVTDLINGKRSLT 223
           +   D + G ++L 
Sbjct: 238 KEAQDALAGGQALA 251


>gi|163732319|ref|ZP_02139765.1| hypothetical protein RLO149_02672 [Roseobacter litoralis Och 149]
 gi|161394617|gb|EDQ18940.1| hypothetical protein RLO149_02672 [Roseobacter litoralis Och 149]
          Length = 246

 Score = 89.0 bits (219), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 86/186 (46%), Gaps = 13/186 (6%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DLG G GAA L + +R+    +   ER PL A  A++           + ++   VD+ L
Sbjct: 47  DLGCGVGAAALCLGARVPGLVLTGVERQPLYADLAQRN-----GGSTFEVVTADIVDLPL 101

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMR 136
                    ++   +DHV+ NPP+ +R  +        E  +  E     WI+ A   + 
Sbjct: 102 --------HIRERQFDHVLANPPYYKRSDSRAAHDADRETALGEETPLADWIKIAAKRLA 153

Query: 137 SSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRY 196
             G    I R + L +I+    +R+GS+E+ PL PR G     ++V GRK  RG  R   
Sbjct: 154 PKGYAHFIHRVERLPEILTEMGKRLGSIEVLPLSPRTGRMPELVIVRGRKNGRGAFRLHT 213

Query: 197 PIVLHK 202
           P++LH+
Sbjct: 214 PLILHE 219


>gi|56695236|ref|YP_165584.1| hypothetical protein SPO0321 [Ruegeria pomeroyi DSS-3]
 gi|56676973|gb|AAV93639.1| conserved hypothetical protein [Ruegeria pomeroyi DSS-3]
          Length = 257

 Score = 89.0 bits (219), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 65/211 (30%), Positives = 104/211 (49%), Gaps = 12/211 (5%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           + LA+ V A     + +LG GAGAA L++ +R+ +  +   E  P  A  AR+  A  AN
Sbjct: 35  VFLAASVAAQTGQSVLELGCGAGAAILSLGARVPDLALTGVELQPGYADLARRNAA--AN 92

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
                 + ++E D+  + +      L+   +DHVI NPP+    G+ +P      A  + 
Sbjct: 93  ---DIALDVVEGDIAALPQ-----ALRQQSFDHVIANPPYY-LAGSHSPASDAGRATALG 143

Query: 121 EDS-FEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASR 179
           E +    WI  A   +   G L +IA+   L  ++ AC  R+GSLE+ PL PR+G  A  
Sbjct: 144 ERTPLALWIDAAARRLTHRGYLHMIAKADRLPDMLAACDDRLGSLEVLPLMPRQGRAAEL 203

Query: 180 ILVTGRKGMRGQLRFRYPIVLHKPNGQPYSR 210
           +++  RKG R   R +  + LH+ +  P  R
Sbjct: 204 VILRARKGGRAPFRLQSGLFLHQGSRHPGDR 234


>gi|114766797|ref|ZP_01445731.1| hypothetical protein 1100011001324_R2601_11876 [Pelagibaca
           bermudensis HTCC2601]
 gi|114540991|gb|EAU44049.1| hypothetical protein R2601_11876 [Roseovarius sp. HTCC2601]
          Length = 247

 Score = 88.6 bits (218), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 67/227 (29%), Positives = 103/227 (45%), Gaps = 15/227 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+ V A     + +LG GAG A   + +R+   ++   E  P  A  AR+ LA   N
Sbjct: 27  VLLAATVPAKPGQSVLELGCGAGPALCCLGARVAGLRLTGLEIQPAYAALARRNLA--EN 84

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
           A   +   +IE D+           LK    DHV+ NPP+ E         +  E  +  
Sbjct: 85  ALTGE---VIEGDI-----GAPPFALKALTVDHVLANPPYFEIESRSIASDVGREMALAG 136

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI 180
                 W+R A   +R  G  + I R + L +++ A    +GSLE+ PL PREG     I
Sbjct: 137 PAPLADWVRLAAKRLRVKGTATFIQRAERLPELLAAMGEGLGSLELWPLAPREGRAPRLI 196

Query: 181 LVTGRKGMRGQLRFRYPIVLHK-----PNGQPYSRFVTDLINGKRSL 222
           L  GRKG R   R   P++LH       +G+ Y+  +  ++ G  +L
Sbjct: 197 LARGRKGGRAAFRLHAPLILHSGPAHIEDGEDYTDVIRTVLRGGEAL 243


>gi|83594284|ref|YP_428036.1| methyltransferase small [Rhodospirillum rubrum ATCC 11170]
 gi|83577198|gb|ABC23749.1| Methyltransferase small [Rhodospirillum rubrum ATCC 11170]
          Length = 260

 Score = 88.2 bits (217), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 63/210 (30%), Positives = 104/210 (49%), Gaps = 12/210 (5%)

Query: 14  HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVD 73
           H+ D GAG GAA L +A+R  + ++   E   L A     ++ L A   ++ R  ++  D
Sbjct: 54  HVLDAGAGTGAALLCLAARRPDLRVTGLELQALHAGLCHWSIELNA---LAGRARVMAGD 110

Query: 74  VTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLED-SFEKWIRTAC 132
           +     +R    L+   +D V+ NPPF    GT  PD  +  A  M+E  + E+W+    
Sbjct: 111 L-----DRPPPELRATPFDAVMTNPPFTS-AGTPPPDGGR--ARAMMEGMALERWVARCL 162

Query: 133 AIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQL 192
           A++R  G+   + R   L  +++A   R G + + PL  R G  A R++V  RKG+RG  
Sbjct: 163 ALLRPKGRFFAVHRADRLDDLISALTGRAGEITVLPLWSRAGRPAERVIVAARKGVRGGA 222

Query: 193 RFRYPIVLHKPNGQPYSRFVTDLINGKRSL 222
           R    +VLH+ +   Y+   T L+   ++L
Sbjct: 223 RLLPGLVLHQADATAYTDETTALLRSGKAL 252


>gi|20429104|emb|CAD24416.1| hypothetical protein [Paracoccus zeaxanthinifaciens]
          Length = 246

 Score = 87.4 bits (215), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 68/202 (33%), Positives = 98/202 (48%), Gaps = 12/202 (5%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+   A     + +LG GAG A L +A+R+   +    ER    A YA   LAL  N
Sbjct: 30  VMLAAACRAAPGDSVLELGCGAGVASLCLAARVPGLRCTGLERQ---ADYA--ALAL-RN 83

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
           AQ       + +DV     +   AGL+   +DHVIMNPP+    GT  PD  +  A    
Sbjct: 84  AQECG----LPLDVLTGDLSDPPAGLRGRGFDHVIMNPPYFLG-GTPAPDAGRATARTE- 137

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI 180
           E   + W+      +   G L++I R   L +I+ A   R G++ I P+  R+G  A R+
Sbjct: 138 ETPLDDWLDAGLRRLNPKGWLTVIQRADRLDRIIAALQGRAGAIAILPIAARQGREAGRV 197

Query: 181 LVTGRKGMRGQLRFRYPIVLHK 202
           +V  RKG R  LR   P V+H 
Sbjct: 198 IVAARKGARAPLRLLAPFVMHD 219


>gi|83854854|ref|ZP_00948384.1| hypothetical protein NAS141_09001 [Sulfitobacter sp. NAS-14.1]
 gi|83842697|gb|EAP81864.1| hypothetical protein NAS141_09001 [Sulfitobacter sp. NAS-14.1]
          Length = 249

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 95/202 (47%), Gaps = 14/202 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+ V A     + +LG G GAA L + +R+   Q+   E  P  A  AR+       
Sbjct: 35  VLLAATVPAQAGQRVLELGCGVGAASLCLGARVPGLQLTGVEIQPAYAALARRN------ 88

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
              +    ++E D+    +   LA L+   +DHV+ NPP+ +R  ++       E  +  
Sbjct: 89  ---NPAFEVVEADI----DAMPLA-LRQRQFDHVLANPPYFDRHASVAATNSGRETALGE 140

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI 180
               E W++ A   +   GQ   I R + L  ++ A    +GS+E+ P+ PR G  A  +
Sbjct: 141 ATPLETWVKIAAKRLAPKGQAHFIHRAERLPDLIRALPHDMGSIEVLPIAPRIGRMAELV 200

Query: 181 LVTGRKGMRGQLRFRYPIVLHK 202
           ++  RK  RG  R   P+++H+
Sbjct: 201 ILRARKSGRGAFRLNAPLIMHE 222


>gi|260576243|ref|ZP_05844235.1| methyltransferase small [Rhodobacter sp. SW2]
 gi|259021511|gb|EEW24815.1| methyltransferase small [Rhodobacter sp. SW2]
          Length = 252

 Score = 86.7 bits (213), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 63/201 (31%), Positives = 98/201 (48%), Gaps = 12/201 (5%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+ V A+    + DLG GAG A L + +R+    +   E   L A YA   LA    
Sbjct: 33  VLLAACVGASAGQSVLDLGCGAGTAVLCLGARVPGLALAGLE---LQADYA--DLARRNA 87

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
           A+    + ++E D+        + G+    +DHVI NPP+    G+ +PD  ++ A +  
Sbjct: 88  ARNGLALEVVEGDLA------QMPGVLLRDFDHVIANPPYYPTTGSASPDAGRDMA-LRT 140

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI 180
                 WI +A   +   G L+LI     L + + A   R+GS+ + PL PREG  A R+
Sbjct: 141 SQPLALWIESATRRLAPGGWLTLILGTDRLPEALAAMDARLGSVAVLPLAPREGRPALRV 200

Query: 181 LVTGRKGMRGQLRFRYPIVLH 201
           +V  RKG R   R   P ++H
Sbjct: 201 IVQARKGGRAAFRLLPPFIMH 221


>gi|126740545|ref|ZP_01756232.1| hypothetical protein RSK20926_04237 [Roseobacter sp. SK209-2-6]
 gi|126718346|gb|EBA15061.1| hypothetical protein RSK20926_04237 [Roseobacter sp. SK209-2-6]
          Length = 271

 Score = 86.7 bits (213), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 99/203 (48%), Gaps = 12/203 (5%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+ +       + +LG GAG   L + +R+ + ++   E  P  A  AR+       
Sbjct: 51  VLLAAAIPVHSGQKVLELGCGAGQMLLCLGARVADLRLTGVELQPAYADLARRN-----G 105

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTP-DKIKEEAHVM 119
            + ++ + +I+ D+T +  +     L+   +DHV+ NPP+  R G  +P      +  + 
Sbjct: 106 CENAQDLEIIQADLTHLPTD-----LRQRQFDHVMANPPYF-RAGAHSPAQDAGRQVALA 159

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASR 179
                E WI  A   +   G L +I R   L ++++AC  R+GSLE  PL  R+G  A  
Sbjct: 160 GPTPLELWIDVAARRLSHKGYLHMIQRADRLPEMLSACVGRLGSLEALPLAARDGRQAEL 219

Query: 180 ILVTGRKGMRGQLRFRYPIVLHK 202
           +++  RKG R + R   P VLH+
Sbjct: 220 VILRARKGGRAEFRLHAPFVLHQ 242


>gi|126463164|ref|YP_001044278.1| methyltransferase small [Rhodobacter sphaeroides ATCC 17029]
 gi|126104828|gb|ABN77506.1| methyltransferase small [Rhodobacter sphaeroides ATCC 17029]
          Length = 253

 Score = 86.3 bits (212), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 65/202 (32%), Positives = 96/202 (47%), Gaps = 11/202 (5%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+ V A+    + +LG GAG A L +A+R+   ++   E  P  A  AR+  AL   
Sbjct: 33  VLLAAAVPASAGQSVLELGCGAGVASLCLAARVPGLRLAGLELQPAYAALARENAALNGV 92

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
           A     + ++E D++ +      A L+ +F DHVI NPP+    G         E  +  
Sbjct: 93  A-----LEVVEGDLSAM-----PAALRQSF-DHVIANPPYYPAGGGTGAADPGRERAMRE 141

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI 180
           E     W+  A   +   G LSLI     L   + A   R+GS  + PL PREG  A R+
Sbjct: 142 ETPLATWVEAAVRRLAPRGVLSLIFGADRLPDALAALDGRMGSSVLLPLQPREGRPAKRV 201

Query: 181 LVTGRKGMRGQLRFRYPIVLHK 202
           ++  RKG R   R   P VLH+
Sbjct: 202 ILQSRKGGRAPFRLLPPFVLHE 223


>gi|77464322|ref|YP_353826.1| N-6 adenine-specific DNA methylase [Rhodobacter sphaeroides 2.4.1]
 gi|77388740|gb|ABA79925.1| N-6 Adenine-specific DNA methylase [Rhodobacter sphaeroides 2.4.1]
          Length = 253

 Score = 85.9 bits (211), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 65/202 (32%), Positives = 96/202 (47%), Gaps = 11/202 (5%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+ V A+    + +LG GAG A L +A+R+   ++   E  P  A  AR+  A+   
Sbjct: 33  VLLAAAVPASAGQSVLELGCGAGVASLCLAARVPGLRLAGLELQPAYAALARENAAMNGV 92

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
           A     + ++E D++ +      A L+ +F DHVI NPP+    G         E  +  
Sbjct: 93  A-----LEVVEGDLSAM-----PAALRQSF-DHVIANPPYYPAGGGTGAADPGRERAMRE 141

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI 180
           E     WI  A   +   G LSLI     L   + A   R+GS  + PL PREG  A R+
Sbjct: 142 ETPLATWIEAAVRRLAPRGVLSLIFGADRLPDALAALDGRMGSSVLLPLQPREGRPAKRV 201

Query: 181 LVTGRKGMRGQLRFRYPIVLHK 202
           ++  RKG R   R   P VLH+
Sbjct: 202 ILQSRKGGRAPFRLLPPFVLHE 223


>gi|332559213|ref|ZP_08413535.1| methyltransferase small [Rhodobacter sphaeroides WS8N]
 gi|332276925|gb|EGJ22240.1| methyltransferase small [Rhodobacter sphaeroides WS8N]
          Length = 253

 Score = 85.5 bits (210), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 64/202 (31%), Positives = 96/202 (47%), Gaps = 11/202 (5%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+ V A+    + +LG GAG A L +A+R+   ++   E  P  A  AR+  A+   
Sbjct: 33  VLLAAAVPASAGQSVLELGCGAGVASLCLAARVPGLRLAGLELQPAYAALARENAAMNGV 92

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
           A     + ++E D++ +      A L+ +F DHVI NPP+    G         E  +  
Sbjct: 93  A-----LEVVEGDLSAM-----PAALRQSF-DHVIANPPYYPAGGGTGAADPGRERAMRE 141

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI 180
           E     W+  A   +   G LSLI     L   + A   R+GS  + PL PREG  A R+
Sbjct: 142 ETPLATWVEAAVRRLAPRGVLSLIFGADRLPDALAALDGRMGSSVLLPLQPREGRPAKRV 201

Query: 181 LVTGRKGMRGQLRFRYPIVLHK 202
           ++  RKG R   R   P VLH+
Sbjct: 202 ILQSRKGGRAPFRLLPPFVLHE 223


>gi|182678943|ref|YP_001833089.1| methyltransferase small [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|182634826|gb|ACB95600.1| methyltransferase small [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 258

 Score = 85.5 bits (210), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 57/168 (33%), Positives = 81/168 (48%), Gaps = 8/168 (4%)

Query: 38  ILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMN 97
           I L ER P  A  A + L L    Q+++R  +   D+ L   +R  AGLK      VI N
Sbjct: 73  IGLVEREPGTAQLAAENLHL---NQLAERGHVFVADL-LSPASRREAGLKEGAAQMVITN 128

Query: 98  PPFNERIGTMTPDKIKEEAHVMLEDS----FEKWIRTACAIMRSSGQLSLIARPQSLIQI 153
           PPF +      P   +     M+E +     E+WI  + A++ + G   +I RP+ L  I
Sbjct: 129 PPFYDPACMRPPQDARRRQAAMMEAAGPVPLERWIGASLALLAADGLFLMIHRPEVLGTI 188

Query: 154 VNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLH 201
           + ACA R G+L I P+      CA R+L+  RKG R  L    P+VL 
Sbjct: 189 IGACAGRAGALVILPIQTSPKSCAKRVLIRARKGSRAPLAIAPPLVLQ 236


>gi|149202963|ref|ZP_01879934.1| methyltransferase small [Roseovarius sp. TM1035]
 gi|149143509|gb|EDM31545.1| methyltransferase small [Roseovarius sp. TM1035]
          Length = 235

 Score = 85.5 bits (210), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 70/227 (30%), Positives = 103/227 (45%), Gaps = 15/227 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+ V A     L DLG G+G A L VASR+    +   E   + A YA   LA   +
Sbjct: 15  VLLAASVPARAGQSLLDLGCGSGIAALCVASRVPGVTLAGLE---IQAAYA--ALARQNS 69

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
           A     + + E D+  +      A L+   +DHVI NPP+ ER  +        E  +  
Sbjct: 70  ASNGIALEVFEGDIADM-----PASLRRRQFDHVIANPPYFERDRSTPASDTGREKAMGE 124

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI 180
                 W+  A       G ++ I R + L  ++ A A  +GS+EI PL PR G  A  I
Sbjct: 125 ALPLADWVHAAARRTGVGGTVTFIQRVERLPDLLAAMATHLGSIEILPLTPRRGRAARLI 184

Query: 181 LVTGRKGMRGQLRFRYPIVLHK-----PNGQPYSRFVTDLINGKRSL 222
           L+ GRKG R  LR     +LH       +G  Y+   +D++    +L
Sbjct: 185 LLRGRKGGRAALRLHDGWLLHAGENHGQDGADYTTATSDVLRNAAAL 231


>gi|254487436|ref|ZP_05100641.1| methyltransferase small [Roseobacter sp. GAI101]
 gi|214044305|gb|EEB84943.1| methyltransferase small [Roseobacter sp. GAI101]
          Length = 249

 Score = 84.7 bits (208), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 93/202 (46%), Gaps = 14/202 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+ V A     + +LG G GAA L + +R+    +   E  P  A  AR+       
Sbjct: 35  VLLAATVPAQAGQRVLELGCGVGAASLCLGARVPGLTLTGVELQPAYAALARRN------ 88

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
                   ++E D+        LA ++   +DHV+ NPP+ +R  ++       E  +  
Sbjct: 89  ---GPDFEVVEADLA----QMPLA-VRQRQFDHVLANPPYFDRDASIASQDAAREVALGE 140

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI 180
               E W++ A   +   GQ   I R + L +++ A    +GS+E+ P+ PR G  A  I
Sbjct: 141 RTPLEIWVQIAAKRLAPKGQAHFIHRAERLPELIRALPHDMGSIEVLPIAPRMGRAAELI 200

Query: 181 LVTGRKGMRGQLRFRYPIVLHK 202
           ++  RK  RG  R   P+V+H+
Sbjct: 201 ILRARKSGRGAFRLCAPLVMHE 222


>gi|85705712|ref|ZP_01036809.1| hypothetical protein ROS217_10442 [Roseovarius sp. 217]
 gi|85669702|gb|EAQ24566.1| hypothetical protein ROS217_10442 [Roseovarius sp. 217]
          Length = 257

 Score = 84.7 bits (208), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 74/228 (32%), Positives = 110/228 (48%), Gaps = 17/228 (7%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+ V A     L DLG G+G A L VA+R+    +   E  P  A  AR+  A    
Sbjct: 37  VLLAASVPARAGQTLLDLGCGSGIAALCVAARVPGVSLAGLEIQPAYAVLARRNSA---- 92

Query: 61  AQISKRISLIEVDVTLVGENRNL-AGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVM 119
                  + + +DVT  G+  +L A L+   +DHVI+NPP+ +R  +   +    E  + 
Sbjct: 93  ------TNGLALDVT-EGDIADLPAELRARQFDHVIVNPPYFDRDHSTAAEDSGRERAMG 145

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASR 179
                  W+R A    R+ G ++LI R + L   +   A  +GSLEI PL PR G  A  
Sbjct: 146 EALPLTDWVRAAARRTRAGGTVTLIQRAERLPDFLATMAAHLGSLEILPLIPRRGRAARL 205

Query: 180 ILVTGRKGMRGQLRFRYPIVLHK-----PNGQPYSRFVTDLINGKRSL 222
           ILV GRKG R  LR     +LH       +G+ Y+   +D++    +L
Sbjct: 206 ILVRGRKGGRAALRLHDGWLLHAGHDHGQDGEDYTAPTSDVLRNAAAL 253


>gi|259415189|ref|ZP_05739111.1| methyltransferase small [Silicibacter sp. TrichCH4B]
 gi|259349099|gb|EEW60853.1| methyltransferase small [Silicibacter sp. TrichCH4B]
          Length = 262

 Score = 84.7 bits (208), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 66/215 (30%), Positives = 99/215 (46%), Gaps = 17/215 (7%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+ VNA     + +LG GAG A L +A+R+ + +I   E     A  AR+  A  A 
Sbjct: 38  VLLAAAVNARPGQSVLELGCGAGQAFLCLAARVQDLKITGVELQAAYAELARRNAAENAT 97

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
           A      +L ++           A L+   +DHVI NPP+  R G  +          + 
Sbjct: 98  AAHVATANLSDLP----------ADLRQQRFDHVIANPPYY-RAGAHSQASDAGRRTALG 146

Query: 121 EDS-FEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASR 179
           E +  E W   A   +   G L +I R   L  ++ A   R+GSLEI PL PR G  A  
Sbjct: 147 EGTPLELWFDVAARRLAPKGYLHMIQRVDRLPDMMAAAQGRLGSLEILPLAPRIGRAAEL 206

Query: 180 ILVTGRKGMRGQLRFRYPIVL-----HKPNGQPYS 209
           +++  RKG R   R   P+++     H+ +G  YS
Sbjct: 207 VILRARKGGRADFRLHAPLLMHDGATHQTDGDDYS 241


>gi|254477393|ref|ZP_05090779.1| methyltransferase small [Ruegeria sp. R11]
 gi|214031636|gb|EEB72471.1| methyltransferase small [Ruegeria sp. R11]
          Length = 256

 Score = 84.0 bits (206), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 100/203 (49%), Gaps = 12/203 (5%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+ V A     + +LG G G A L +A+R+    +   E   L A+YA         
Sbjct: 36  VLLAAAVPARSGMRVLELGCGGGQALLCLAARVPGLALSGLE---LQANYADLARR--NA 90

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
           A  +  +S+ E D++ +  +     L++  +DHVI NPP+  R G  +P +       + 
Sbjct: 91  ALNAADLSVFEGDLSALPVD-----LRHQQFDHVIANPPYY-RAGAHSPAQDAGRQIALG 144

Query: 121 EDS-FEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASR 179
            D+  E W   A   +   G L +I R   L +++ AC  R+GS+E+ PL PR G  A  
Sbjct: 145 GDTPLELWFDAAARRLAHKGYLHMIQRADRLPEMLAACLGRLGSVEVLPLSPRVGRGAEL 204

Query: 180 ILVTGRKGMRGQLRFRYPIVLHK 202
           +L+  RKG R   R   P+VLH+
Sbjct: 205 VLLRARKGGRANFRLHSPLVLHE 227


>gi|75676774|ref|YP_319195.1| methyltransferase small [Nitrobacter winogradskyi Nb-255]
 gi|74421644|gb|ABA05843.1| methyltransferase small [Nitrobacter winogradskyi Nb-255]
          Length = 261

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/190 (30%), Positives = 91/190 (47%), Gaps = 6/190 (3%)

Query: 31  SRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNF 90
           +R+    ++L ER   +A  A +   L    +++ R+ ++  D+    +    AGL  + 
Sbjct: 64  TRIDNIDLVLIERDETLAGLAGRNALL---NRLAARVCVL--DIAAEADAFAAAGLGPDS 118

Query: 91  YDHVIMNPPFNERI-GTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQS 149
            D V+MNPPFN+      +PD+ +  AHV    + + W   A  +++S G LSLI R   
Sbjct: 119 ADGVLMNPPFNDAARHRPSPDQSRRAAHVADPSTLDIWTHAARRMLKSGGALSLIWRSDG 178

Query: 150 LIQIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYS 209
           L +++ A  R  G + I P+HP     A RILV   KG R  LR    ++L    GQP  
Sbjct: 179 LAEVLGALGRGFGGIAIRPVHPDPRRPAIRILVRAIKGSRAPLRLCPGLMLSDEMGQPDK 238

Query: 210 RFVTDLINGK 219
                L  G+
Sbjct: 239 EAQGSLAGGE 248


>gi|90425824|ref|YP_534194.1| methyltransferase small [Rhodopseudomonas palustris BisB18]
 gi|90107838|gb|ABD89875.1| methyltransferase small [Rhodopseudomonas palustris BisB18]
          Length = 253

 Score = 83.2 bits (204), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/177 (32%), Positives = 89/177 (50%), Gaps = 10/177 (5%)

Query: 32  RLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV--TLVGENRNLAGLKNN 89
           R+    ++L E    +A  AR   AL    Q+S  + +++V+   T   E    AGL  +
Sbjct: 64  RVAGVDLMLLEIDAGLAELARGNAAL---NQLSAAVFVLDVEAGATAFAE----AGLFPD 116

Query: 90  FYDHVIMNPPFNERI-GTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQ 148
             D V+MNPPFN+      +PD  +  AHV    + E W+  A  I++S G+L+LI R  
Sbjct: 117 SVDAVLMNPPFNDAARHRGSPDAGRRLAHVAARSTLEGWVHAARRILKSGGELTLIWRAD 176

Query: 149 SLIQIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNG 205
           ++ +++ A  R  G L I P+HP+ G  A R+LV   KG R  L     ++L    G
Sbjct: 177 AIAEVLEALDRGFGGLVILPVHPQPGLPAIRVLVRASKGGRAPLSLLPGLMLRDEAG 233


>gi|86748215|ref|YP_484711.1| methyltransferase small [Rhodopseudomonas palustris HaA2]
 gi|86571243|gb|ABD05800.1| Methyltransferase small [Rhodopseudomonas palustris HaA2]
          Length = 265

 Score = 82.8 bits (203), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 75/135 (55%), Gaps = 2/135 (1%)

Query: 89  NFYDHVIMNPPFNE-RIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARP 147
           +  D V+MNPPFN+      +PD  ++ AHV    + E W+  A  +++S G L+LI R 
Sbjct: 116 DSVDVVLMNPPFNDPSRHRGSPDGARQAAHVATATTLESWVHAARRVLKSGGALTLIWRA 175

Query: 148 QSLIQIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQP 207
             L +++ A AR  GSL + P+H +  E A R+L+   KG R  L+    + L++ +G P
Sbjct: 176 DGLAEVLAALARGFGSLALLPVHGKPDEPAIRVLIRAVKGGRAPLQIHAAVHLNEASGTP 235

Query: 208 YSRFVTDLINGKRSL 222
            +     ++NG++ L
Sbjct: 236 TA-LARAVLNGEQIL 249


>gi|163745679|ref|ZP_02153039.1| hypothetical protein OIHEL45_08810 [Oceanibulbus indolifex HEL-45]
 gi|161382497|gb|EDQ06906.1| hypothetical protein OIHEL45_08810 [Oceanibulbus indolifex HEL-45]
          Length = 255

 Score = 82.0 bits (201), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 54/201 (26%), Positives = 94/201 (46%), Gaps = 13/201 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+ V A     + +LG G GAA L +++R+    +   E  P  A  AR+       
Sbjct: 37  VLLAASVEAAAGQSVLELGCGVGAAVLCLSARVPGLALTGCELQPAYADLARRN------ 90

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
                 + ++E D+T +  +     L+   +DHV+ NPP+ +R  ++       EA +  
Sbjct: 91  --GGDVLEVVEADLTDMPLH-----LRQRQFDHVLANPPYFDRAASVQSRDPGREAALGE 143

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI 180
                +W+R A   ++  GQ   I R + L +++ A    +GS+E+ PL  R G   + I
Sbjct: 144 ATPLRQWVRIAAKRLKPKGQAHFIHRAERLPELLAALPHEMGSVEVLPLFSRAGRMPALI 203

Query: 181 LVTGRKGMRGQLRFRYPIVLH 201
           L+  RK  RG  R  +   +H
Sbjct: 204 LLRARKNGRGAFRLHHSYAMH 224


>gi|221640206|ref|YP_002526468.1| methyltransferase small [Rhodobacter sphaeroides KD131]
 gi|221160987|gb|ACM01967.1| Methyltransferase small [Rhodobacter sphaeroides KD131]
          Length = 253

 Score = 81.6 bits (200), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 65/202 (32%), Positives = 95/202 (47%), Gaps = 11/202 (5%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+ V A+    + +LG GAG A L +A+R+   ++   E  P  A  AR+  A+   
Sbjct: 33  VLLAAAVPASAGQSVLELGCGAGVASLCLAARVPGLRLAGLELQPAYAALARENAAMNGV 92

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
           A     + ++E D++ +      A L+ +F DHVI NPP+    G         E  +  
Sbjct: 93  A-----LEVVEGDLSAM-----PAVLRRSF-DHVIANPPYYPAGGGTGAADPGRERAMRE 141

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI 180
           E     WI  A   +   G LSLI     L   + A   R GS  + PL PREG  A R+
Sbjct: 142 ETPLALWIEAAVRRLAPRGVLSLIFGADRLPDALAALDGRRGSSVLLPLQPREGRPAKRV 201

Query: 181 LVTGRKGMRGQLRFRYPIVLHK 202
           ++  RKG R   R   P VLH+
Sbjct: 202 ILQSRKGGRAPFRLLPPFVLHE 223


>gi|114570732|ref|YP_757412.1| methyltransferase small [Maricaulis maris MCS10]
 gi|114341194|gb|ABI66474.1| methyltransferase small [Maricaulis maris MCS10]
          Length = 242

 Score = 81.3 bits (199), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 80/161 (49%), Gaps = 11/161 (6%)

Query: 63  ISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLED 122
           +  R+ +   D+T +G +  +        D V  NPPF +    + P K ++ A  +  D
Sbjct: 88  MGARVRVQNSDITQLGTSLKV--------DQVFFNPPFFDDPAALRPPKDEKRAAWLTGD 139

Query: 123 -SFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRIL 181
             F  W+R A   +++ G+L+LI R   L  I+ A  R  GS+ I P+HPR GE A R++
Sbjct: 140 VPFADWVRCAARALKAKGKLTLIHRADRLADILTALERSFGSVVIKPIHPRAGEPAKRVI 199

Query: 182 VTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSL 222
           V    G +  L    P++LH  +G+ +S     ++ GK  L
Sbjct: 200 VRATIGGKSPLVLLAPLILH--DGESHSAEAHAILRGKAVL 238


>gi|296447429|ref|ZP_06889354.1| methyltransferase small [Methylosinus trichosporium OB3b]
 gi|296255049|gb|EFH02151.1| methyltransferase small [Methylosinus trichosporium OB3b]
          Length = 267

 Score = 81.3 bits (199), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 57/160 (35%), Positives = 85/160 (53%), Gaps = 4/160 (2%)

Query: 64  SKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF-NERIGTMTPDKIKEEAHVMLED 122
           + R+ L E D+ L   +R  AG+ +   D V+ NPPF +     ++PD  +  AHV    
Sbjct: 109 ATRVRLCEADL-LSPASRRAAGIVDEAADLVLTNPPFLDPARSRVSPDPRRALAHVA-AG 166

Query: 123 SFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRILV 182
             E W+R   A++R  G+L+LI R  +L   +     R+G L I P+ PR GE A+RIL+
Sbjct: 167 GLEPWLRACLALLRPGGELALIHRADALTDCLAGLGARLGGLRILPVAPRAGEPATRILL 226

Query: 183 TGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSL 222
            G KG +  L    P+VLH+ +G  ++R    L  G  SL
Sbjct: 227 RGVKGSKAPLALLAPLVLHEADGA-FTREAEALARGDGSL 265


>gi|294085839|ref|YP_003552599.1| putative O-methyltransferase [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292665414|gb|ADE40515.1| Predicted O-methyltransferase [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 253

 Score = 80.5 bits (197), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 52/203 (25%), Positives = 96/203 (47%), Gaps = 11/203 (5%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           D+G G G   L +A RL +  +   E  P M   A + +    +  ++ +I L      L
Sbjct: 50  DMGCGVGGVALCIAKRLPDVHVTAVEIDPDMLALAERNIK---DNNLAAQIRL------L 100

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMR 136
            G+ + L+ +  N +DHV+ NPP+++  GT   ++ +  AH+  +     W++ A    +
Sbjct: 101 TGDIKALSPVLANSFDHVVSNPPYHDTRGTRPQNRSRALAHMGEDTKLADWVKAAIWATK 160

Query: 137 SSGQLSLIARPQSLIQIVNACARR-IGSLEITPLHPREGECASRILVTGRKGMRGQLRFR 195
             G++S I R     +++ A      G   + PL PR    ASR+++  RK + G     
Sbjct: 161 PRGRISFICRADRASELITAFETNGAGETLLCPLWPRHDTPASRVIIQVRKTITGPGAIL 220

Query: 196 YPIVLHKPNGQPYSRFVTDLING 218
             +VLH  +G  Y++  + ++ G
Sbjct: 221 PGLVLHNDSGD-YTQSASRIMQG 242


>gi|84500215|ref|ZP_00998481.1| hypothetical protein OB2597_09744 [Oceanicola batsensis HTCC2597]
 gi|84392149|gb|EAQ04417.1| hypothetical protein OB2597_09744 [Oceanicola batsensis HTCC2597]
          Length = 257

 Score = 80.5 bits (197), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 60/202 (29%), Positives = 94/202 (46%), Gaps = 12/202 (5%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           + LA+ V A     + DLG GAGAA L +  R+   ++   ER P+ A  AR+      N
Sbjct: 32  VFLAASVGARPGQSVLDLGCGAGAASLCLGRRVAGLRLTGLERQPVYAELARR------N 85

Query: 61  A-QISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVM 119
           A +      ++E D++ +  +     L+   +DHVI NPP+  R  ++       E  + 
Sbjct: 86  AIENGLAFEVVEGDLSDMPTH-----LRQRSFDHVIANPPYFRRDRSLRARDAAREGAMG 140

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASR 179
            E     W+  A       G ++ I R   L +++ A    +GSLE+ PL PREG  +  
Sbjct: 141 EETPLSDWVAAAARRCAPRGTVTFINRVDRLPEMLAAFESCLGSLELFPLIPREGRESQL 200

Query: 180 ILVTGRKGMRGQLRFRYPIVLH 201
            L+ GRK  R   R    +V+H
Sbjct: 201 FLLRGRKEGRAAFRLHRGLVVH 222


>gi|89052980|ref|YP_508431.1| methyltransferase small [Jannaschia sp. CCS1]
 gi|88862529|gb|ABD53406.1| methyltransferase small [Jannaschia sp. CCS1]
          Length = 247

 Score = 80.1 bits (196), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 95/202 (47%), Gaps = 19/202 (9%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           + LA+   AT    + +LG G G A L + +R+   ++   ER    A  AR+       
Sbjct: 37  VFLAAACPATTGESVLELGCGVGVAALCLQARVPGVEVTGVERQAAYADLARR------- 89

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
                 + +++ D+T +        L+   +DHVI NPP+    GT + D  ++EA +  
Sbjct: 90  ----NGVDVVQADLTSL-----PTALRQRSFDHVIANPPYYG-PGTGSDDAGRDEA-LRE 138

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI 180
           E    +W R A A +   G L++I   + L  ++ A     GS+ + PL  REG  A R+
Sbjct: 139 ETPLAEWGRIARARLIPGGWLTMIHMAERLPDVLGALTG-FGSISVLPLAAREGRAAGRV 197

Query: 181 LVTGRKGMRGQLRFRYPIVLHK 202
           +V  RKG RG  R   P+ +H 
Sbjct: 198 VVRARKGARGAFRLLPPVHVHD 219


>gi|126726040|ref|ZP_01741882.1| N-6 Adenine-specific DNA methylase [Rhodobacterales bacterium
           HTCC2150]
 gi|126705244|gb|EBA04335.1| N-6 Adenine-specific DNA methylase [Rhodobacterales bacterium
           HTCC2150]
          Length = 246

 Score = 79.7 bits (195), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 64/209 (30%), Positives = 101/209 (48%), Gaps = 19/209 (9%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           +LG G G A L + SR+  +   L     L + YA   LA    A+    + +IE D+  
Sbjct: 45  ELGCGVGVASLCLMSRVDVSVTGL----ELQSDYA--ALARQNAARNQFEMDIIEGDIAA 98

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNERIG-TMTPDKIKEEAHVMLEDSFEKWIRTACAIM 135
           +        L+   +DHVI NPP+  + G T   D  +E A+  + D  + W+  A   +
Sbjct: 99  LPSE-----LREQSFDHVIANPPYYPKGGGTSAADAGREFANREILD-LDVWVDAAARRL 152

Query: 136 RSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFR 195
           +  G L+LI   + + +++ A   R G++EI PL  R G  A RI++  RKG +  LR R
Sbjct: 153 KPKGWLTLIILAERMGELLVAMGDRFGAVEIIPLTARVGRDAGRIILRARKGAKAPLRLR 212

Query: 196 YPIVLHK-----PNGQPYSRFVTDLI-NG 218
            P V+H       +G  YS    +++ NG
Sbjct: 213 VPFVIHDGATHGSDGADYSEEAENILRNG 241


>gi|294678698|ref|YP_003579313.1| methyltransferase small domain-containing protein [Rhodobacter
           capsulatus SB 1003]
 gi|294477518|gb|ADE86906.1| methyltransferase small domain protein [Rhodobacter capsulatus SB
           1003]
          Length = 253

 Score = 79.7 bits (195), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 64/202 (31%), Positives = 92/202 (45%), Gaps = 12/202 (5%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+   A     + +LG GAG A L +  R+        E  P  A  AR+  A  AN
Sbjct: 33  VLLAAACGAKPGQSVLELGCGAGVASLCLGWRVKGLVQAGLELQPAYADLARRNAA--AN 90

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPP-FNERIGTMTPDKIKEEAHVM 119
                 + + E D+      R  A L+   YDHVI NPP F    GT   D  +E A   
Sbjct: 91  ---GVPLEVFEGDLA-----RMPAALRARNYDHVIANPPYFAASGGTAAADAGRERAQRE 142

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASR 179
           +      W+R     ++  G L+LI     L  I+ A A + G++ + P+  R+G  A R
Sbjct: 143 VT-PLADWVRAGMRRLQPGGWLTLIQNADRLGDILAALAGQGGAVTVLPIAARQGRAAGR 201

Query: 180 ILVTGRKGMRGQLRFRYPIVLH 201
           ++V  RKG +  LR   P VLH
Sbjct: 202 VIVAARKGGKTPLRLLAPFVLH 223


>gi|254450580|ref|ZP_05064017.1| methyltransferase small [Octadecabacter antarcticus 238]
 gi|198264986|gb|EDY89256.1| methyltransferase small [Octadecabacter antarcticus 238]
          Length = 253

 Score = 79.7 bits (195), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 60/205 (29%), Positives = 101/205 (49%), Gaps = 16/205 (7%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+ V A     + DLG G GAA L +A+R+    +   E  P  A   R       N
Sbjct: 33  VLLAAAVRAQAGQSVLDLGCGTGAALLCLATRVSGLALHGVEVQPRYADLCR------VN 86

Query: 61  AQISKRISLIEVDVTL-VGENRNL-AGLKNNFYDHVIMNPPFNERI-GTMTPDKIKEEAH 117
           A  +       +D T+   + R+L + L+   +DHV++NPP+ +R  G  +P   ++ A 
Sbjct: 87  ATANN------IDTTIWTADLRDLPSDLRALTFDHVMVNPPYFKRSSGNSSPLPDRDIAF 140

Query: 118 VMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECA 177
              + +   WI TA   ++  G L++I +   L  ++ A   R+G++ + P+  R+G  A
Sbjct: 141 AG-DTATVNWIDTATRRLKPKGTLTMIQKADRLPDLLRAIDERLGAINVYPITGRDGRAA 199

Query: 178 SRILVTGRKGMRGQLRFRYPIVLHK 202
            RI++  RKG R   +   PI LH 
Sbjct: 200 DRIILRARKGGRTPFKLHAPIPLHD 224


>gi|254467260|ref|ZP_05080671.1| methyltransferase small [Rhodobacterales bacterium Y4I]
 gi|206688168|gb|EDZ48650.1| methyltransferase small [Rhodobacterales bacterium Y4I]
          Length = 255

 Score = 79.3 bits (194), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 65/213 (30%), Positives = 95/213 (44%), Gaps = 32/213 (15%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+ V A     + +LG GAG A L + +R+    +   E     A  AR+  A  AN
Sbjct: 35  VLLAAAVPARAGETVLELGCGAGQALLCLGARVPGLALAGVELQAPYADLARRNAA--AN 92

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
            Q    I + E D++ + E      LK   + HVI NPP+            K  AH   
Sbjct: 93  GQA---IDVHEADLSALPE-----ALKLRQFHHVIANPPY-----------YKAGAHSQA 133

Query: 121 EDSFEK-----------WIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPL 169
            D   K           WI  A   +   G+L +I R   L  ++ AC   +GSLE+ PL
Sbjct: 134 RDDGRKVALGEGTPLADWIAVAARRLAPKGRLHMIQRADRLPDMLAACDGVLGSLEVLPL 193

Query: 170 HPREGECASRILVTGRKGMRGQLRFRYPIVLHK 202
            PR+G  A  +++  RKG R   R   P++LH+
Sbjct: 194 APRQGRAAELVILRARKGGRAGFRLHAPLILHE 226


>gi|299134684|ref|ZP_07027876.1| methyltransferase small [Afipia sp. 1NLS2]
 gi|298590494|gb|EFI50697.1| methyltransferase small [Afipia sp. 1NLS2]
          Length = 267

 Score = 79.0 bits (193), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 70/126 (55%), Gaps = 1/126 (0%)

Query: 85  GLKNNFYDHVIMNPPFNERI-GTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSL 143
           GL  +  DHV+MNPPF+       +PD+ +  AHV   ++ + W + A  +++  G L+L
Sbjct: 116 GLPPDHADHVMMNPPFHAADRHRASPDEGRRTAHVDTGETLDVWSKAARRVLKPGGCLTL 175

Query: 144 IARPQSLIQIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKP 203
           I R   L ++++   R  G++E+ P++P+    A R+LV   KG RG L+    +VL+  
Sbjct: 176 IWRADELDRVLDVLERGFGAVEVIPVYPKPDAVAIRVLVRAIKGSRGPLQILPGLVLNDR 235

Query: 204 NGQPYS 209
            G P +
Sbjct: 236 QGHPTA 241


>gi|209886072|ref|YP_002289929.1| methyltransferase small [Oligotropha carboxidovorans OM5]
 gi|209874268|gb|ACI94064.1| methyltransferase small [Oligotropha carboxidovorans OM5]
          Length = 266

 Score = 78.6 bits (192), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 46/128 (35%), Positives = 69/128 (53%), Gaps = 3/128 (2%)

Query: 84  AGLKNNFYDHVIMNPPFN--ERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQL 141
           AGL  +  DHV+MNPPF+  ER    +PD  +  AH+   +  + W+  A  +++S G L
Sbjct: 115 AGLPPDCADHVLMNPPFHAAER-HRASPDAARRTAHLDEGEVLDVWVGAARRVLKSGGTL 173

Query: 142 SLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLH 201
           +LI R   L +++ A  R  G +EI P++P+    A RILV   KG R  L     +VL+
Sbjct: 174 TLIWRADELDRVLAALRRGFGGIEIVPVYPKPEGAAIRILVRAVKGSRAPLHLCAGLVLN 233

Query: 202 KPNGQPYS 209
              G P +
Sbjct: 234 DVAGNPSA 241


>gi|114327554|ref|YP_744711.1| methyltransferase [Granulibacter bethesdensis CGDNIH1]
 gi|114315728|gb|ABI61788.1| methyltransferase [Granulibacter bethesdensis CGDNIH1]
          Length = 250

 Score = 77.8 bits (190), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 58/207 (28%), Positives = 103/207 (49%), Gaps = 9/207 (4%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+ + A     + + G G GA  L +A R+   Q    E+S  +A  AR+ +     
Sbjct: 33  VLLAAAIPARAEERVLEAGTGPGAGLLCLAHRVPGIQGTGVEKSSDIATLARQNVQ---T 89

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
             +  R+S+I  D+    +   ++G  +N YDHV  NPP++E   + +P  ++++A    
Sbjct: 90  NHLENRLSIITQDILDFAQE--MSGSPSN-YDHVFANPPWHEEASSPSPVALRDQAKRRH 146

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR--RIGSLEITPLHPREGECAS 178
                +W++   +++R  G +SLI  P +LI       R  + G + + PL P+ G  A 
Sbjct: 147 AGLVSQWVQALGSMVRPRGSISLIL-PAALISEAMTSLREAKAGEISLYPLWPKAGRRAK 205

Query: 179 RILVTGRKGMRGQLRFRYPIVLHKPNG 205
            I+V G K  RG  R    ++LH+ +G
Sbjct: 206 IIIVRGIKAARGPDRVEPGLMLHQEDG 232


>gi|146278503|ref|YP_001168662.1| methyltransferase small [Rhodobacter sphaeroides ATCC 17025]
 gi|145556744|gb|ABP71357.1| methyltransferase small [Rhodobacter sphaeroides ATCC 17025]
          Length = 271

 Score = 77.8 bits (190), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 64/204 (31%), Positives = 95/204 (46%), Gaps = 15/204 (7%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           + LA+ V A     + +LG GAG A L +A+R+   ++   E  P  A  AR        
Sbjct: 51  VFLAAAVPARPGQSVLELGCGAGVASLCLAARVPGLRLAGLEVQPAYAELARVN-----A 105

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIG-TMTPDKIKEEAHVM 119
           A+    + ++E D+        +  +    +DHVI NPP+    G T   D  +E A  M
Sbjct: 106 ARNGVSLEVVEGDLA------AMPPVLRRSFDHVIANPPYYPAGGGTGATDPGRERA--M 157

Query: 120 LEDS-FEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECAS 178
            ED+    WI  A   +   G LSLI     L   ++A   R+GS+ + PL  REG  A 
Sbjct: 158 REDTPLGLWIEAAVRRLAPRGILSLIFGADRLPDALSALDARMGSIAVLPLQAREGRAAK 217

Query: 179 RILVTGRKGMRGQLRFRYPIVLHK 202
           R+++  RKG R   R   P +LH+
Sbjct: 218 RVILQSRKGGRAPFRLLPPFLLHE 241


>gi|83311262|ref|YP_421526.1| O-methyltransferase [Magnetospirillum magneticum AMB-1]
 gi|82946103|dbj|BAE50967.1| Predicted O-methyltransferase [Magnetospirillum magneticum AMB-1]
          Length = 255

 Score = 77.8 bits (190), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 65/208 (31%), Positives = 99/208 (47%), Gaps = 12/208 (5%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+ + A     + DLG G GAA L + +R  + ++   E    +A  AR+   L A 
Sbjct: 33  VLLAAALGARPGERVLDLGCGVGAAALCLLARCPDVEVDGLEVQETLAELARRNAVLNAV 92

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNER-IGTMTPDKIKEEAHVM 119
                        + L    +  AGL    Y HV+ NPPF ER  GT   ++ +  AH  
Sbjct: 93  EGC--------FGIHLGDAAKPPAGLGG--YHHVMTNPPFFERGSGTSAANESRAMAHEE 142

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQI-VNACARRIGSLEITPLHPREGECAS 178
                  W++ A  ++R  G+L+LI R + L  I V    R +G + + PL PR    A 
Sbjct: 143 KGLDLAGWLKAAVKLLRPKGRLTLIHRAERLGDILVGLRGRGVGDVVVVPLWPRADRAAG 202

Query: 179 RILVTGRKGMRGQLRFRYPIVLHKPNGQ 206
           R++V+ RKG+R  LR    +VLH   G+
Sbjct: 203 RVIVSARKGVRSPLRLLPGLVLHGEGGE 230


>gi|23014220|ref|ZP_00054048.1| COG4123: Predicted O-methyltransferase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 250

 Score = 77.4 bits (189), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 64/207 (30%), Positives = 95/207 (45%), Gaps = 12/207 (5%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           + LA+ V A     + DLG G GAA L + +R  +  +   E    +A  AR+   L   
Sbjct: 33  VFLAAAVPARPGERILDLGCGVGAAALCLLARCPDVVVEGLEIQGPLAGLARRNAVL--- 89

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNER-IGTMTPDKIKEEAHVM 119
            +  +  ++   D       R  AGL    + HV+ NPPF E   GT   D  +  AH  
Sbjct: 90  NEAERGFAVHAGDAA-----RPPAGLGG--FHHVMTNPPFFESGSGTRAADASRAMAHEE 142

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECAS 178
                  WI+ A  ++R  G+L LI R + L  I+     R +G + + PL P+ G  A 
Sbjct: 143 GGLDLAGWIKAAVKLLRPKGRLILIHRAERLGDILAGLRGRGVGDVAVLPLWPKNGRGAG 202

Query: 179 RILVTGRKGMRGQLRFRYPIVLHKPNG 205
           R++V+ RK +R  LR    +VLH   G
Sbjct: 203 RVIVSARKSVRSPLRLLPGLVLHDDAG 229


>gi|119384761|ref|YP_915817.1| methyltransferase small [Paracoccus denitrificans PD1222]
 gi|119374528|gb|ABL70121.1| methyltransferase small [Paracoccus denitrificans PD1222]
          Length = 252

 Score = 77.0 bits (188), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 69/225 (30%), Positives = 105/225 (46%), Gaps = 16/225 (7%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+   A     + +LG GAG A L + +R+   ++   E  P  A  AR+  A  A 
Sbjct: 30  VMLAAACPARTGESVLELGCGAGVAMLCLGARVPGLRLAGLELQPSYAELARQNAATNAI 89

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
           A       L + D+      R  A L+   +DHVI NPP+    G+  PD+ +  A   +
Sbjct: 90  AA-----ELHQGDLA-----RMPAALREQSFDHVIANPPYFIG-GSPAPDEGRGRARHEV 138

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI 180
                 WI      +R  G ++LI R   L  I+ A +   G++ I P+  REG  A R+
Sbjct: 139 -TPLPLWIEAGLRRLRPGGWITLIQRADRLGAILAALSVPAGAITILPVTAREGREAGRV 197

Query: 181 LVTGRKGMRGQLRFRYPIVLH-KPNGQPYSRFVTDLINGKRSLTR 224
           +V  RKG R  LR   P V+H KP+   +S    DL    +++ R
Sbjct: 198 IVCARKGARAPLRLLSPFVMHAKPS---HSADREDLTEAAQAVLR 239


>gi|89070185|ref|ZP_01157513.1| N-6 Adenine-specific DNA methylase [Oceanicola granulosus HTCC2516]
 gi|89044201|gb|EAR50352.1| N-6 Adenine-specific DNA methylase [Oceanicola granulosus HTCC2516]
          Length = 255

 Score = 77.0 bits (188), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 63/205 (30%), Positives = 96/205 (46%), Gaps = 18/205 (8%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLA---L 57
           ++LA+ V A       +LG G G A L +A R    ++   E  P  A  AR       L
Sbjct: 35  VLLAAAVPARAGETALELGCGVGVAALCLARRAPGVRVTGVELQPAYAALARANADANDL 94

Query: 58  PANAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPP-FNERIGTMTPDKIKEEA 116
           P        + ++E D+  +       G+++  +DHV+MNPP F    GT + D  ++ A
Sbjct: 95  P--------LEVVEADLRALPP-----GVRSRSFDHVLMNPPYFAPGAGTGSADPGRDTA 141

Query: 117 HVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGEC 176
            +  E +   W+  A   +   G+L+LI R + L +I++ C  R+GSL + PL  R G  
Sbjct: 142 -LRGETAMADWLDVAIRRLAPRGRLTLIQRIERLPEILSGCDGRVGSLVVAPLAARRGRA 200

Query: 177 ASRILVTGRKGMRGQLRFRYPIVLH 201
               L+  RKG R   R   PI LH
Sbjct: 201 PHLFLLQARKGGRTPFRLTDPIRLH 225


>gi|159045610|ref|YP_001534404.1| type 11 methyltransferase [Dinoroseobacter shibae DFL 12]
 gi|157913370|gb|ABV94803.1| methyltransferase type 11 [Dinoroseobacter shibae DFL 12]
          Length = 256

 Score = 76.6 bits (187), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 62/203 (30%), Positives = 89/203 (43%), Gaps = 13/203 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+ V A       DLG G GAA L +  R   A   + E  P  A  AR      AN
Sbjct: 34  VLLAASVPARAGQSCLDLGCGVGAAALCLMVRTGAACTGV-ELQPGYAALAR------AN 86

Query: 61  AQISK-RISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVM 119
           A  +   + +IE D T +  +     L+   +DHV  NPP+     +  P     +  + 
Sbjct: 87  ASRNDLPLEVIEGDATDLPPD-----LRQRSFDHVFFNPPYFAAEASTAPADAGRDLALR 141

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASR 179
                  W+  A    R  G ++LIAR   L +++ A  R +GSL + PL  R G  A R
Sbjct: 142 DRGDLTDWLAAAVRRTRPRGTVTLIARTDRLPEVMAAVPRVLGSLRLQPLVARAGRPAKR 201

Query: 180 ILVTGRKGMRGQLRFRYPIVLHK 202
            ++ G K  R     R P+VLH 
Sbjct: 202 FVLQGIKEGRAPFTLRAPLVLHD 224


>gi|254439341|ref|ZP_05052835.1| Methyltransferase small domain family [Octadecabacter antarcticus
           307]
 gi|198254787|gb|EDY79101.1| Methyltransferase small domain family [Octadecabacter antarcticus
           307]
          Length = 253

 Score = 76.6 bits (187), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 62/204 (30%), Positives = 99/204 (48%), Gaps = 14/204 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+ V A     + +LG G GAA L +A+R+    +   E  P  A   R      AN
Sbjct: 33  VLLAAAVRARVGQSVLELGCGTGAALLCLATRVSGLGLHAVEVQPHYADICR------AN 86

Query: 61  AQISKRISLIEVDVTLVGENRNL-AGLKNNFYDHVIMNPPFNERI-GTMTPDKIKEEAHV 118
           A  +   ++I        + R+L A L+   +DHVI+NPP+ ER  G  +P   ++ A  
Sbjct: 87  AVANHIDAMI-----WTADLRDLPADLRALTFDHVIVNPPYFERASGNSSPLPDRDIAFA 141

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECAS 178
             + +   WI TA   ++  G L+LI +   L  ++ A   R+G++ + P+  R G  A 
Sbjct: 142 G-DTATVDWIDTATRRLKPKGTLTLIQKADRLPDLLRAIDDRLGAIHVYPITGRAGRPAD 200

Query: 179 RILVTGRKGMRGQLRFRYPIVLHK 202
           RI++  RKG R   +    I LH 
Sbjct: 201 RIVLRARKGGRAPFKLHAAIALHD 224


>gi|144898410|emb|CAM75274.1| conserved hypothetical protein [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 249

 Score = 76.3 bits (186), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 57/211 (27%), Positives = 104/211 (49%), Gaps = 18/211 (8%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           + LA+ V+A     + DLG+G G AGL + +R+    +   E    +A  A+      AN
Sbjct: 35  VFLAAAVDARAGERILDLGSGVGTAGLCLLARVDGIHVTGLELQSQLADLAQ------AN 88

Query: 61  A---QISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEA- 116
           A    +  R ++++  +T        A L+   +DHVI NPP+ E  GT+   +   +A 
Sbjct: 89  AVENGLDGRYTVVQGCLT-----SRPATLRGVTFDHVITNPPWYEP-GTIRAPRADSKAI 142

Query: 117 -HVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREG 174
            H+  E    +W+R A   ++  G+L LI R   L +I++     ++G + + P+  ++G
Sbjct: 143 GHLEGEADLAQWLRAAVKYVKPKGRLWLIHRADHLGRILSGLEGLKVGEIRVVPIWSKQG 202

Query: 175 ECASRILVTGRKGMRGQLRFRYPIVLHKPNG 205
             A+R++VT RK  +  +     ++ H  +G
Sbjct: 203 RAATRVVVTARKDSKAPMELLPGLLAHGDDG 233


>gi|83952379|ref|ZP_00961110.1| hypothetical protein ISM_09516 [Roseovarius nubinhibens ISM]
 gi|83836052|gb|EAP75350.1| hypothetical protein ISM_09516 [Roseovarius nubinhibens ISM]
          Length = 253

 Score = 75.9 bits (185), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 60/210 (28%), Positives = 91/210 (43%), Gaps = 10/210 (4%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+ V A       DLG G G AGL +A+R+    +   E  P    YA    A    
Sbjct: 30  VLLAASVPAREGETALDLGCGVGVAGLCLAARVPGVAVTGLELQP---DYAALARANATA 86

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
             +     +IE D+  + E      +K+  +DHV++NPP+ +R  +        E  +  
Sbjct: 87  NGLP--FEVIEGDLATMPE-----AIKSRRFDHVLVNPPYFDRKASRPAQHKGRETAMGE 139

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI 180
                 W+  A       G ++ I R + L  ++   A  +GSLE+ PL PR G  A   
Sbjct: 140 ATPLALWVEMAARRAAPGGSVTFIHRAERLPDLLGHMAAHLGSLELLPLAPRRGREARLC 199

Query: 181 LVTGRKGMRGQLRFRYPIVLHKPNGQPYSR 210
           L+ GRK  R   R   P +LH  +  P  R
Sbjct: 200 LLRGRKEGRANFRLHAPWILHAGDEHPGDR 229


>gi|329848573|ref|ZP_08263601.1| methyltransferase small domain protein [Asticcacaulis biprosthecum
           C19]
 gi|328843636|gb|EGF93205.1| methyltransferase small domain protein [Asticcacaulis biprosthecum
           C19]
          Length = 229

 Score = 75.1 bits (183), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 84/174 (48%), Gaps = 17/174 (9%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           +LG GAG A L++ +R  +  +   ER P+ A  AR+  AL  NA+++    +IE D+  
Sbjct: 31  ELGCGAGGAILSLKARCPDLALTGIEREPVYAGLARENAALNGNAEVT----VIEGDIG- 85

Query: 77  VGENRNLAGLKN---NFYDHVIMNPPFNERIGTM-TPDKIKEEAHVMLEDSFEKWIRTAC 132
                  AG K    + +D V  NPPF +   T+  P   K  A +  +D    W+  A 
Sbjct: 86  -------AGFKTFGLDRFDLVFSNPPFFDDPDTLRAPHDAKRPAWIA-DDGLGAWLDFAL 137

Query: 133 AIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRILVTGRK 186
           A ++  G +  I R   L  I+   + + GS  + P+ P   + A RILV G++
Sbjct: 138 AAVKDGGDIVFIHRADRLADILTGLSSKAGSFRVRPIQPFIEKEAKRILVWGKR 191


>gi|254462690|ref|ZP_05076106.1| methyltransferase small [Rhodobacterales bacterium HTCC2083]
 gi|206679279|gb|EDZ43766.1| methyltransferase small [Rhodobacteraceae bacterium HTCC2083]
          Length = 264

 Score = 74.7 bits (182), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 90/203 (44%), Gaps = 14/203 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+ + A     + +LG G G A L +A RL    +   E     A  AR+       
Sbjct: 42  VLLAASIPAKAGETVLELGCGGGVASLCLARRLVGLTLTGVELQENYADLARRN------ 95

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLK--NNFYDHVIMNPPFNERIGTMTPDKIKEEAHV 118
              ++R +L   D+ +V  + N    +  +  +DHV  NPP+ +R  ++       E  +
Sbjct: 96  ---AERNAL---DLNVVHADINALPFEVLDQRFDHVFANPPYYDRAHSVPARDKGRETGL 149

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECAS 178
                  KW+  A   +   GQ   + R   L  +++A    +GS+E+ PL  R G  A 
Sbjct: 150 GGNTPLRKWVAVASKRLAPKGQAHFVQRADRLADLLSAVHVHLGSIEVQPLCARRGRAAH 209

Query: 179 RILVTGRKGMRGQLRFRYPIVLH 201
            +LV G+K  R   R   PIV+H
Sbjct: 210 LVLVRGKKSGRADFRLHAPIVMH 232


>gi|115526407|ref|YP_783318.1| methyltransferase small [Rhodopseudomonas palustris BisA53]
 gi|115520354|gb|ABJ08338.1| methyltransferase small [Rhodopseudomonas palustris BisA53]
          Length = 248

 Score = 73.6 bits (179), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 71/212 (33%), Positives = 105/212 (49%), Gaps = 14/212 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLA---L 57
           M+LA+   A G   + D GAG GAAGLA+ASR+    + L E +P +A  AR   A   L
Sbjct: 27  MLLAASTPARGGDRVVDFGAGVGAAGLALASRVRGLDLALLEIAPELAELARHNAAFNAL 86

Query: 58  PANAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTM--TPDKIKEE 115
           PA         ++ +DV          GL  +  D V+MNPPFN+  G    +PD  ++ 
Sbjct: 87  PAE--------ILVMDVEAGAAAFAANGLAPDSVDVVLMNPPFND-AGRHRGSPDASRQR 137

Query: 116 AHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGE 175
           AHV    + + W+  A  +++ SG L+LI R   L +++ A  R  G + I P+H     
Sbjct: 138 AHVATPTTLQGWVHAARRLLKPSGVLTLIWRGDGLAEVLVALDRGFGGVAIQPVHGEADA 197

Query: 176 CASRILVTGRKGMRGQLRFRYPIVLHKPNGQP 207
            A R+LV   KG R  L     ++L+    +P
Sbjct: 198 PAIRVLVRAIKGGRAPLSIYPSLLLNDAAAKP 229


>gi|326202932|ref|ZP_08192799.1| Methyltransferase type 11 [Clostridium papyrosolvens DSM 2782]
 gi|325987009|gb|EGD47838.1| Methyltransferase type 11 [Clostridium papyrosolvens DSM 2782]
          Length = 244

 Score = 73.2 bits (178), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 105/209 (50%), Gaps = 14/209 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++L+   +   +  + D+G G G   + +A +   A+I+  E    MA  A +++ L   
Sbjct: 34  VLLSDFADVKRNSKVLDIGTGTGIIPVLLAGKTKAAKIVGLEIQEEMAEMASRSVTL--- 90

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF-NERIGTMTPDKIKEEAHVM 119
            Q+S+R+ +++ D+ L  E         + +D V+ NPP+ N+  G + P   K  +   
Sbjct: 91  NQLSERLEIVQGDIKLYREY-----FGKSSFDVVVSNPPYTNKGCGLINPMDSKAISRHE 145

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE---ITPLHPREGEC 176
           +  S E  +  A A++   GQL+++ RP+ L  I+  C+ R   +E   +  +HP+ G+ 
Sbjct: 146 ILCSLEDVVSAAAALLVPGGQLAMVHRPERLADII--CSMRNNGIEPKYLRLVHPKPGKK 203

Query: 177 ASRILVTGRKGMRGQLRFRYPIVLHKPNG 205
            + +L+ G +G   +L+   P+ ++  +G
Sbjct: 204 PNMLLIKGNRGGNPELKVMEPLYVYNSDG 232


>gi|149913260|ref|ZP_01901794.1| methyltransferase small [Roseobacter sp. AzwK-3b]
 gi|149813666|gb|EDM73492.1| methyltransferase small [Roseobacter sp. AzwK-3b]
          Length = 256

 Score = 73.2 bits (178), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 61/204 (29%), Positives = 96/204 (47%), Gaps = 14/204 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+ V A     + DLG G G AGL +ASR+    +   E     A  AR+      N
Sbjct: 36  VLLAASVPARAGDTVLDLGCGVGVAGLCLASRVDGLALAGLELQCAYAALARQ------N 89

Query: 61  AQISK-RISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNER-IGTMTPDKIKEEAHV 118
           A ++   + ++  DV+ + E       +   + HV++NPP+ +R  G+   D  +E A  
Sbjct: 90  ASVNGITMEVVTGDVSDMPEQ-----FRQRQFTHVLVNPPYFDRNAGSAARDTGRETALG 144

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECAS 178
            +      W+R A       G ++ I R + L  ++   +  +GSLE+ PL PR G  A 
Sbjct: 145 EVT-PLATWVRAAARRAAPKGTVTFIHRTERLPALLGEISDHLGSLEVLPLIPRRGRPAR 203

Query: 179 RILVTGRKGMRGQLRFRYPIVLHK 202
             LV GRKG R   +     VLH+
Sbjct: 204 LSLVRGRKGGRADFKLHDGWVLHE 227


>gi|255264731|ref|ZP_05344073.1| methyltransferase small [Thalassiobium sp. R2A62]
 gi|255107066|gb|EET49740.1| methyltransferase small [Thalassiobium sp. R2A62]
          Length = 256

 Score = 72.8 bits (177), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 56/207 (27%), Positives = 91/207 (43%), Gaps = 12/207 (5%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+   A     + +LG GAGAA L +A R+    +   E  P  A  A       A 
Sbjct: 36  VLLAAATEAKSGDRVLELGCGAGAASLCLARRVEGLSLTGVELQPAYAALA-------AR 88

Query: 61  AQISKRISLIEVDVTLVGENRNLA-GLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVM 119
              +  +SL  ++  L    R L   L+   +DHVI NPP+ +R    +      +  + 
Sbjct: 89  NAKANDLSLTVINADL----RALPMDLRQQQFDHVIANPPYFDRATGSSATDTGRDIALG 144

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASR 179
            +     W+R A   +   G L++I +   L  I+      +GS+++ PL PR    +  
Sbjct: 145 GDTDLADWVRIAAKRLAPKGYLTMIQKSDRLADILAPLQGLLGSVQVVPLAPRGARDSHL 204

Query: 180 ILVTGRKGMRGQLRFRYPIVLHKPNGQ 206
           +LV  +K  RG+ R   P +LH   G 
Sbjct: 205 VLVRAKKNGRGKFRLHAPKILHVGGGH 231


>gi|148260435|ref|YP_001234562.1| O-methyltransferase-like protein [Acidiphilium cryptum JF-5]
 gi|146402116|gb|ABQ30643.1| O-methyltransferase-like protein [Acidiphilium cryptum JF-5]
          Length = 239

 Score = 72.8 bits (177), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 62/206 (30%), Positives = 93/206 (45%), Gaps = 13/206 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA++V A     + + G GAGA  L ++ R+ E + +  ER P +A  AR  L     
Sbjct: 29  VLLAAVVPARPGERVIEAGTGAGAGLLCLSYRVPELRGVGIERDPELAALARDNL----R 84

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
               +  ++I  D+T       L G     +DH   NPP+     T +PD  +  A+   
Sbjct: 85  TNGFEGTTIIAADIT----GPPLTG----PFDHAFANPPWRPVADTPSPDPGRRLAYEAP 136

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASR 179
            D    W  +   ++R  G LSLI    SL   + A  A   GSL I PL PR G  A  
Sbjct: 137 GDLLPAWTASLTRLLRPRGSLSLILPAASLDTALEAARAAGCGSLRILPLWPRAGRPAKL 196

Query: 180 ILVTGRKGMRGQLRFRYPIVLHKPNG 205
            ++   +G RG       +VLH+ +G
Sbjct: 197 FILRAIRGGRGPTVLLPGLVLHEASG 222


>gi|220927621|ref|YP_002504530.1| methyltransferase type 11 [Clostridium cellulolyticum H10]
 gi|219997949|gb|ACL74550.1| Methyltransferase type 11 [Clostridium cellulolyticum H10]
          Length = 260

 Score = 72.4 bits (176), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 50/209 (23%), Positives = 106/209 (50%), Gaps = 14/209 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++L+   +   +  + D+G G+G   + +A +   A+I+  E    MA  A +++ +   
Sbjct: 40  VLLSDFADVKRNSKVLDIGTGSGIIPVLLAGKTKAAKIVGIEIQEEMAEMASRSVLM--- 96

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF-NERIGTMTPDKIKEEAHVM 119
            ++S R+ +++ D+ L  E       + + +D V+ NPP+ N+  G + P   K  +   
Sbjct: 97  NRLSDRLEIVQGDIKLYREY-----FRKSSFDVVVSNPPYTNKGCGLVNPMDSKAISRHE 151

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE---ITPLHPREGEC 176
           +  S E  +  A A++   GQL+++ RP+ L  I+  C+ R   +E   +  +HP+ G+ 
Sbjct: 152 ILCSLEDVVSAAAALLVPGGQLAMVHRPERLADII--CSMRNNGIEPKHLRLVHPKPGKK 209

Query: 177 ASRILVTGRKGMRGQLRFRYPIVLHKPNG 205
            + +L+ G +G   +L+   P+ ++  NG
Sbjct: 210 PNLLLIKGNRGGNPELKVMEPLYVYNSNG 238


>gi|167647339|ref|YP_001685002.1| methyltransferase small [Caulobacter sp. K31]
 gi|167349769|gb|ABZ72504.1| methyltransferase small [Caulobacter sp. K31]
          Length = 245

 Score = 71.6 bits (174), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 58/206 (28%), Positives = 91/206 (44%), Gaps = 8/206 (3%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           + G G G A LA ASR   A+ +  ER P  A  AR  +AL     ++ R+ ++  D+  
Sbjct: 45  EAGCGVGGALLAAASRRKGARFVGLERDPAAADLARGNIALNG---LADRVEVVTGDI-- 99

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMR 136
               R    L    +D VI NPPF +  G +     ++    M +   E W       +R
Sbjct: 100 ---ERGFRALDLPVFDAVISNPPFFDDPGALRAPAPEKSGAWMADGGLEAWTAFCLKAVR 156

Query: 137 SSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRY 196
             G ++LI R   L  I+     + GS +I P+ P     A R++V   K  +  L    
Sbjct: 157 EGGTVTLIHRADRLAGILALLTPKAGSFKIRPIAPFADAPAKRVIVRAIKTGKAPLVLLP 216

Query: 197 PIVLHKPNGQPYSRFVTDLINGKRSL 222
           P+VLH+  G  +S     ++ G+ +L
Sbjct: 217 PLVLHEREGAGHSAAAEAILRGEAAL 242


>gi|298293860|ref|YP_003695799.1| methyltransferase type 11 [Starkeya novella DSM 506]
 gi|296930371|gb|ADH91180.1| Methyltransferase type 11 [Starkeya novella DSM 506]
          Length = 262

 Score = 71.6 bits (174), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 53/179 (29%), Positives = 85/179 (47%), Gaps = 2/179 (1%)

Query: 32  RLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFY 91
           R+ +A++ L E  P+ A  A +  A      IS RI+++  DV  +G             
Sbjct: 70  RIEKAEVTLVEIDPVAAALAARNAAR-QQPDISARIAVVTADVAALGRPSGPTLPAARAA 128

Query: 92  DHVIMNPPFNERIGTMT-PDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSL 150
           D V+MNPPFN+     T P   K  AH + +   + W+R A  ++   G+L+LI RP+++
Sbjct: 129 DLVLMNPPFNDPARHRTSPHAAKALAHSVADGDLDIWLRAAERLLAPGGRLALIHRPEAM 188

Query: 151 IQIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYS 209
             I+     R G++ I P++      A R+LV   KG R         VL   +G+P +
Sbjct: 189 EAILAGMKGRFGAVTIRPVYATPDAPAIRVLVGAVKGRRTPPALLPGFVLADRDGRPST 247


>gi|258542158|ref|YP_003187591.1| methyltransferase [Acetobacter pasteurianus IFO 3283-01]
 gi|256633236|dbj|BAH99211.1| methyltransferase [Acetobacter pasteurianus IFO 3283-01]
 gi|256636295|dbj|BAI02264.1| methyltransferase [Acetobacter pasteurianus IFO 3283-03]
 gi|256639348|dbj|BAI05310.1| methyltransferase [Acetobacter pasteurianus IFO 3283-07]
 gi|256642404|dbj|BAI08359.1| methyltransferase [Acetobacter pasteurianus IFO 3283-22]
 gi|256645459|dbj|BAI11407.1| methyltransferase [Acetobacter pasteurianus IFO 3283-26]
 gi|256648512|dbj|BAI14453.1| methyltransferase [Acetobacter pasteurianus IFO 3283-32]
 gi|256651565|dbj|BAI17499.1| methyltransferase [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256654556|dbj|BAI20483.1| methyltransferase [Acetobacter pasteurianus IFO 3283-12]
          Length = 251

 Score = 71.2 bits (173), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 60/218 (27%), Positives = 102/218 (46%), Gaps = 11/218 (5%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           +++A+ V A    H+ ++G GAGA  L +  R+        E+    A  A+K +A  AN
Sbjct: 33  VLMAAAVPARTGQHVLEIGCGAGAGLLCLLHRISTIHGTGVEKESDTAALAQKNMA--AN 90

Query: 61  AQISKRI-SLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVM 119
            Q + RI +    DV L    +        ++DH + NPP++  +GT +    ++ A  M
Sbjct: 91  QQQNIRILNATFPDVFLADTPQ-----PEQYFDHCMANPPWHAPLGTASAHPRRDLARRM 145

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARR-IGSLEITPLHPREGECAS 178
             D+   WI  A  I+R  G L+L        Q +   ++   G + + P  P+ G  + 
Sbjct: 146 GADTLPTWIEGAARILRHKGSLTLALPAALADQAIFCLSKAGFGGVTLYPFWPKAGRESR 205

Query: 179 RILVTGRKGMRGQLRFRYPIVLHKPNG--QPYSRFVTD 214
            +LV  RKG++   R    +VLH+ +G   P +R V +
Sbjct: 206 IVLVQARKGVKSPARVLAGLVLHEADGAFTPTARTVLE 243


>gi|326403629|ref|YP_004283711.1| hypothetical protein ACMV_14820 [Acidiphilium multivorum AIU301]
 gi|325050491|dbj|BAJ80829.1| hypothetical protein ACMV_14820 [Acidiphilium multivorum AIU301]
          Length = 239

 Score = 70.9 bits (172), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 62/206 (30%), Positives = 92/206 (44%), Gaps = 13/206 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA++V A     + + G GAGA  L ++ R+ E + +  ER P +A  AR  L     
Sbjct: 29  VLLAAVVPARPGERVIEAGTGAGAGLLCLSYRVPELRGVGIERDPELAALARDNL----R 84

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
               +  ++I  D+T       L G      DH   NPP+     T +PD  +  A+   
Sbjct: 85  TNGFEGTTIITADIT----GPPLTG----PVDHAFANPPWRPVADTPSPDPGRRLAYEAP 136

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASR 179
            D    W  +   ++R  G LSLI    SL   + A  A   GSL I PL PR G  A  
Sbjct: 137 GDLLPAWTASLTRLLRPRGSLSLILPAASLDTALEAARAAGCGSLRILPLWPRAGRPAKL 196

Query: 180 ILVTGRKGMRGQLRFRYPIVLHKPNG 205
            ++   +G RG       +VLH+ +G
Sbjct: 197 FILRAIRGGRGPTVLLPGLVLHEASG 222


>gi|83945356|ref|ZP_00957704.1| hypothetical protein OA2633_14256 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83851190|gb|EAP89047.1| hypothetical protein OA2633_14256 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 243

 Score = 70.9 bits (172), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 49/189 (25%), Positives = 82/189 (43%), Gaps = 11/189 (5%)

Query: 34  HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFYDH 93
            + ++   E  P  A  A+  +AL    ++  R+ + E D     + R L        D 
Sbjct: 62  EDVELTGVELDPRAAALAQDNVAL---NRMEGRVRVSEGDALAYRDEREL--------DA 110

Query: 94  VIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQI 153
           V  NPP+ +    +   K  +    M +     WI T    +RS G L++I R   L  I
Sbjct: 111 VFFNPPYFDDPSALRAPKAGKSPAWMSDAGLAAWIDTGLRRLRSGGVLTVIQRADRLDDI 170

Query: 154 VNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVT 213
           + A   R G++ + P+     E A R+LV   K  +G+L+ R P+VLH+  G  ++    
Sbjct: 171 LVALKGRAGAVNVLPVQAHADEPAKRVLVQATKTAKGRLQLRPPLVLHEAGGTGFTADAD 230

Query: 214 DLINGKRSL 222
            +  G+  L
Sbjct: 231 AIFRGEARL 239


>gi|310815062|ref|YP_003963026.1| N-6 Adenine-specific DNA methylase [Ketogulonicigenium vulgare Y25]
 gi|308753797|gb|ADO41726.1| N-6 Adenine-specific DNA methylase [Ketogulonicigenium vulgare Y25]
          Length = 255

 Score = 70.9 bits (172), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 60/201 (29%), Positives = 88/201 (43%), Gaps = 11/201 (5%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+   A     + +LG G G A L V  R+    +   E   + A YA    A  A 
Sbjct: 32  VLLAAACPAKAGESVLELGCGVGTALLCVGRRVEGLDLTGIE---VQADYAALARANAAT 88

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
             I    +++  D+T +      A L+   + HVIMNPP+ ER  + TP +       + 
Sbjct: 89  NGIDA--TIVTADLTAL-----PADLRQRQFHHVIMNPPYYER-ASSTPAQDSGRDRALA 140

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI 180
                 WI      +R  G L+LI R   L +++ A   +IGS+ + PL  R G      
Sbjct: 141 GAQMSDWIGMGARRLRPKGSLTLIQRITRLPEVLAAATGQIGSISVLPLAARAGRAPDLF 200

Query: 181 LVTGRKGMRGQLRFRYPIVLH 201
           L+ G KG R   R   P VLH
Sbjct: 201 LMRGIKGGRAAFRLLAPRVLH 221


>gi|254293447|ref|YP_003059470.1| methyltransferase small [Hirschia baltica ATCC 49814]
 gi|254041978|gb|ACT58773.1| methyltransferase small [Hirschia baltica ATCC 49814]
          Length = 244

 Score = 70.9 bits (172), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 93/189 (49%), Gaps = 10/189 (5%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+ + A     + + G GAGAA L+ A RL    +   ER   M   A++ +A  A 
Sbjct: 30  VLLAASLEAAPKQRILEAGCGAGAALLSCAHRLQGVHVAGLERDERMLALAQQNVAENA- 88

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
             +  R+ + + DV+    NR  + L  N YD V  NPPF          + KE A+ + 
Sbjct: 89  --LQDRVEVFQGDVS----NRPDSLL--NAYDQVFSNPPFFNPSTIQAVGEGKEGAY-LA 139

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI 180
           +   E W++     ++  G++++I R  +L +I++    R G + + P+    G  + RI
Sbjct: 140 DVPLESWLKFMLHAVKPKGRITIIHRAAALSEILSFLQPRFGEICVLPVRSHAGAPSKRI 199

Query: 181 LVTGRKGMR 189
           LV  RKG+R
Sbjct: 200 LVRARKGLR 208


>gi|163738899|ref|ZP_02146312.1| methyltransferase small [Phaeobacter gallaeciensis BS107]
 gi|161387704|gb|EDQ12060.1| methyltransferase small [Phaeobacter gallaeciensis BS107]
          Length = 255

 Score = 70.5 bits (171), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 46/146 (31%), Positives = 72/146 (49%), Gaps = 5/146 (3%)

Query: 61  AQISKR-ISLIEVDVTLVGENRNL--AGLKNNFYDHVIMNPPFNERIGTMTP-DKIKEEA 116
           A +++R  +L  VD+T+V  +     A L+   +D VI NPP+  R G  +P   +  + 
Sbjct: 82  ADLARRNAALNSVDMTVVEADLAALPADLRQQQFDQVIANPPYY-RAGAHSPAQDVGRQI 140

Query: 117 HVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGEC 176
            +        W  TA   +   G L +I R   L +++ AC  R+GSLE+ PL  R G  
Sbjct: 141 ALGGATELSVWFDTAARRLSHKGYLHMIQRADRLPEMLEACLGRLGSLEVLPLAARVGRR 200

Query: 177 ASRILVTGRKGMRGQLRFRYPIVLHK 202
           A  +L+  RKG R   +   P++LH 
Sbjct: 201 AELVLLRARKGGRAGFKLHAPMILHD 226


>gi|114771289|ref|ZP_01448709.1| N-6 Adenine-specific DNA methylase [alpha proteobacterium HTCC2255]
 gi|114548214|gb|EAU51101.1| N-6 Adenine-specific DNA methylase [alpha proteobacterium HTCC2255]
          Length = 247

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 58/225 (25%), Positives = 102/225 (45%), Gaps = 23/225 (10%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           + LA+ ++A     + D+G+G G A L + +R+    +   E   L   Y   T    AN
Sbjct: 29  VFLAASISAENGQSILDIGSGVGVASLCLGARIQGLSLHGIE---LQQEY---TFMAEAN 82

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNF----YDHVIMNPPFNERIGTMTPDKIKEEA 116
           A        IE ++     N +L  L + F    +DHV+ NPPF        P ++++  
Sbjct: 83  A--------IENNINFKVLNADLNNLPSTFRQKSFDHVMTNPPFFIPSTLSKPLRLEKST 134

Query: 117 HVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGEC 176
             +       WI  +   ++S G  S+I   + L +I+++ +   GS+ + P+  R+   
Sbjct: 135 ANIETIPLADWISISLKRLKSGGSFSIIHLTERLPEILSSLSISCGSISVLPIVARKSRP 194

Query: 177 ASRILVTGRKGMRGQLRFRYPIVLHKP---NGQ--PYSRFVTDLI 216
           A RI+V   KG +G L+   P ++H     NG    YS+   D++
Sbjct: 195 AKRIIVQCIKGSKGPLKLLDPFIVHDGDMHNGDKSDYSKKANDIL 239


>gi|329113330|ref|ZP_08242111.1| tRNA (adenine-N(6)-)-methyltransferase [Acetobacter pomorum DM001]
 gi|326697155|gb|EGE48815.1| tRNA (adenine-N(6)-)-methyltransferase [Acetobacter pomorum DM001]
          Length = 251

 Score = 69.3 bits (168), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 58/217 (26%), Positives = 99/217 (45%), Gaps = 9/217 (4%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           +++A+ V A    H+ ++G GAGA  L +  R    Q    E+    A  A++ +   AN
Sbjct: 33  VLMAAAVPARKGQHVLEIGCGAGAGLLCLLHRAPTLQGTGVEKESDTATLAQQNMV--AN 90

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
            Q + RI         + +N     L   ++DH + NPP++  +GT +    ++ A  M 
Sbjct: 91  HQQNIRILNATFPDVFLEDNP----LPEQYFDHCMANPPWHAPLGTASAHPRRDLARRMG 146

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARR-IGSLEITPLHPREGECASR 179
            D+   WI  A  I+R  G L+L        Q +    +   G + + P  P+ G  +  
Sbjct: 147 ADTLPTWIAGAARILRHKGSLTLALPAALADQAIFCLNKSGFGGVTLYPFWPKAGRESRI 206

Query: 180 ILVTGRKGMRGQLRFRYPIVLHKPNG--QPYSRFVTD 214
           +LV  RKG++   R    +VLH+ +G   P +R V +
Sbjct: 207 VLVQARKGVKSPARVLAGLVLHEADGAFTPSARTVLE 243


>gi|323340835|ref|ZP_08081087.1| methyltransferase [Lactobacillus ruminis ATCC 25644]
 gi|323091958|gb|EFZ34578.1| methyltransferase [Lactobacillus ruminis ATCC 25644]
          Length = 248

 Score = 69.3 bits (168), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 56/212 (26%), Positives = 103/212 (48%), Gaps = 22/212 (10%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL AG GA GL +  +   AQI   E  P +A  A++++ L     + +R+++I  D+
Sbjct: 51  IVDLCAGNGAVGLFLTPK-SSAQIYEVEIQPRLADMAKRSIDLNG---LEERVTVINDDL 106

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVM------LEDSFEKWI 128
                N     L  +  D V  NPP+ E      PD  K     +      L  + E+ I
Sbjct: 107 -----NNVFDYLAKDSIDTVTCNPPYFED----QPDSKKNPNQYLALARHELAVTLEQTI 157

Query: 129 RTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTG-RK 186
             A  +++ +G++S + RP+ LI+++    + R+    +  ++P+    A+ +LV   + 
Sbjct: 158 EQASGLLKMNGRVSYVHRPERLIEMIELMKKHRLEPKRVQFVYPKRNREANMVLVEAIKD 217

Query: 187 GMRGQLRFRYPIVLHKPNGQPYSRFVTDLING 218
           G  G LRF  P+ +++ NG+ Y+  V  ++ G
Sbjct: 218 GKPGGLRFMPPLFVYEENGE-YTEEVRKIVYG 248


>gi|163741855|ref|ZP_02149245.1| hypothetical protein RG210_04780 [Phaeobacter gallaeciensis 2.10]
 gi|161385028|gb|EDQ09407.1| hypothetical protein RG210_04780 [Phaeobacter gallaeciensis 2.10]
          Length = 255

 Score = 69.3 bits (168), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 46/146 (31%), Positives = 72/146 (49%), Gaps = 5/146 (3%)

Query: 61  AQISKR-ISLIEVDVTLVGENRNL--AGLKNNFYDHVIMNPPFNERIGTMTP-DKIKEEA 116
           A +++R  +L  VD+T+V  +     A L+   +D VI NPP+  R G  +P   +  + 
Sbjct: 82  ADLARRNAALNSVDMTVVEADLAALPADLRQQQFDQVIANPPYY-RAGAHSPAQDVGRQI 140

Query: 117 HVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGEC 176
            +        W  TA   +   G L +I R   L +++ AC  R+GSLE+ PL  R G  
Sbjct: 141 ALGGATELSVWFDTAARRLCHKGYLHMIQRADRLPEMLEACLGRLGSLEVLPLAARVGRR 200

Query: 177 ASRILVTGRKGMRGQLRFRYPIVLHK 202
           A  +L+  RKG R   +   P++LH 
Sbjct: 201 AELVLLRARKGGRAGFKLHAPMILHD 226


>gi|227552620|ref|ZP_03982669.1| methyltransferase [Enterococcus faecium TX1330]
 gi|257888152|ref|ZP_05667805.1| conserved hypothetical protein [Enterococcus faecium 1,141,733]
 gi|257896957|ref|ZP_05676610.1| conserved hypothetical protein [Enterococcus faecium Com12]
 gi|293379099|ref|ZP_06625250.1| methyltransferase small domain protein [Enterococcus faecium PC4.1]
 gi|227178246|gb|EEI59218.1| methyltransferase [Enterococcus faecium TX1330]
 gi|257824206|gb|EEV51138.1| conserved hypothetical protein [Enterococcus faecium 1,141,733]
 gi|257833522|gb|EEV59943.1| conserved hypothetical protein [Enterococcus faecium Com12]
 gi|292642240|gb|EFF60399.1| methyltransferase small domain protein [Enterococcus faecium PC4.1]
          Length = 244

 Score = 69.3 bits (168), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 53/223 (23%), Positives = 117/223 (52%), Gaps = 14/223 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA          + DL AG GA GL ++ R  +A I   E  P +A  AR+++AL   
Sbjct: 32  VLLAHFSRVPKKGQIVDLCAGNGAVGLFLSKRT-QAAIDAIELQPRLADMARRSIAL--- 87

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGT--MTPDKIKEEAHV 118
             + +++++  +D+       +L+ +++N  D V+ NPP+ + + T    P+K    A  
Sbjct: 88  NHLDEQMTVHTIDL-----KDSLSVIRHNSCDLVVCNPPYFKGLPTNKTNPNKHLAIARH 142

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACA-RRIGSLEITPLHPREGECA 177
            +  + E+ I  +  +++++G+ +++ RP+  ++I+      RI    I  ++P+ G+ A
Sbjct: 143 EIHTTLEEVIDNSSKLLKTNGRFAMVHRPERFLEIIQIMQNHRIAPKRIQFVYPKAGKEA 202

Query: 178 SRILVTG-RKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
           + +LV G ++G     +   P++ +  +G+ Y+  + +++ GK
Sbjct: 203 NILLVEGIKEGKLDGFKVAPPLITYDADGE-YTAEIREMLYGK 244


>gi|257899583|ref|ZP_05679236.1| conserved hypothetical protein [Enterococcus faecium Com15]
 gi|257837495|gb|EEV62569.1| conserved hypothetical protein [Enterococcus faecium Com15]
          Length = 244

 Score = 68.6 bits (166), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 53/223 (23%), Positives = 116/223 (52%), Gaps = 14/223 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA          + DL AG GA GL ++ R  +A I   E  P +A  AR+++AL   
Sbjct: 32  VLLAHFSRVPKKGQIVDLCAGNGAVGLFLSKRT-QAAIDAIELQPRLADMARRSIAL--- 87

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGT--MTPDKIKEEAHV 118
             + +++++  +D+       +L+ +++N  D V+ NPP+ + + T    P+K    A  
Sbjct: 88  NHLDEQMTVHTIDL-----KDSLSVVRHNSCDLVVCNPPYFKGLPTNKTNPNKHLAIARH 142

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACA-RRIGSLEITPLHPREGECA 177
            +  + E+ I  +  +++++G+ +++ RP+  ++I+      RI    I  ++P+ G+ A
Sbjct: 143 EIHTTLEEVIDNSSKLLKTNGRFAMVHRPERFLEIIQIMQNHRIAPKRIQFVYPKAGKEA 202

Query: 178 SRILVTG-RKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
           + +LV G + G     +   P++ +  +G+ Y+  + +++ GK
Sbjct: 203 NILLVEGIKDGKLDGFKVAPPLITYDADGE-YTAEIHEMLYGK 244


>gi|293571579|ref|ZP_06682601.1| methyltransferase [Enterococcus faecium E980]
 gi|291608385|gb|EFF37685.1| methyltransferase [Enterococcus faecium E980]
          Length = 244

 Score = 68.6 bits (166), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 53/223 (23%), Positives = 116/223 (52%), Gaps = 14/223 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA          + DL AG GA GL ++ R  +A I   E  P +A  AR+++AL   
Sbjct: 32  VLLAHFSRVPKKGQIVDLCAGNGAVGLFLSKRT-QAAIDAIELQPRLADMARRSIAL--- 87

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGT--MTPDKIKEEAHV 118
             + +++++  +D+       +L+ +++N  D V+ NPP+ + + T    P+K    A  
Sbjct: 88  NHLDEQMTVHTIDL-----KDSLSVVRHNSCDLVVCNPPYFKGLPTNKTNPNKHLAIARH 142

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACA-RRIGSLEITPLHPREGECA 177
            +  + E+ I  +  +++++G+ +++ RP+  ++I+      RI    I  ++P+ G+ A
Sbjct: 143 EIHTTLEEVIDNSSKLLKTNGRFAMVHRPERFLEIIQIMQNHRIAPKRIQFVYPKAGKEA 202

Query: 178 SRILVTG-RKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
           + +LV G + G     +   P++ +  +G+ Y+  + +++ GK
Sbjct: 203 NILLVEGIKDGKLDGFKVAPPLITYDADGE-YTAEIREMLYGK 244


>gi|330994652|ref|ZP_08318575.1| putative methyltransferase [Gluconacetobacter sp. SXCC-1]
 gi|329758293|gb|EGG74814.1| putative methyltransferase [Gluconacetobacter sp. SXCC-1]
          Length = 205

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 58/201 (28%), Positives = 92/201 (45%), Gaps = 11/201 (5%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           + G GAGA  L +A+R+     +  E  P     A        N QI+ R  L     TL
Sbjct: 2   EAGCGAGAGLLCLANRVPHLTGIGLEHDPATGRLAAH------NFQINARDGLRARAATL 55

Query: 77  --VGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAI 134
             + ++  L+G      DH   NPP++    T +P + ++ AH + + +  +W R   A 
Sbjct: 56  PALPDDPLLSGPGTRRIDHAFANPPWHGHDSTPSPHRQRDLAHRLPDGALREWTRVLAAQ 115

Query: 135 MRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTGRKGMRGQLR 193
           +R  G L+L      L   ++A  A R+G + I P  PR G+ A  +LV GR   R    
Sbjct: 116 LRHHGTLTLALPAALLATGISAMEAARLGGIRIFPFWPRTGQAARIVLVQGRANTRAGSE 175

Query: 194 FRYPIVLHKPNGQ--PYSRFV 212
               ++LH+ +G+  P +R V
Sbjct: 176 MLPGLILHETDGRFTPAARAV 196


>gi|69247674|ref|ZP_00604450.1| conserved hypothetical protein [Enterococcus faecium DO]
 gi|257880305|ref|ZP_05659958.1| conserved hypothetical protein [Enterococcus faecium 1,230,933]
 gi|257882160|ref|ZP_05661813.1| conserved hypothetical protein [Enterococcus faecium 1,231,502]
 gi|257890964|ref|ZP_05670617.1| conserved hypothetical protein [Enterococcus faecium 1,231,410]
 gi|257894219|ref|ZP_05673872.1| conserved hypothetical protein [Enterococcus faecium 1,231,408]
 gi|258614747|ref|ZP_05712517.1| hypothetical protein EfaeD_03462 [Enterococcus faecium DO]
 gi|260562391|ref|ZP_05832905.1| conserved hypothetical protein [Enterococcus faecium C68]
 gi|293559941|ref|ZP_06676451.1| methyltransferase [Enterococcus faecium E1162]
 gi|293568354|ref|ZP_06679677.1| methyltransferase [Enterococcus faecium E1071]
 gi|294621014|ref|ZP_06700210.1| methyltransferase [Enterococcus faecium U0317]
 gi|314937681|ref|ZP_07845006.1| methyltransferase small domain protein [Enterococcus faecium
           TX0133a04]
 gi|314940923|ref|ZP_07847829.1| methyltransferase small domain protein [Enterococcus faecium
           TX0133C]
 gi|314948056|ref|ZP_07851458.1| methyltransferase small domain protein [Enterococcus faecium
           TX0082]
 gi|314952335|ref|ZP_07855345.1| methyltransferase small domain protein [Enterococcus faecium
           TX0133A]
 gi|314991941|ref|ZP_07857396.1| methyltransferase small domain protein [Enterococcus faecium
           TX0133B]
 gi|314995199|ref|ZP_07860313.1| methyltransferase small domain protein [Enterococcus faecium
           TX0133a01]
 gi|68194746|gb|EAN09226.1| conserved hypothetical protein [Enterococcus faecium DO]
 gi|257814533|gb|EEV43291.1| conserved hypothetical protein [Enterococcus faecium 1,230,933]
 gi|257817818|gb|EEV45146.1| conserved hypothetical protein [Enterococcus faecium 1,231,502]
 gi|257827324|gb|EEV53950.1| conserved hypothetical protein [Enterococcus faecium 1,231,410]
 gi|257830598|gb|EEV57205.1| conserved hypothetical protein [Enterococcus faecium 1,231,408]
 gi|260073315|gb|EEW61656.1| conserved hypothetical protein [Enterococcus faecium C68]
 gi|291588963|gb|EFF20788.1| methyltransferase [Enterococcus faecium E1071]
 gi|291599414|gb|EFF30435.1| methyltransferase [Enterococcus faecium U0317]
 gi|291606106|gb|EFF35530.1| methyltransferase [Enterococcus faecium E1162]
 gi|313590608|gb|EFR69453.1| methyltransferase small domain protein [Enterococcus faecium
           TX0133a01]
 gi|313593525|gb|EFR72370.1| methyltransferase small domain protein [Enterococcus faecium
           TX0133B]
 gi|313595550|gb|EFR74395.1| methyltransferase small domain protein [Enterococcus faecium
           TX0133A]
 gi|313600281|gb|EFR79124.1| methyltransferase small domain protein [Enterococcus faecium
           TX0133C]
 gi|313642954|gb|EFS07534.1| methyltransferase small domain protein [Enterococcus faecium
           TX0133a04]
 gi|313645472|gb|EFS10052.1| methyltransferase small domain protein [Enterococcus faecium
           TX0082]
          Length = 244

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 53/223 (23%), Positives = 117/223 (52%), Gaps = 14/223 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA          + DL AG GA GL ++ R  +A I   E  P +A  AR+++AL   
Sbjct: 32  VLLAHFSRVPKKGKIVDLCAGNGAVGLFLSKRT-QAAIDAIELQPRLADMARRSIAL--- 87

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGT--MTPDKIKEEAHV 118
             +++++++  +D+       +L+ +++N  D V+ NPP+ + + T    P+K    A  
Sbjct: 88  NHLNEQMTVHTIDL-----KDSLSVVRHNSCDLVVCNPPYFKGLPTNKTNPNKHLAIARH 142

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECA 177
            +  + E+ I  +  +++++G+ +++ RP   ++I+      RI    I  ++P+ G+ A
Sbjct: 143 EIHTTLEEVIDISSKLLKTNGRFTMVHRPDRFLEIIQVMEDYRIAPKRIQFVYPKPGKEA 202

Query: 178 SRILVTG-RKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
           + +LV G ++G     +   P++ +  +G+ Y+  + +++ GK
Sbjct: 203 NILLVEGIKEGKLDGFKVAPPLITYNMDGE-YTAEIREMLYGK 244


>gi|294619483|ref|ZP_06698926.1| methyltransferase [Enterococcus faecium E1679]
 gi|291594279|gb|EFF25710.1| methyltransferase [Enterococcus faecium E1679]
          Length = 244

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 53/223 (23%), Positives = 117/223 (52%), Gaps = 14/223 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA          + DL AG GA GL ++ R  +A I   E  P +A  AR+++AL   
Sbjct: 32  VLLAHFSRVPKKGKIVDLCAGNGAVGLFLSKRT-QAAIDAIELQPRLADMARRSIAL--- 87

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGT--MTPDKIKEEAHV 118
             +++++++  +D+       +L+ +++N  D V+ NPP+ + + T    P+K    A  
Sbjct: 88  NHLNEQMTVHTIDL-----KDSLSVVRHNSCDLVVCNPPYFKGLPTNKTNPNKHLAIARH 142

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECA 177
            +  + E+ I  +  +++++G+ +++ RP   ++I+      RI    I  ++P+ G+ A
Sbjct: 143 EIHTTLEEVIDISSKLLKTNGRFTMVHRPDRFLEIIQVMEDYRIAPKRIQFVYPKPGKEA 202

Query: 178 SRILVTG-RKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
           + +LV G ++G     +   P++ +  +G+ Y+  + +++ GK
Sbjct: 203 NILLVEGIKEGKLDGFKVAPPLITYNMDGE-YTVEIREMLYGK 244


>gi|257885352|ref|ZP_05665005.1| conserved hypothetical protein [Enterococcus faecium 1,231,501]
 gi|261209234|ref|ZP_05923626.1| conserved hypothetical protein [Enterococcus faecium TC 6]
 gi|289565983|ref|ZP_06446421.1| conserved hypothetical protein [Enterococcus faecium D344SRF]
 gi|293553052|ref|ZP_06673694.1| DNA methyltransferase signature protein [Enterococcus faecium
           E1039]
 gi|294616213|ref|ZP_06696010.1| methyltransferase [Enterococcus faecium E1636]
 gi|257821208|gb|EEV48338.1| conserved hypothetical protein [Enterococcus faecium 1,231,501]
 gi|260076780|gb|EEW64515.1| conserved hypothetical protein [Enterococcus faecium TC 6]
 gi|289162181|gb|EFD10043.1| conserved hypothetical protein [Enterococcus faecium D344SRF]
 gi|291590968|gb|EFF22680.1| methyltransferase [Enterococcus faecium E1636]
 gi|291602761|gb|EFF32971.1| DNA methyltransferase signature protein [Enterococcus faecium
           E1039]
          Length = 244

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 53/223 (23%), Positives = 117/223 (52%), Gaps = 14/223 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA          + DL AG GA GL ++ R  +A I   E  P +A  AR+++AL   
Sbjct: 32  VLLAHFSRVPKKGKIVDLCAGNGAVGLFLSKRT-QAAIDAIELQPRLADMARRSIAL--- 87

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGT--MTPDKIKEEAHV 118
             +++++++  +D+       +L+ +++N  D V+ NPP+ + + T    P+K    A  
Sbjct: 88  NHLNEQMTVHTIDL-----KDSLSVVRHNSCDLVVCNPPYFKGLPTNKTNPNKHLAIARH 142

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECA 177
            +  + E+ I  +  +++++G+ +++ RP   ++I+      RI    I  ++P+ G+ A
Sbjct: 143 EIHTTLEEVIDISSKLLKTNGRFTMVHRPDRFLEIIQVMQDYRIAPKRIQFVYPKPGKEA 202

Query: 178 SRILVTG-RKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
           + +LV G ++G     +   P++ +  +G+ Y+  + +++ GK
Sbjct: 203 NILLVEGIKEGKLDGFKVAPPLITYNMDGE-YTVEIREMLYGK 244


>gi|324990614|gb|EGC22550.1| methyltransferase [Streptococcus sanguinis SK353]
 gi|324995336|gb|EGC27248.1| methyltransferase [Streptococcus sanguinis SK678]
 gi|325688273|gb|EGD30292.1| methyltransferase [Streptococcus sanguinis SK72]
 gi|327461626|gb|EGF07957.1| methyltransferase [Streptococcus sanguinis SK1]
 gi|327489483|gb|EGF21276.1| methyltransferase [Streptococcus sanguinis SK1058]
 gi|328945527|gb|EGG39678.1| methyltransferase [Streptococcus sanguinis SK1087]
          Length = 248

 Score = 65.9 bits (159), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 53/212 (25%), Positives = 108/212 (50%), Gaps = 20/212 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL AG GA GL  ++R  +AQIL  E    +A  A +++ L     +++++ +I+ D+
Sbjct: 50  IVDLCAGNGAVGLFASTRT-KAQILAVEIQERLADMAERSIEL---NDLTQQMQVIQDDL 105

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-----EDSFEKWIR 129
             +G  R + G K    D ++ NPP+           + E  H +L       + E+  +
Sbjct: 106 KNLG--RYITGSK---VDMILCNPPY---FKVDKKSNLNESQHYLLARHEISTNLEEICK 157

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTG-RKG 187
            A  +++S+G+L+++ RP+  + I++   A  +    I  ++P+ G+ A+ +L+   + G
Sbjct: 158 IAQRVLKSNGRLAMVHRPERFLDILDTMQAHNLAPKRIQFVYPKLGKEANMLLIEAIKDG 217

Query: 188 MRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
            R  L+   P+ +H  +G  Y+  + ++  GK
Sbjct: 218 SRDGLKILPPLFIHNQDGS-YTPEIHEIYYGK 248


>gi|327468975|gb|EGF14447.1| methyltransferase [Streptococcus sanguinis SK330]
          Length = 248

 Score = 65.9 bits (159), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 53/212 (25%), Positives = 108/212 (50%), Gaps = 20/212 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL AG GA GL  ++R  +AQIL  E    +A  A +++ L     +++++ +I+ D+
Sbjct: 50  IVDLCAGNGAVGLFASTRT-KAQILAVEIQERLADMAERSIEL---NDLTQQMQVIQDDL 105

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-----EDSFEKWIR 129
             +G  R + G K    D ++ NPP+           + E  H +L       + E+  +
Sbjct: 106 KNLG--RYITGSK---VDMILCNPPY---FKVDKQSNLNESQHYLLARHEISTNLEEICK 157

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTG-RKG 187
            A  +++S+G+L+++ RP+  + I++   A  +    I  ++P+ G+ A+ +L+   + G
Sbjct: 158 IAQRVLKSNGRLAMVHRPERFLDILDTMQAHNLAPKRIQFVYPKLGKEANMLLIEAIKDG 217

Query: 188 MRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
            R  L+   P+ +H  +G  Y+  + ++  GK
Sbjct: 218 SRDGLKILPPLFIHNQDGS-YTPEIHEIYYGK 248


>gi|323352686|ref|ZP_08087656.1| methyltransferase [Streptococcus sanguinis VMC66]
 gi|322121722|gb|EFX93468.1| methyltransferase [Streptococcus sanguinis VMC66]
          Length = 248

 Score = 65.5 bits (158), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 52/212 (24%), Positives = 109/212 (51%), Gaps = 20/212 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL AG GA GL  ++R  +AQIL  E    +A  A +++ L     +++++ +I+ D+
Sbjct: 50  IVDLCAGNGAVGLFASTRT-KAQILAVEIQERLADMAERSIEL---NDLTQQMQIIQDDL 105

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-----EDSFEKWIR 129
             +G+   + G K    D ++ NPP+           + E  H +L       + E+  +
Sbjct: 106 KNLGQY--ITGSK---VDMILCNPPY---FKVDKQSNLNESQHYLLARHEISTNLEEICK 157

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTG-RKG 187
            A  +++S+G+L+++ RP+  + I++   A ++    I  ++P+ G+ A+ +L+   + G
Sbjct: 158 IAQRVLKSNGRLAMVHRPERFLDILDTMQAHKLAPKRIQFVYPKLGKEANMLLIEAIKDG 217

Query: 188 MRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
            R  L+   P+ +H  +G  Y+  + ++  GK
Sbjct: 218 SRDGLKILPPLFIHNQDGS-YTPEIHEIYYGK 248


>gi|187934189|ref|YP_001887561.1| SAM-dependent methyltransferase [Clostridium botulinum B str.
           Eklund 17B]
 gi|187722342|gb|ACD23563.1| SAM-dependent methyltransferase [Clostridium botulinum B str.
           Eklund 17B]
          Length = 250

 Score = 64.7 bits (156), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 48/209 (22%), Positives = 101/209 (48%), Gaps = 14/209 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           +IL+   N    + + DL  G G     +  + +  ++   E    M + A K++ L A 
Sbjct: 39  VILSDFANVKNKYRVIDLCTGTGIIPFLLYGKYNPKEVYGLEIQEEMVNMAEKSVKLNA- 97

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKN-NFYDHVIMNPPFN-ERIGTMTP-DKIKEEAH 117
             +  +I+ I+ D+      +N+  LK  + +D V +NPP+     G + P DK+    H
Sbjct: 98  --LEDKITFIKEDL------KNIEYLKKMDKFDVVTVNPPYKLNNAGIINPSDKLAIARH 149

Query: 118 VMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGEC 176
            +L  + E  I  +  +++ +G++ ++ RP+ L  I     + +I    +  ++P+ G+ 
Sbjct: 150 EVLC-NLEDVIYASKVLLKDNGRMFIVHRPERLADIFTLMRKYKIEPKRVKMVYPKPGKA 208

Query: 177 ASRILVTGRKGMRGQLRFRYPIVLHKPNG 205
           A+ +LV G++     L++  P+ +H  +G
Sbjct: 209 ANIVLVEGQRDGGSYLKWDIPLYVHNEDG 237


>gi|327458711|gb|EGF05059.1| methyltransferase [Streptococcus sanguinis SK1057]
          Length = 248

 Score = 64.7 bits (156), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 53/212 (25%), Positives = 108/212 (50%), Gaps = 20/212 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL AG GA GL  ++R  +A+IL  E    +A  A +++ L     +++++ +I+ D+
Sbjct: 50  IVDLCAGNGAVGLFASTRT-KAKILAVEIQERLADMAERSIEL---NDLTQQMQVIQDDL 105

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-----EDSFEKWIR 129
             +G  R + G K    D ++ NPP+           + E  H +L       + E+  +
Sbjct: 106 KNLG--RYITGSK---VDMILCNPPY---FKVDKKSNLNESQHYLLARHEISTNLEEICK 157

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTG-RKG 187
            A  I++S+G+L+++ RP+  + I++   A  +    I  ++P+ G+ A+ +L+   + G
Sbjct: 158 IAQRILKSNGRLAMVHRPERFLDILDTMQAHNLAPKRIQFVYPKLGKEANMLLIEAIKDG 217

Query: 188 MRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
            R  L+   P+ +H  +G  Y+  + ++  GK
Sbjct: 218 SRDGLKILPPLFIHNQDGS-YTPEIHEIYYGK 248


>gi|58040423|ref|YP_192387.1| hypothetical protein GOX1995 [Gluconobacter oxydans 621H]
 gi|58002837|gb|AAW61731.1| Hypothetical protein GOX1995 [Gluconobacter oxydans 621H]
          Length = 280

 Score = 64.7 bits (156), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 52/214 (24%), Positives = 95/214 (44%), Gaps = 14/214 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           +++A+ + A     + + G GAGAA L +++R+     +  E  P     A   +   + 
Sbjct: 55  VLMAASIPARAGETVLEAGCGAGAALLCLSARIPGVHGVGLEADPETIKLAEWNIWNNSG 114

Query: 61  AQISKRISLIEVDVTLVGEN-RNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVM 119
                ++ +++  +  +    R      N  + HV+ NPP++   GT +PD  +  A   
Sbjct: 115 PTGLPKLQILQAQLPDIPRTLRAFTPTANGRFHHVMANPPWHSPHGTPSPDTRRRLALSA 174

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARP-------QSLIQIVNACARRIGSLEITPLHPR 172
              + E+WI      +   G L+ +          Q+L++  N C    GS++  P  PR
Sbjct: 175 ETTAPEEWIGALTKWVLPGGTLTFVLSTAVADRACQTLLE--NGC----GSIQFYPFWPR 228

Query: 173 EGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQ 206
           +G  A  +LV    G RG  R R  +VLH+ +G+
Sbjct: 229 QGRGAKLVLVRAVHGGRGIFRLRAGLVLHEADGR 262


>gi|332362756|gb|EGJ40552.1| methyltransferase [Streptococcus sanguinis SK49]
          Length = 248

 Score = 64.7 bits (156), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 52/212 (24%), Positives = 108/212 (50%), Gaps = 20/212 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL AG GA GL  ++R  +A+IL  E    +A  A +++ L     +++++ +I+ D+
Sbjct: 50  IVDLCAGNGAVGLFASTRT-KAKILAVEIQERLADMAERSIEL---NDLTQQMQVIQDDL 105

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-----EDSFEKWIR 129
             +G  R + G K    D ++ NPP+           + E  H +L       + E+  +
Sbjct: 106 KNLG--RYITGSK---VDMILCNPPY---FKVDKQSNLNESQHYLLARHEISTNLEEICK 157

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTG-RKG 187
            A  +++S+G+L+++ RP+  + I++   A  +    I  ++P+ G+ A+ +L+   + G
Sbjct: 158 IAQRVLKSNGRLAMVHRPERFLDILDTMQAHNLAPKRIQFVYPKLGKEANMLLIEAIKDG 217

Query: 188 MRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
            R  L+   P+ +H  +G  Y+  + ++  GK
Sbjct: 218 SRDGLKILPPLFIHNQDG-SYTSEIHEIYYGK 248


>gi|126733998|ref|ZP_01749745.1| methyltransferase small [Roseobacter sp. CCS2]
 gi|126716864|gb|EBA13728.1| methyltransferase small [Roseobacter sp. CCS2]
          Length = 251

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 93/203 (45%), Gaps = 14/203 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           +ILA+ V A     + +LG G G A L +A+R+    +   E   + +     TLA    
Sbjct: 31  VILAASVPAKSGQTVLELGCGVGVASLCLAARVPGLHVTGVEVQDVYS-----TLAQRNG 85

Query: 61  AQISKRISLIEVDVTLVGENRNL-AGLKNNFYDHVIMNPPFNER-IGTMTPDKIKEEAHV 118
                   +I  D+      R+L AGL+   +DHVIMNPP+ +R  GTM+ D  K+ A  
Sbjct: 86  VANDLPFEVITADL------RSLPAGLRQKRFDHVIMNPPYFDRGAGTMSDDAGKDIAFG 139

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECAS 178
             +     W+      +   G L++I R + L +++ A   R+GS  + P+  R G    
Sbjct: 140 G-DTPLGDWLEVGARRVGPRGYLTVIQRIERLPEVLAALQGRLGSFIVRPIAGRIGRAPE 198

Query: 179 RILVTGRKGMRGQLRFRYPIVLH 201
             L+  R+  +   R    +++H
Sbjct: 199 LFLLQARQEGKTPFRMAPTLIMH 221


>gi|258645194|ref|ZP_05732663.1| SAM-dependent methyltransferase [Dialister invisus DSM 15470]
 gi|260402543|gb|EEW96090.1| SAM-dependent methyltransferase [Dialister invisus DSM 15470]
          Length = 249

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 61/215 (28%), Positives = 109/215 (50%), Gaps = 25/215 (11%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           +ADLG G G   L +++ L    I   E +P+MA  AR+ +    N + S  I ++E D 
Sbjct: 50  IADLGTGTGVIALLLSA-LGGEDITAFEINPVMADLARRNVN--GNNK-SDCIKVVEYDC 105

Query: 75  TLVGENRNLAGLK-NNFYDHVIMNPPFNERIGTMTPDKIK------EEAHVMLEDSFEKW 127
                 RN+  +     ++ V++NPP+ E IGT   +  +       E +V LED F   
Sbjct: 106 ------RNVKKIYPTGSFNSVVVNPPYRE-IGTGRMNHCEGVASASYELNVTLEDIFH-- 156

Query: 128 IRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRK 186
             TA  +++  G+L++I R   L+ ++    R ++ +  I P++ R G  A R+L+  R 
Sbjct: 157 --TAQYLLKYGGRLTMIHRADRLVDLITLGRRYKMEAKRIRPVYARIGASAVRVLLEFRY 214

Query: 187 GMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRS 221
           G   +L    P+++H  +G  Y++ + + I GK++
Sbjct: 215 GGHTELILEPPLLIHNTDGS-YTQEIME-IYGKKT 247


>gi|210623265|ref|ZP_03293682.1| hypothetical protein CLOHIR_01632 [Clostridium hiranonis DSM 13275]
 gi|210153666|gb|EEA84672.1| hypothetical protein CLOHIR_01632 [Clostridium hiranonis DSM 13275]
          Length = 251

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/216 (23%), Positives = 98/216 (45%), Gaps = 10/216 (4%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+         +ADLG G G   L +  + +  +I   E    +   A +T+ +   
Sbjct: 35  VLLANFARVKNGARVADLGTGTGIIPLIIYGKNNVEKIYGVEIQEEVFEMASRTVKM--- 91

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
            +I  +I ++  D+  + E      L  N +D V  NPP+    G   P+  K  +   +
Sbjct: 92  NEIEDKIEIVNADLKEIKE-----VLPQNTFDVVTSNPPYMHSEGVKNPNDKKMISRHEV 146

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASR 179
           + + +  I+ A  +++  G+  +I RP  LI IV    + R+    +  +HPR  +  + 
Sbjct: 147 KCNLDDVIKAASILLKERGKFFMIHRPTRLIDIVTIGRKYRLEPKIMRFIHPRADKAPNL 206

Query: 180 ILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDL 215
           +LV   KG +  L+   P+ ++   G  Y++ + D+
Sbjct: 207 LLVEFTKGGKPDLKIMDPLYVYDNEGN-YTQEILDI 241


>gi|218134398|ref|ZP_03463202.1| hypothetical protein BACPEC_02301 [Bacteroides pectinophilus ATCC
           43243]
 gi|217989783|gb|EEC55794.1| hypothetical protein BACPEC_02301 [Bacteroides pectinophilus ATCC
           43243]
          Length = 254

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/192 (26%), Positives = 89/192 (46%), Gaps = 12/192 (6%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DL  G G   + + ++         E     A  ARK++ L   A    RI ++  D+  
Sbjct: 54  DLCTGNGIIPVLMEAKTKGKHYTGLEIQKESAELARKSVELNNTAD---RIDIVNDDL-- 108

Query: 77  VGENRNLAGL-KNNFYDHVIMNPPF-NERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAI 134
               +N   L K   +D V +NPP+ NE  G + P   K  A   +  + E  I T+ A+
Sbjct: 109 ----KNAVALYKRGRFDVVTVNPPYMNENHGIVNPSSPKAIARHEICCTLEDIISTSSAL 164

Query: 135 MRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTGRKGMRGQLR 193
           +R  G+  ++ RPQ L+QI   C + R+    +  ++P  G+ A+ +L+   +G   QL 
Sbjct: 165 LRDKGRFYMVHRPQRLVQIFELCHSYRLEPKRMRMVYPSYGKNANMVLIEAVRGGNSQLT 224

Query: 194 FRYPIVLHKPNG 205
              P++++  +G
Sbjct: 225 TEPPLIVYNEDG 236


>gi|125717564|ref|YP_001034697.1| hypothetical protein SSA_0711 [Streptococcus sanguinis SK36]
 gi|125497481|gb|ABN44147.1| Conserved hypothetical protein [Streptococcus sanguinis SK36]
 gi|325697121|gb|EGD39008.1| methyltransferase [Streptococcus sanguinis SK160]
 gi|332366026|gb|EGJ43782.1| methyltransferase [Streptococcus sanguinis SK1059]
          Length = 248

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 52/212 (24%), Positives = 108/212 (50%), Gaps = 20/212 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL AG GA GL  ++R  +A+IL  E    +A  A +++ L     +++++ +I+ D+
Sbjct: 50  IVDLCAGNGAVGLFASTRT-KAKILAVEIQERLADMAERSIEL---NDLTQQMQVIQDDL 105

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-----EDSFEKWIR 129
             +G  R + G K    D ++ NPP+           + E  H +L       + E+  +
Sbjct: 106 KNLG--RYITGSK---VDMILCNPPY---FKVDKQSNLNESQHYLLARHEISTNLEEICK 157

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTG-RKG 187
            A  +++S+G+L+++ RP+  + I++   A  +    I  ++P+ G+ A+ +L+   + G
Sbjct: 158 IAQRVLKSNGRLAMVHRPERFLDILDTMQAHNLAPKRIQFVYPKLGKEANMLLIEAIKDG 217

Query: 188 MRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
            R  L+   P+ +H  +G  Y+  + ++  GK
Sbjct: 218 SRDGLKILPPLFIHNQDGS-YTPEIHEIYYGK 248


>gi|332363469|gb|EGJ41252.1| methyltransferase [Streptococcus sanguinis SK355]
          Length = 248

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 109/212 (51%), Gaps = 20/212 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL AG GA GL  ++R  +A+IL  E    +A  A +++ L     +++++ +I+ D+
Sbjct: 50  IVDLCAGNGAVGLFASTRT-KAKILAVEIQERLADMAERSIEL---NDLTQQMQVIQDDL 105

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-----EDSFEKWIR 129
             +G+   + G K    D ++ NPP+           + E  H +L       + E+  +
Sbjct: 106 KNLGQY--ITGSK---VDMILCNPPY---FKVDKQSNLNESQHYLLARHEISTNLEEICK 157

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTG-RKG 187
            A  +++S+G+L+++ RP+  + I++   A ++    I  ++P+ G+ A+ +L+   + G
Sbjct: 158 IAQRVLKSNGRLAMVHRPERFLDILDTMQAHKLAPKRIQFVYPKLGKEANMLLIESIKDG 217

Query: 188 MRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
            R  L+   P+ +H  +G  Y+  + ++  GK
Sbjct: 218 SRNGLKILPPLFIHNQDGS-YTPEIHEIYYGK 248


>gi|323490974|ref|ZP_08096168.1| hypothetical protein GPDM_16436 [Planococcus donghaensis MPA1U2]
 gi|323395330|gb|EGA88182.1| hypothetical protein GPDM_16436 [Planococcus donghaensis MPA1U2]
          Length = 245

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 58/212 (27%), Positives = 108/212 (50%), Gaps = 23/212 (10%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL  G GA  L +++R  E++I+  E    +AH AR+++A     ++ K+I +IE DV
Sbjct: 47  IVDLCTGNGAIPLFLSART-ESRIIGVELQERLAHMARRSIAY---NELEKQIEIIEGDV 102

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKE-------EAHVMLEDSFEKW 127
             + +      L    YD V  NPP+      M+   I E       E H+ L+++    
Sbjct: 103 KDMPKQ-----LGFEKYDVVTCNPPYFP-AHEMSDKNISEHMAIARHELHLTLDEA---- 152

Query: 128 IRTACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTGRK 186
           ++ A  +++  G+ + + R   LI ++ A  A R+    I  ++P+ G+ A+ +L+ G K
Sbjct: 153 VQAASQLLKQGGKAAFVHRAGRLIDLMAAMRANRLEPKRIRLVYPKAGKEANTLLIEGIK 212

Query: 187 GMRGQLRFRYPIVLHKPNGQPYSRFVTDLING 218
             +  LR   P+V++  +G+ Y+  V +L+ G
Sbjct: 213 DGKPDLRILPPLVVYGEDGE-YTEEVRELLYG 243


>gi|325690144|gb|EGD32148.1| methyltransferase [Streptococcus sanguinis SK115]
          Length = 248

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 108/212 (50%), Gaps = 20/212 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL AG GA GL  ++R  +AQI+  E    +A  A +++ L     +++++ +I+ D+
Sbjct: 50  IVDLCAGNGAVGLFASTRT-KAQIMAVEIQERLADMAERSIEL---NDLTQQMQVIQDDL 105

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-----EDSFEKWIR 129
             +G  R + G +    D ++ NPP+           + E  H +L       + E+  +
Sbjct: 106 KNLG--RYITGSR---VDMILCNPPY---FKVDKQSNLNESQHYLLARHEISTNLEEICK 157

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTG-RKG 187
            A  +++S+G+L+++ RP+  + I++   A  +    I  ++P+ G+ A+ +L+   + G
Sbjct: 158 IAQRVLKSNGRLAMVHRPERFLDILDTMQAHNLAPKRIQFVYPKLGKEANMLLIEAIKDG 217

Query: 188 MRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
            R  L+   P+ +H  +G  Y+  + ++  GK
Sbjct: 218 SRDGLKILPPLFIHNQDGS-YTPEIHEIYYGK 248


>gi|289548934|ref|YP_003473922.1| methyltransferase small [Thermocrinis albus DSM 14484]
 gi|289182551|gb|ADC89795.1| methyltransferase small [Thermocrinis albus DSM 14484]
          Length = 238

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 51/198 (25%), Positives = 90/198 (45%), Gaps = 17/198 (8%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DLGAG GA  +  A R +   +L  ER  LM    R  + +    Q+  ++S++E DV
Sbjct: 44  VVDLGAGFGALSVLTALR-YSCHVLAVERDSLMLELLRYNVKV---NQLQDKVSVVEGDV 99

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFN-ERIGTMTPDKIKEEAHVMLEDSFEKWIRTACA 133
             V        LK    D VI+NPPF     G+          H  ++   E +I+ +  
Sbjct: 100 RDVEH-----FLKRYTADAVIVNPPFYPAHWGSKDGG-----YHFEMDTKLEDFIKASSY 149

Query: 134 IMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRKGMRGQL 192
           +++  G L+++      ++ V    R  I  + +   +P+  + A  + + GRK MR Q+
Sbjct: 150 LLKDGGHLNILIPSFRFLEAVENMKRYNIAPVHVMFFYPKLSKNARLVRIHGRKNMRSQM 209

Query: 193 RFRYPIVLHKPNGQPYSR 210
               P++++  +G  Y R
Sbjct: 210 IIEKPLIINTEDGS-YER 226


>gi|328948386|ref|YP_004365723.1| methyltransferase type 11 [Treponema succinifaciens DSM 2489]
 gi|328448710|gb|AEB14426.1| Methyltransferase type 11 [Treponema succinifaciens DSM 2489]
          Length = 244

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 54/217 (24%), Positives = 97/217 (44%), Gaps = 21/217 (9%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++L+      G     DLG G G   L ++ +  EA     E     A  AR+ + L   
Sbjct: 33  VLLSDFARTKGKCKACDLGTGTGIIPLLMSEKNPEANFECIEIQEESADMARRNVEL--- 89

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIK------E 114
             + ++I +   D+           L+ N +D V+ NPP+ E I     +K K       
Sbjct: 90  NNLQEKIKIFCADI-----KEPFKVLQKNSFDAVVSNPPYIE-ISNGNTNKTKPLSVARH 143

Query: 115 EAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPRE 173
           E    LED     I+TA A+++S G+  +I +P  L QI +   + ++    I  + P +
Sbjct: 144 EVFCTLED----VIKTAYALLKSHGKFFMIHKPFRLPQIFSLLEKYKLAPKRIKLVFPNK 199

Query: 174 GECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSR 210
            + AS +++   K  +  L+   PI+++  +G+ Y+R
Sbjct: 200 EKEASMVMIESEKCAKPYLKVESPIIVYGDDGK-YTR 235


>gi|302383414|ref|YP_003819237.1| methyltransferase small [Brevundimonas subvibrioides ATCC 15264]
 gi|302194042|gb|ADL01614.1| methyltransferase small [Brevundimonas subvibrioides ATCC 15264]
          Length = 254

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 86/207 (41%), Gaps = 10/207 (4%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           + G G GA    +A+R     +   ER P         + L A   +  R+++++ DV  
Sbjct: 55  EAGCGVGAVLTQIAARRPGVVVTGVERDPAAVALGACNVGLNA---LQDRMAVVQADVA- 110

Query: 77  VGENRNLAGLKNNFYDHVIMNPP-FNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIM 135
                  A L    +D  + NPP F++      P   K  A +  +D    WIR      
Sbjct: 111 ----GGFAALGRERFDWAVSNPPFFDDEAALRAPSPAKRGAWIA-DDGLAVWIRFLSDGA 165

Query: 136 RSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFR 195
           R  G++ +I R   L  ++     R GS  I P+ P   + A R+LV   +G +  LR  
Sbjct: 166 RDGGRIVVIHRADRLADLLALLGERCGSFAIRPIQPFADQAAKRVLVQAVRGGKAPLRLL 225

Query: 196 YPIVLHKPNGQPYSRFVTDLINGKRSL 222
             +VLH  +G  ++     ++ G+  L
Sbjct: 226 PALVLHDRSGAKHAPEAEAILRGETGL 252


>gi|256545047|ref|ZP_05472414.1| N-6 adenine-specific DNA methylase [Anaerococcus vaginalis ATCC
           51170]
 gi|256399250|gb|EEU12860.1| N-6 adenine-specific DNA methylase [Anaerococcus vaginalis ATCC
           51170]
          Length = 233

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 55/226 (24%), Positives = 107/226 (47%), Gaps = 29/226 (12%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+      +  L D+G+G+G   LA +S  + +++   E     A+  ++ + L   
Sbjct: 28  ILLANFSKMKKNKILIDIGSGSGILSLACSSYYNLSKVFSIEIQKEKANLLKENIKLNG- 86

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDK-----IKEE 115
                 I+ IEV    V ++ N     NNF D++I NPP+ ++   +  +K      ++E
Sbjct: 87  ------INNIEV----VNDDLNKVNFPNNFCDYIITNPPYYKKGANIKNEKKEFLLSRQE 136

Query: 116 AHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE---ITPLHPR 172
             + L D F    R +   ++  G+L +I +P+ L+ I+    +  G+L+   I  +  +
Sbjct: 137 IKMNLSDIF----RFSNKCLKDKGKLFMIHKPERLVDII----KESGNLKLKRIKFVQSK 188

Query: 173 EGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLING 218
             E    IL+   K     L+F  P++++  N   Y++ V + ING
Sbjct: 189 AFEKPVFILMEFVKNANDGLKFENPLIIYDENNN-YTKEVKE-ING 232


>gi|329889421|ref|ZP_08267764.1| methyltransferase small domain protein [Brevundimonas diminuta ATCC
           11568]
 gi|328844722|gb|EGF94286.1| methyltransferase small domain protein [Brevundimonas diminuta ATCC
           11568]
          Length = 242

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 60/216 (27%), Positives = 96/216 (44%), Gaps = 8/216 (3%)

Query: 7   VNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKR 66
           V A     L + G GAGA  + +A+R     +   ER    A  AR+   L  NA+   R
Sbjct: 33  VEARPGERLIEAGCGAGAVLMQIAARRPGVLLTGLERDAAAAALARQNAEL-NNAE--AR 89

Query: 67  ISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEK 126
            +++E DV      R    L  + +D  + NPPF +  G +      +    M +D    
Sbjct: 90  TTIVEGDVA-----RGFRALDLSPFDWAVSNPPFFDDPGALRAPAEGKLGAWMADDGLTA 144

Query: 127 WIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRILVTGRK 186
           W       +R  G++ +I R   L  I++  A + GS  + P+HP   + A R+LV   K
Sbjct: 145 WAGFLLKAVREGGRIVIIHRADRLADILSLLAPKAGSFAVRPIHPYADQPAKRVLVQAIK 204

Query: 187 GMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSL 222
             +  LR   P++LH  +G  +S     ++ G+ SL
Sbjct: 205 TGKAPLRLLPPLILHDRDGAKHSPQAEAILRGEASL 240


>gi|325694062|gb|EGD35980.1| methyltransferase [Streptococcus sanguinis SK150]
          Length = 248

 Score = 62.4 bits (150), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 52/212 (24%), Positives = 107/212 (50%), Gaps = 20/212 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL AG GA GL  ++R  +AQIL  E    +A  A +++ L     +++++ +I+ D+
Sbjct: 50  IVDLCAGNGAVGLFASTRT-KAQILAVEIQERLADMAERSIEL---NDLTQQMQVIQDDL 105

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-----EDSFEKWIR 129
             +G  R + G K    D ++ NPP+           + E  H +L       +  +  +
Sbjct: 106 KNLG--RYITGSK---VDMILCNPPY---FKVDKKSNLNESQHYLLARHEISTNLGEICK 157

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTG-RKG 187
            A  +++S+G+L+++ RP+  + I++   A  +    I  ++P+ G+ A+ +L+   + G
Sbjct: 158 IAQRVLKSNGRLAMVHRPERFLDILDTMQAHNLAPKRIQFVYPKLGKEANMLLIEAIKDG 217

Query: 188 MRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
            R  L+   P+ +H  +G  Y+  + ++  GK
Sbjct: 218 SRDGLKILPPLFIHNQDGS-YTPEIHEIYYGK 248


>gi|170017344|ref|YP_001728263.1| O-methyltransferase [Leuconostoc citreum KM20]
 gi|169804201|gb|ACA82819.1| Predicted O-methyltransferase [Leuconostoc citreum KM20]
          Length = 253

 Score = 62.4 bits (150), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 56/217 (25%), Positives = 107/217 (49%), Gaps = 16/217 (7%)

Query: 7   VNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKR 66
           V   G+    DLGAG GA GL  A ++   ++ L E  P +A  A++++A+    ++++R
Sbjct: 44  VKGKGTGLTVDLGAGTGAVGLFYAPKV-TGKLALVEIQPELADMAKRSIAM---NELTQR 99

Query: 67  ISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF---NERIGTMTPDKIKEEAHVMLEDS 123
           +S+IE D+  + E+     ++    + V+ NPP+   NE   T   DK  + A   L   
Sbjct: 100 VSVIESDMKAIFED-----IQPGSVETVLSNPPYFPLNETTKT-NHDKHYQLARHELTID 153

Query: 124 FEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACA-RRIGSLEITPLHPREGECASRILV 182
                +    +++++G+  ++ RP  L  I  A A R++    I  ++ +    A+ +L+
Sbjct: 154 LPGLAQVVNKLLKNNGKFYMVHRPDRLADIFAAFASRKLMIKRIQFVYGKANREANMVLI 213

Query: 183 TGRKGMR-GQLRFRYPIVLHKPNGQPYSRFVTDLING 218
              K  R G +R   PI+ +      Y++ V+D++ G
Sbjct: 214 EAIKSGRPGGVRIMPPIIAYTSENN-YTKAVSDILYG 249


>gi|295688726|ref|YP_003592419.1| putative RNA methylase [Caulobacter segnis ATCC 21756]
 gi|295430629|gb|ADG09801.1| putative RNA methylase [Caulobacter segnis ATCC 21756]
          Length = 219

 Score = 62.0 bits (149), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 55/204 (26%), Positives = 87/204 (42%), Gaps = 8/204 (3%)

Query: 19  GAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVG 78
           G G G A LA A+R         ER  L A  A +  AL     +S+R++++E DV    
Sbjct: 22  GCGVGGALLAAATRRPGVIFQGVERDSLAASLATENAAL---NDLSERVAILEGDV---- 74

Query: 79  ENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSS 138
                  L    +D V+ NPPF +   T+      +    M +   + W       +R  
Sbjct: 75  -EAGFRALGLPAFDAVMTNPPFFDDPATLRAPHPAKSGAWMADGGLKAWTTFCLKAVREG 133

Query: 139 GQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPI 198
           G +++I R   L  I+   A + GS  I P+ P     A R++V   K  +  L    P+
Sbjct: 134 GTITIIHRADRLADILAELAPKAGSFRIRPIAPFADASAKRVIVRAIKTGKAPLVLLPPL 193

Query: 199 VLHKPNGQPYSRFVTDLINGKRSL 222
           VLH  +G  +S     ++ G+ +L
Sbjct: 194 VLHDRDGGKHSAEAEAILRGEAAL 217


>gi|169825664|ref|YP_001695822.1| hypothetical protein Bsph_0054 [Lysinibacillus sphaericus C3-41]
 gi|168990152|gb|ACA37692.1| Hypothetical yabB protein [Lysinibacillus sphaericus C3-41]
          Length = 249

 Score = 62.0 bits (149), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 58/229 (25%), Positives = 110/229 (48%), Gaps = 22/229 (9%)

Query: 1   MILASLVNATGSFH---LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLAL 57
           ++L+  VN    +H   + DL +G G   L ++ R  + QI   E  P +   A +++  
Sbjct: 35  VLLSKFVNI--PYHKGNIVDLCSGNGVIPLFLSVRT-KGQITGVELQPRLLDMAERSIRY 91

Query: 58  PANAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAH 117
               Q+  +I +I  DV  + +   +       YD V  NPP+   +     DK   E H
Sbjct: 92  ---NQLENQIQMILGDVKEIPKQLGIEK-----YDVVTCNPPY--FLAHEASDKNLSEHH 141

Query: 118 VM----LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPR 172
            +    L  + E+ I++A  +++  G+ + + RP  L+ IV A  A R+    +  ++P+
Sbjct: 142 AIARHELYLTLEEAIQSASKLLKQGGKAAFVHRPGRLLDIVTAMRANRLEPKRMQLIYPK 201

Query: 173 EGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRS 221
           EG+ A+ +L+ G K  +  L+   P+ ++K N + Y+  V +++ GK  
Sbjct: 202 EGKEANTLLIEGIKDGKPDLKILPPLYVYKNNNE-YTAEVREILYGKEQ 249


>gi|158321689|ref|YP_001514196.1| methyltransferase small [Alkaliphilus oremlandii OhILAs]
 gi|158141888|gb|ABW20200.1| methyltransferase small [Alkaliphilus oremlandii OhILAs]
          Length = 255

 Score = 62.0 bits (149), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 45/206 (21%), Positives = 100/206 (48%), Gaps = 9/206 (4%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+ V    +  + DLG G G   + +A +   + I   E    +A  A++++ L   
Sbjct: 35  VLLANFVTLKKNAKVVDLGTGTGIIPILLAGKSQTSHITALEIQKEVADMAQRSVQL--- 91

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
             ++ RI ++ +D+    +N ++ G     YD V  NPP+    G +  +  K  +   +
Sbjct: 92  NHLADRIHVLNMDLKDAEKNLDVNG-----YDVVTSNPPYMHPEGLLNIEDKKAISRHEV 146

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASR 179
           + + E  IRTA  +++ +G+  ++ RP  L  I+  C + ++   ++  +HP   +  + 
Sbjct: 147 KCTLEDVIRTASRLLKHNGKFFMVHRPIRLADIMVYCRQYKLEPKKLQLIHPTYDKKPNL 206

Query: 180 ILVTGRKGMRGQLRFRYPIVLHKPNG 205
           +L+   K  + +L+   P+ ++  +G
Sbjct: 207 LLIECVKAAKPELKILDPLYVYHKDG 232


>gi|258611633|ref|ZP_05234310.2| conserved hypothetical protein [Listeria monocytogenes FSL N3-165]
 gi|258602041|gb|EEW15366.1| conserved hypothetical protein [Listeria monocytogenes FSL N3-165]
          Length = 250

 Score = 62.0 bits (149), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 54/219 (24%), Positives = 108/219 (49%), Gaps = 33/219 (15%)

Query: 14  HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVD 73
            + DL +G G   L +++R  EAQI+  E    +A  A+++++     Q+ ++I +IE D
Sbjct: 50  EIIDLCSGNGIIPLLLSTRT-EAQIVGVEIQERLADMAKRSISY---NQLEEQIEMIEYD 105

Query: 74  VTLVGENRNLAGL-KNNFYDHVIMNPPFNERIGTMTPDK-----------IKEEAHVMLE 121
           +      +N+  L      D V  NPP+       TPD             + E    LE
Sbjct: 106 L------KNITDLIPKERADIVTCNPPY-----FATPDTSLKNTNEHFRIARHEVMCTLE 154

Query: 122 DSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRI 180
           D+    IR A ++++  G+ + + RP+ L+ I++   + R+    I  +HPR  + A+ +
Sbjct: 155 DT----IRVAASLLKQGGKANFVHRPERLLDIIDIMRKYRLEPKRIQFVHPRIDKEANTV 210

Query: 181 LVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
           LV G K  +  +++  P++++   G+ Y+  + +++ G+
Sbjct: 211 LVEGIKDGKPGVKYVPPVIVYDELGE-YTPVIKEILYGE 248


>gi|16802213|ref|NP_463698.1| hypothetical protein lmo0165 [Listeria monocytogenes EGD-e]
 gi|16409524|emb|CAC98380.1| lmo0165 [Listeria monocytogenes EGD-e]
          Length = 250

 Score = 61.6 bits (148), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 54/218 (24%), Positives = 108/218 (49%), Gaps = 33/218 (15%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G G   L +++R  EAQI+  E    +A  A+++++     Q+ ++I +IE D+
Sbjct: 51  IIDLCSGNGIIPLLLSTRT-EAQIVGVEIQERLADMAKRSISY---NQLEEQIEMIEYDL 106

Query: 75  TLVGENRNLAGL-KNNFYDHVIMNPPFNERIGTMTPDK-----------IKEEAHVMLED 122
                 +N+  L      D V  NPP+       TPD             + E    LED
Sbjct: 107 ------KNITDLIPKERADIVTCNPPY-----FATPDTSLKNTNEHFRIARHEVMCTLED 155

Query: 123 SFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRIL 181
           +    IR A ++++  G+ + + RP+ L+ I++   + R+    I  +HPR  + A+ +L
Sbjct: 156 T----IRVAASLLKQGGKANFVHRPERLLDIIDIMRKYRLEPKRIQFVHPRIDKEANTVL 211

Query: 182 VTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
           V G K  +  +++  P++++   G+ Y+  + +++ G+
Sbjct: 212 VEGIKDGKPGVKYVPPVIVYDELGE-YTPVIKEILYGE 248


>gi|224500801|ref|ZP_03669150.1| hypothetical protein LmonF1_14461 [Listeria monocytogenes Finland
           1988]
 gi|224503751|ref|ZP_03672058.1| hypothetical protein LmonFR_14839 [Listeria monocytogenes FSL
           R2-561]
 gi|254832315|ref|ZP_05236970.1| hypothetical protein Lmon1_13254 [Listeria monocytogenes 10403S]
 gi|255027242|ref|ZP_05299228.1| hypothetical protein LmonocytFSL_14528 [Listeria monocytogenes FSL
           J2-003]
          Length = 257

 Score = 61.6 bits (148), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 54/218 (24%), Positives = 108/218 (49%), Gaps = 33/218 (15%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G G   L +++R  EAQI+  E    +A  A+++++     Q+ ++I +IE D+
Sbjct: 58  IIDLCSGNGIIPLLLSTRT-EAQIVGVEIQERLADMAKRSISY---NQLEEQIEMIEYDL 113

Query: 75  TLVGENRNLAGL-KNNFYDHVIMNPPFNERIGTMTPDK-----------IKEEAHVMLED 122
                 +N+  L      D V  NPP+       TPD             + E    LED
Sbjct: 114 ------KNITDLIPKERADIVTCNPPY-----FATPDTSLKNTNEHFRIARHEVMCTLED 162

Query: 123 SFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRIL 181
           +    IR A ++++  G+ + + RP+ L+ I++   + R+    I  +HPR  + A+ +L
Sbjct: 163 T----IRVAASLLKQGGKANFVHRPERLLDIIDIMRKYRLEPKRIQFVHPRIDKEANTVL 218

Query: 182 VTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
           V G K  +  +++  P++++   G+ Y+  + +++ G+
Sbjct: 219 VEGIKDGKPGVKYVPPVIVYDELGE-YTPVIKEILYGE 255


>gi|114798814|ref|YP_759410.1| hypothetical protein HNE_0681 [Hyphomonas neptunium ATCC 15444]
 gi|114738988|gb|ABI77113.1| conserved hypothetical protein [Hyphomonas neptunium ATCC 15444]
          Length = 247

 Score = 61.6 bits (148), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 51/206 (24%), Positives = 87/206 (42%), Gaps = 11/206 (5%)

Query: 14  HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVD 73
            + +LG G G A L  A R+        E S  ++  +RK  AL        R+++   +
Sbjct: 47  EMLELGCGCGGALLPAAYRMPGVSFTGLEVSRSVSDMSRKGAALNG---FGPRVTIENTE 103

Query: 74  VTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACA 133
            +             N +D V  NPP+ E      P + K  A++    S E WI+    
Sbjct: 104 AS------EWVKSHENRFDAVFANPPYFEPGKISEPGEGKASAYIETL-SLEGWIKAMLH 156

Query: 134 IMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRILVTGRKGM-RGQL 192
             +    + L+ R   L +++    R+ G + + P+  + GE A R+LV  RKG+ RG L
Sbjct: 157 AAKPRAPVILVHRAAELARLLAQLDRQAGEITVLPVASKAGEPARRVLVRARKGLKRGPL 216

Query: 193 RFRYPIVLHKPNGQPYSRFVTDLING 218
               P++ H  +G   +     ++ G
Sbjct: 217 TLLPPLITHTDDGSARTPAAQAIVEG 242


>gi|327473346|gb|EGF18766.1| methyltransferase [Streptococcus sanguinis SK408]
          Length = 248

 Score = 61.6 bits (148), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 49/212 (23%), Positives = 107/212 (50%), Gaps = 20/212 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL AG GA GL  ++R  +A+IL  E    +A  A +++ L     +++++ +I+ D+
Sbjct: 50  IVDLCAGNGAVGLFASTRT-KAKILAVEIQERLADMAERSIEL---NDLTQQMQVIQDDL 105

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-----EDSFEKWIR 129
             +G+      +  +  D ++ NPP+           + E  H +L       + E+  +
Sbjct: 106 KNLGQY-----ITGSRVDMILCNPPY---FKVDKQSNLNESQHYLLARHEISTNLEEICK 157

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTG-RKG 187
            A  +++S+G+L+++ RP+  + I++   A  +    I  ++P+ G+ A+ +L+   + G
Sbjct: 158 IAQRVLKSNGRLAMVHRPERFLDILDTMQAHNLAPKRIQFVYPKLGKEANMLLIEAIKDG 217

Query: 188 MRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
            R  L+   P+ +H  +G  Y+  + ++  GK
Sbjct: 218 SRDGLKILPPLFIHNQDGS-YTPEIHEIYYGK 248


>gi|324993353|gb|EGC25273.1| methyltransferase [Streptococcus sanguinis SK405]
          Length = 248

 Score = 61.6 bits (148), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 107/212 (50%), Gaps = 20/212 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL AG GA GL  ++R  +A+IL  E    +A  A +++ L     +++++ +I+ D+
Sbjct: 50  IVDLCAGNGAVGLFASTRT-KAKILAVEIQERLADMAERSIEL---NDLTQQMQVIQDDL 105

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-----EDSFEKWIR 129
             +G  R + G K    D ++ NPP+           + E  H +L       + E+  +
Sbjct: 106 KNLG--RYITGSK---VDMILCNPPY---FKVDKQSNLNESQHYLLARHEISTNLEEICK 157

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTG-RKG 187
            A  +++S+G+L+++ RP+  + I++   A  +    I  ++P+ G+ A+ +L+   + G
Sbjct: 158 IAQRVLKSNGRLAMVHRPERFLDILDTMQAHNLAPKRIQFVYPKLGKEANMLLIEAIKDG 217

Query: 188 MRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
               L+   P+ +H  +G  Y+  + ++  GK
Sbjct: 218 SSDGLKILPPLFIHNQDGS-YTPEIHEIYYGK 248


>gi|188587917|ref|YP_001922499.1| SAM-dependent methyltransferase [Clostridium botulinum E3 str.
           Alaska E43]
 gi|188498198|gb|ACD51334.1| SAM-dependent methyltransferase [Clostridium botulinum E3 str.
           Alaska E43]
          Length = 250

 Score = 61.6 bits (148), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 50/219 (22%), Positives = 106/219 (48%), Gaps = 15/219 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           +IL+   N      + DL  G G     +  + +  +I   E    M   A K++ L A 
Sbjct: 39  VILSDFANIKNKHRVIDLCTGTGIIPFLLYGKYNPKEIYGLEIQEEMVKMAEKSVKLNA- 97

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKN-NFYDHVIMNPPFN-ERIGTMTP-DKIKEEAH 117
             +  +I++I+ D+      +N+  LK  + +D V +NPP+     G + P DK+    H
Sbjct: 98  --LEDKITIIKEDL------KNIEYLKKMDKFDVVTVNPPYKLNNAGIINPSDKLAIARH 149

Query: 118 VMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGEC 176
            +L  + E  I  +  +++ +G++ ++ RP+ L  I     + +I    +  ++P+ G+ 
Sbjct: 150 EVLC-NLEDVIYASKILLKDNGRMFIVHRPERLADIFTLMRKYKIEPKRVRMVYPKPGKA 208

Query: 177 ASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDL 215
           A+ +LV G++     L++  P+ +H  +G  Y++ + ++
Sbjct: 209 ANIVLVEGQRDGGSYLKWDIPLYVHNEDGS-YTKQIDEI 246


>gi|194018002|ref|ZP_03056609.1| YabB [Bacillus pumilus ATCC 7061]
 gi|194010339|gb|EDW19914.1| YabB [Bacillus pumilus ATCC 7061]
          Length = 247

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 57/216 (26%), Positives = 104/216 (48%), Gaps = 27/216 (12%)

Query: 14  HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVD 73
            + DL  G G   L +++R  +A I   E    +   A++++A     Q+ K+I LI  D
Sbjct: 48  EIIDLCTGNGIVPLLLSTR-SKASITGVEIQERLFDMAKRSVAY---NQLEKQIELIHGD 103

Query: 74  VTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKE---------EAHVMLEDSF 124
           +     N   +   N+  D +  NPP+     T + ++I E         E H  LED  
Sbjct: 104 L-----NDMPSRYGNHKVDVITCNPPY---FKTPSKEEINENEYLAIARHEIHCTLED-- 153

Query: 125 EKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVT 183
              IR +  +++  G+L+++ RP  L++IV    + RI    I  ++P++G+ A+ ILV 
Sbjct: 154 --VIRVSSTLLKQGGKLAMVHRPGRLLEIVELMKKYRIEPKRIQFVYPKQGKEANTILVE 211

Query: 184 GRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
           G K  +  L+   P+ ++  + Q Y+  +  ++ GK
Sbjct: 212 GIKDGKPDLKILPPLFVYG-DDQEYTEEIRTILYGK 246


>gi|332361710|gb|EGJ39514.1| methyltransferase [Streptococcus sanguinis SK1056]
          Length = 248

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 107/212 (50%), Gaps = 20/212 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL AG GA GL  ++R  +AQIL  E    +A  A +++ L     +++++ +I+ D+
Sbjct: 50  IVDLCAGNGAVGLFASTRT-KAQILAVEIQERLADMAERSIEL---NDLTQQMQVIQDDL 105

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-----EDSFEKWIR 129
             +G+   + G K    D ++ NPP+           + E  H +L       +  +  +
Sbjct: 106 KNLGQY--ITGSK---VDMILCNPPY---FKVDKKSNLNESQHYLLARHEISTNLGEICK 157

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTG-RKG 187
            A  +++S+G+L+++ RP+  + I++   A  +    I  ++P+ G+ A+ +L+   + G
Sbjct: 158 IAQRVLKSNGRLAMVHRPERFLDILDTMQAHNLAPKRIQFVYPKLGKEANMLLIEAIKDG 217

Query: 188 MRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
            R  L+   P+ +H  +G  Y+  + ++  GK
Sbjct: 218 SRDGLKILPPLFIHNQDGS-YTPEIHEIYYGK 248


>gi|260428939|ref|ZP_05782916.1| methyltransferase small [Citreicella sp. SE45]
 gi|260419562|gb|EEX12815.1| methyltransferase small [Citreicella sp. SE45]
          Length = 257

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 63/226 (27%), Positives = 97/226 (42%), Gaps = 16/226 (7%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+ + A     + +LG GA  A   +  R+   ++   E  P  A  AR+ L    N
Sbjct: 37  VLLAATIPARSGESVLELGCGAAPALCCLGVRVPGLKLAGLEIQPGYAALARRNLE--GN 94

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
               +   + E D+         A L+   +DHV+ NPP+ E         +  E  +  
Sbjct: 95  GLDGE---VFEGDIAT-----PPATLRALTFDHVLANPPYFEAGRRSAAPDVGREMALAG 146

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI 180
                 W   A   +R  G ++ I R + L +++ A     GSLE+ PL PR G     I
Sbjct: 147 PAPMAAWAALAARRLRPRGTVTFIQRVERLPELLAAMQAVFGSLELWPLAPRAGRAPRLI 206

Query: 181 LVTGRKGMRGQLRFRYPIVLHK-----PNGQPYSRFV-TDLINGKR 220
           L  GRKG R   RF   +VLH+      +G+ Y+  +   L  GKR
Sbjct: 207 LARGRKGGRAAFRFHPALVLHEGARHLEDGEDYTDVIRATLREGKR 252


>gi|197104246|ref|YP_002129623.1| methyltransferase [Phenylobacterium zucineum HLK1]
 gi|196477666|gb|ACG77194.1| methyltransferase [Phenylobacterium zucineum HLK1]
          Length = 246

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 78/188 (41%), Gaps = 8/188 (4%)

Query: 36  AQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVI 95
           A  +  ER P     A++ +AL     +  R+ ++  DV +       A L    +D  +
Sbjct: 65  ASFVGVERDPEALALAQENVALNG---LQDRVQVLAGDVGV-----PFAKLGLPAFDAAM 116

Query: 96  MNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVN 155
            NPPF +    +     ++ A  M E     W       +R  G +++I R   L  ++ 
Sbjct: 117 ANPPFFDNPAALRAPAAEKTAAWMAEGGLSAWTGFLSKAVREGGTITIIHRADRLADLLA 176

Query: 156 ACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDL 215
             + + GS ++ P+H   GE A R++V   K  +  LR    +VLH   G  ++     +
Sbjct: 177 GLSPKAGSFQVRPVHAFAGEPAKRVIVRAVKTGKAPLRLLPALVLHDRGGAKHTAEAEAI 236

Query: 216 INGKRSLT 223
           + G   L 
Sbjct: 237 LRGAAGLA 244


>gi|157690816|ref|YP_001485278.1| O-methyltransferase [Bacillus pumilus SAFR-032]
 gi|157679574|gb|ABV60718.1| possible O-methyltransferase [Bacillus pumilus SAFR-032]
          Length = 247

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 57/216 (26%), Positives = 104/216 (48%), Gaps = 27/216 (12%)

Query: 14  HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVD 73
            + DL  G G   L +++R  +A I   E    +   A++++A     Q+ K+I LI  D
Sbjct: 48  EIIDLCTGNGIVPLLLSTR-SKASITGVEIQDRLFDMAKRSVAY---NQLEKQIELIHGD 103

Query: 74  VTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKE---------EAHVMLEDSF 124
           +     N   A   N+  D +  NPP+     T + ++I E         E H  LED  
Sbjct: 104 L-----NDMPARYGNHKVDVITCNPPY---FKTPSKEEINENEYLAIARHEIHCTLED-- 153

Query: 125 EKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVT 183
              IR +  +++  G+L+++ RP  L++IV    + RI    I  ++P++G+ A+ ILV 
Sbjct: 154 --VIRVSSTLLKQGGKLAMVHRPGRLLEIVELMKKYRIEPKRIQFVYPKQGKEANTILVE 211

Query: 184 GRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
           G K  +  L+   P+ ++  + Q Y+  +  ++ G+
Sbjct: 212 GIKDGKPDLKILPPLFVYG-DDQEYTEEIRTILYGE 246


>gi|302384472|ref|YP_003820294.1| Methyltransferase type 11 [Clostridium saccharolyticum WM1]
 gi|302195100|gb|ADL02671.1| Methyltransferase type 11 [Clostridium saccharolyticum WM1]
          Length = 245

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 89/191 (46%), Gaps = 10/191 (5%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DLG G G   L + ++         E    MA  AR+++AL     + ++I+++  D+  
Sbjct: 51  DLGTGTGIIPLLLEAKNQGIHYTGLEIQEAMAEMARRSVAL---NHLEEKITIVTGDIK- 106

Query: 77  VGENRNLAGLKNNFYDHVIMNPPF-NERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIM 135
             E   L G  +  +D V  NPP+ N+  G   PD  K  A   +  S     R A  ++
Sbjct: 107 --EASRLFGAAS--FDVVTSNPPYMNDSHGLKNPDLPKAIARHEVLCSLSDVTREAARLL 162

Query: 136 RSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRKGMRGQLRF 194
           R  G+  ++ RP  L++I+ A    R+    +  +HP   + A+ +L+   +G R  ++ 
Sbjct: 163 RPGGRFYMVHRPHRLVEIITALKDCRLEPKRMKMVHPFADKEANMVLIEAVRGGRSMIKV 222

Query: 195 RYPIVLHKPNG 205
             P++++K  G
Sbjct: 223 EAPVIVYKEPG 233


>gi|299536742|ref|ZP_07050052.1| hypothetical protein BFZC1_12007 [Lysinibacillus fusiformis ZC1]
 gi|298727856|gb|EFI68421.1| hypothetical protein BFZC1_12007 [Lysinibacillus fusiformis ZC1]
          Length = 249

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 53/212 (25%), Positives = 103/212 (48%), Gaps = 17/212 (8%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G G   L +++R  + QI   E  P +   A +++      Q+ ++I +I  DV
Sbjct: 50  IVDLCSGNGVIPLFLSART-KGQITGVEIQPRLFEMAERSIRY---NQLEQQIQMILGDV 105

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVM----LEDSFEKWIRT 130
             + +   +       YD V  NPP+   +     DK   E H +    L  + E+ I++
Sbjct: 106 KEIPKQLGIEK-----YDVVTCNPPYF--LAHEASDKNLSEHHAIARHELYLTLEEAIQS 158

Query: 131 ACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTGRKGMR 189
           A  +++  G+ + + RP  L+ IV A  A R+    +  ++P+EG+ A+ +L+ G K  +
Sbjct: 159 ASKLLKQGGKAAFVHRPGRLLDIVTAMRANRLEPKRMQLIYPKEGKEANTLLIEGIKDGK 218

Query: 190 GQLRFRYPIVLHKPNGQPYSRFVTDLINGKRS 221
             L+   P+ ++  N + Y+  V +++ GK  
Sbjct: 219 PDLKILPPLYVYDANNE-YTAEVREILYGKEQ 249


>gi|284803095|ref|YP_003414960.1| hypothetical protein LM5578_2852 [Listeria monocytogenes 08-5578]
 gi|284996236|ref|YP_003418004.1| hypothetical protein LM5923_2801 [Listeria monocytogenes 08-5923]
 gi|284058657|gb|ADB69598.1| hypothetical protein LM5578_2852 [Listeria monocytogenes 08-5578]
 gi|284061703|gb|ADB72642.1| hypothetical protein LM5923_2801 [Listeria monocytogenes 08-5923]
          Length = 257

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/218 (24%), Positives = 107/218 (49%), Gaps = 33/218 (15%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G G   L +++R  E QI+  E    +A  A+++++     Q+ ++I +IE D+
Sbjct: 58  IIDLCSGNGIIPLLLSTRT-ETQIVGVEIQERLADMAKRSISY---NQLEEQIEMIEYDL 113

Query: 75  TLVGENRNLAGL-KNNFYDHVIMNPPFNERIGTMTPDK-----------IKEEAHVMLED 122
                 +N+  L      D V  NPP+       TPD             + E    LED
Sbjct: 114 ------KNITDLIPKERADIVTCNPPY-----FATPDTSLKNTNEHFRIARHEVMCTLED 162

Query: 123 SFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRIL 181
           +    IR A ++++  G+ + + RP+ L+ I++   + R+    I  +HPR  + A+ +L
Sbjct: 163 T----IRVAASLLKQGGKANFVHRPERLLDIIDIMRKYRLEPKRIQFVHPRIDKEANTVL 218

Query: 182 VTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
           V G K  +  +++  P++++   G+ Y+  + +++ G+
Sbjct: 219 VEGIKDGKPGVKYVPPVIVYDELGE-YTPVIKEILYGE 255


>gi|332524046|ref|ZP_08400298.1| methyltransferase small domain protein [Streptococcus porcinus str.
           Jelinkova 176]
 gi|332315310|gb|EGJ28295.1| methyltransferase small domain protein [Streptococcus porcinus str.
           Jelinkova 176]
          Length = 249

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/220 (24%), Positives = 106/220 (48%), Gaps = 34/220 (15%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G GA GL  ASR  +AQI+  E    +A  A +++ L    Q+ K++S+I  D+
Sbjct: 50  IVDLCSGNGAVGL-FASRNTKAQIVEIEIQERLAEMAERSIKL---NQLEKQVSIICDDL 105

Query: 75  TLVGENRNLAGLKNNFYDHV--------IMNPPFNERIGTMTPDKIKEEAHVMLEDSFEK 126
                        NN  DHV        + NPP+ +   T +  K   + +++       
Sbjct: 106 -------------NNLLDHVPRSGVDLILCNPPYFK--STKSSKKNISKHYLLARHEITT 150

Query: 127 WIRTACAI----MRSSGQLSLIARPQSLIQIVNACARR-IGSLEITPLHPREGECASRIL 181
            +   C+I    ++S+G+L+++ RP   I+IV++  +  +    +  ++P+  + A+ +L
Sbjct: 151 NLEEICSISRHALKSNGRLAMVHRPDRFIEIVDSLQKYGLAPKRVQFVYPKASKEANMLL 210

Query: 182 VTG-RKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKR 220
           +   + G    ++   P+++HK NG  Y+  +  L  G +
Sbjct: 211 IEAIKDGSIEGMKILPPLIVHKENGD-YTDDINTLYFGTK 249


>gi|254418181|ref|ZP_05031905.1| Methyltransferase small domain family [Brevundimonas sp. BAL3]
 gi|196184358|gb|EDX79334.1| Methyltransferase small domain family [Brevundimonas sp. BAL3]
          Length = 249

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 54/208 (25%), Positives = 89/208 (42%), Gaps = 8/208 (3%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           L + G GAGA  + +A+R     +   ER  + A  AR+   L    Q + RI + + DV
Sbjct: 48  LFEAGCGAGAVLMQIAARHAGVSLTGLERDSVAAGLARENADL---NQSADRIRIFDGDV 104

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAI 134
                      L    +D  + NPPF +  G +      ++   M +D    W       
Sbjct: 105 A-----DGFRPLDLPPFDWAVSNPPFFDDPGALRAPAPGKQGAWMADDGLSAWTGLLLKA 159

Query: 135 MRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRF 194
           +R  G++ +I R   L  ++     + GS  I P+ P   E A R+LV   K  +  LR 
Sbjct: 160 VREGGRIVIIHRADRLADLLTLLGEKAGSFAIRPVQPFADEPAKRVLVQAIKTGKAPLRL 219

Query: 195 RYPIVLHKPNGQPYSRFVTDLINGKRSL 222
             P+VLH  +G  ++     ++ G+ +L
Sbjct: 220 LPPLVLHDRSGAKHTPEAEAILRGEAAL 247


>gi|212696291|ref|ZP_03304419.1| hypothetical protein ANHYDRO_00828 [Anaerococcus hydrogenalis DSM
           7454]
 gi|212676920|gb|EEB36527.1| hypothetical protein ANHYDRO_00828 [Anaerococcus hydrogenalis DSM
           7454]
          Length = 233

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 57/226 (25%), Positives = 103/226 (45%), Gaps = 29/226 (12%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+      +  L D+GAG G   LA  S  + +++   E     A    + L L + 
Sbjct: 28  ILLANFSKMKKNKTLIDIGAGNGILSLACLSYYNLSKVYGIEIQEKKAEIFNENLKLNSI 87

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDK-----IKEE 115
                        + ++ ++ NL    NNF D++I NPP+ ++   +  DK      ++E
Sbjct: 88  NN-----------IEIINKDLNLTNFPNNFCDYIITNPPYYKKGANIRNDKEEFLLSRQE 136

Query: 116 AHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE---ITPLHPR 172
             + L D F    +T    ++  G+L +I +P+ L+ I+    +  G+L+   I  +  +
Sbjct: 137 IKMNLADIFSFSNKT----LKDKGRLFMIHKPERLVDII----KESGNLKLKRIKFVQSK 188

Query: 173 EGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLING 218
             E    IL+   K     L+F  P++++  NG  YS+ V  LING
Sbjct: 189 SNEKPVFILLEFVKNANDGLKFEDPLIIYDENGN-YSQEVR-LING 232


>gi|251779390|ref|ZP_04822310.1| SAM-dependent methyltransferase [Clostridium botulinum E1 str.
           'BoNT E Beluga']
 gi|243083705|gb|EES49595.1| SAM-dependent methyltransferase [Clostridium botulinum E1 str.
           'BoNT E Beluga']
          Length = 250

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 49/219 (22%), Positives = 105/219 (47%), Gaps = 15/219 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           +IL+   N      + DL  G G     +  +    +I   E    M + A K++ L A 
Sbjct: 39  VILSDFANIKNKHRVIDLCTGTGIIPFLLYGKYSPREIYGLEIQEEMVNMAEKSVKLNA- 97

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKN-NFYDHVIMNPPFN-ERIGTMTP-DKIKEEAH 117
             +  +I+ ++ D+      +N+  LK  + +D V +NPP+     G + P DK+    H
Sbjct: 98  --LEDKITFMKEDL------KNIEYLKKMDKFDVVTVNPPYKLNNAGIINPTDKLAIARH 149

Query: 118 VMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGEC 176
            +L  + E  I  +  +++ +G++ ++ RP+ L  I     + +I    +  ++P+ G+ 
Sbjct: 150 EVLC-NLEDVIYASKILLKDNGRMFIVHRPERLADIFTLMRKYKIEPKRVKMVYPKPGKA 208

Query: 177 ASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDL 215
           A+ +LV G++     L++  P+ +H  +G  Y++ + ++
Sbjct: 209 ANIVLVEGQRDGGSYLKWDIPLYVHNEDGS-YTKQIDEI 246


>gi|162147609|ref|YP_001602070.1| methyltransferase [Gluconacetobacter diazotrophicus PAl 5]
 gi|161786186|emb|CAP55768.1| putative methyltransferase [Gluconacetobacter diazotrophicus PAl 5]
          Length = 277

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 58/119 (48%), Gaps = 4/119 (3%)

Query: 91  YDHVIMNPPFNERIGTMTPDKIKEEAH-VMLEDSFEKWIRTACAIMRSSGQLSLIARPQS 149
           +DH   NPP++    + +PD  ++ A  V   D    WIR     +R  G L+L A P  
Sbjct: 144 FDHAFANPPWHHNAASASPDARRDLARRVGSPDMIALWIRALGRQVRHRGTLTL-ALPAG 202

Query: 150 LIQIVNACARR--IGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQ 206
           L+ +  A  R   IG++ + P  P+ G  A  +L+ GR G RG+      + LH+ +G 
Sbjct: 203 LLDMAVAAMRAHGIGAISLFPFWPKAGRAARIMLIQGRVGARGEAVLMPGMTLHRDDGS 261


>gi|150387943|ref|YP_001317992.1| methyltransferase small [Alkaliphilus metalliredigens QYMF]
 gi|149947805|gb|ABR46333.1| methyltransferase small [Alkaliphilus metalliredigens QYMF]
          Length = 255

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 47/212 (22%), Positives = 99/212 (46%), Gaps = 9/212 (4%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+ V    +  + DLG G G   + +A +   + +   E    +A  A++++ L   
Sbjct: 35  VLLANFVTLKKNARVVDLGTGTGIIPILLAGKSESSHVTGIEIQEEVAEMAQRSVKLNG- 93

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
             +  RI ++ +D+    +      L  N +D V  NPP+    G    +  K  +   +
Sbjct: 94  --LECRIDILPMDLKEAPQ-----VLPVNSFDVVTSNPPYMHGQGLKNQEDKKTISRHEV 146

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASR 179
           + + E  IRTA  +++  G+L LI RPQ ++ I+  C + ++   ++  +H    +  + 
Sbjct: 147 KCNLEDVIRTASKLLKQHGKLFLIHRPQRIVDILVFCRQYKLEPKQLRLIHSTYDKKPNL 206

Query: 180 ILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRF 211
           +L+  +K    +L+F  P+ ++   G+  S  
Sbjct: 207 MLLEAKKDANPELKFLDPLYVYDQEGKYTSEI 238


>gi|209542241|ref|YP_002274470.1| putative methyltransferase [Gluconacetobacter diazotrophicus PAl 5]
 gi|209529918|gb|ACI49855.1| putative methyltransferase [Gluconacetobacter diazotrophicus PAl 5]
          Length = 272

 Score = 59.3 bits (142), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 58/119 (48%), Gaps = 4/119 (3%)

Query: 91  YDHVIMNPPFNERIGTMTPDKIKEEAH-VMLEDSFEKWIRTACAIMRSSGQLSLIARPQS 149
           +DH   NPP++    + +PD  ++ A  V   D    WIR     +R  G L+L A P  
Sbjct: 139 FDHAFANPPWHHNAASASPDARRDLARRVGSPDMIALWIRALGRQVRHRGTLTL-ALPAG 197

Query: 150 LIQIVNACARR--IGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQ 206
           L+ +  A  R   IG++ + P  P+ G  A  +L+ GR G RG+      + LH+ +G 
Sbjct: 198 LLDMAVAAMRAHGIGAISLFPFWPKAGRAARIMLIQGRVGARGEAVLMPGMTLHRDDGS 256


>gi|125974592|ref|YP_001038502.1| methyltransferase small [Clostridium thermocellum ATCC 27405]
 gi|125714817|gb|ABN53309.1| methyltransferase small [Clostridium thermocellum ATCC 27405]
          Length = 251

 Score = 59.3 bits (142), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 49/219 (22%), Positives = 103/219 (47%), Gaps = 15/219 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+  +      + DLG G G   + +A +     I+  E    MA  A++++ L   
Sbjct: 35  VLLANFADIKKGDTVIDLGTGTGIIAILIAGKTEAKSIIGLEIQEEMAEMAQRSVKL--- 91

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF-NERIGTMTPDKIKEEAHVM 119
             +  R+ ++  D+       ++     + +D V+ NPP+ N+  G +     K  +   
Sbjct: 92  NNLEDRVKIVCGDI-----KNSVEMFGASKFDVVVTNPPYMNQGGGLLNISDTKAISRHE 146

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE---ITPLHPREGEC 176
           ++ + E  I+ +  ++   GQ +++ RP  L+ I+     R  S+E   +  +HP   + 
Sbjct: 147 IKCTLEDVIKASSKLLVPGGQFAMVHRPDRLVDII--WLMRKYSIEPKYLQFVHPYPRKK 204

Query: 177 ASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDL 215
           A+ IL+ G +  R QL+   P+ ++  NG  YS+ + ++
Sbjct: 205 ANLILIKGARQGRVQLKMLEPLYVYDENGN-YSKEIDNI 242


>gi|256004046|ref|ZP_05429031.1| methyltransferase small [Clostridium thermocellum DSM 2360]
 gi|281419117|ref|ZP_06250134.1| Methyltransferase type 11 [Clostridium thermocellum JW20]
 gi|255991969|gb|EEU02066.1| methyltransferase small [Clostridium thermocellum DSM 2360]
 gi|281407266|gb|EFB37527.1| Methyltransferase type 11 [Clostridium thermocellum JW20]
 gi|316941710|gb|ADU75744.1| Methyltransferase type 11 [Clostridium thermocellum DSM 1313]
          Length = 254

 Score = 59.3 bits (142), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 51/223 (22%), Positives = 104/223 (46%), Gaps = 23/223 (10%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+  +      + DLG G G   + +A +     I+  E    MA  A++++ L   
Sbjct: 38  VLLANFADIKKGDTVIDLGTGTGIIAILIAGKTEAKSIIGLEIQEEMAEMAQRSVKL--- 94

Query: 61  AQISKRISLIEVD----VTLVGENRNLAGLKNNFYDHVIMNPPF-NERIGTMTPDKIKEE 115
             +  R+ ++  D    V + G ++         +D V+ NPP+ N+  G +     K  
Sbjct: 95  NNLEDRVKIVCGDIKNSVEMFGASK---------FDVVVTNPPYMNQGGGLLNISDTKAI 145

Query: 116 AHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE---ITPLHPR 172
           +   ++ + E  I+ +  ++   GQ +++ RP  L+ I+     R  S+E   +  +HP 
Sbjct: 146 SRHEIKCTLEDVIKASSKLLVPGGQFAMVHRPDRLVDII--WLMRKYSIEPKYLQFVHPY 203

Query: 173 EGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDL 215
             + A+ IL+ G +  R QL+   P+ ++  NG  YS+ + ++
Sbjct: 204 PRKKANLILIKGARQGRVQLKMLEPLYVYDENGN-YSKEIDNI 245


>gi|255657495|ref|ZP_05402904.1| hypothetical protein CdifQCD-2_17756 [Clostridium difficile
           QCD-23m63]
 gi|296449091|ref|ZP_06890881.1| SAM-dependent methyltransferase [Clostridium difficile NAP08]
 gi|296879914|ref|ZP_06903887.1| SAM-dependent methyltransferase [Clostridium difficile NAP07]
 gi|296262184|gb|EFH08989.1| SAM-dependent methyltransferase [Clostridium difficile NAP08]
 gi|296429203|gb|EFH15077.1| SAM-dependent methyltransferase [Clostridium difficile NAP07]
          Length = 248

 Score = 59.3 bits (142), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 49/220 (22%), Positives = 99/220 (45%), Gaps = 10/220 (4%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+         + DLG G G   + +A +    +I+  E    +   A +++ L   
Sbjct: 33  VLLANFTKIKKDAKVVDLGTGTGIIPILIAGKSEAKKIIGVEIQEDVYEMATRSVKLNG- 91

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
             + +R+ +I  D+  + +  ++ G     Y  V  NPP+    G   P+  K  +   +
Sbjct: 92  --LEERVEIINEDIKYIDKVLDVNG-----YHVVTSNPPYMHIDGIKNPNDKKAISRHEV 144

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASR 179
             + E  IR A  ++ S G+  +I RP  L+ I+    + R+    I  +HPR  +  + 
Sbjct: 145 RCNLEDVIRAASRLVMSRGKFLMIHRPTRLVDIITLGRKYRLEPKVIQFVHPRPQKAPNL 204

Query: 180 ILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
           +LV   K  R +L+   P+ ++  +G  Y++ +  + N +
Sbjct: 205 VLVQFVKDGRPELKILDPLYVYGEDGN-YTKELKAIYNNE 243


>gi|313890747|ref|ZP_07824372.1| methyltransferase small domain protein [Streptococcus
           pseudoporcinus SPIN 20026]
 gi|313120848|gb|EFR43962.1| methyltransferase small domain protein [Streptococcus
           pseudoporcinus SPIN 20026]
          Length = 249

 Score = 58.9 bits (141), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 49/198 (24%), Positives = 103/198 (52%), Gaps = 17/198 (8%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G GA GL  ASR   AQI+  E    +A  A++++ L    Q+ +++S+I  D+
Sbjct: 50  IVDLCSGNGAVGL-FASRNTNAQIVEIEIQERLAEMAQRSIKL---NQLEEQVSMICDDL 105

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAI 134
             +  +   +G+     D ++ NPP+ +   T +  K   E +++        +   C+I
Sbjct: 106 KHLLNHVPRSGV-----DLILCNPPYFK--STESSKKNMSEHYLLARHEITTNLEEICSI 158

Query: 135 ----MRSSGQLSLIARPQSLIQIVNACARR-IGSLEITPLHPREGECASRILVTG-RKGM 188
               ++S+G+L+++ RP   I+IV++  +  +    I  ++P+ G+ A+ +L+   + G 
Sbjct: 159 SRHGLKSNGRLAMVHRPDRFIEIVDSLRKYGLAPKRIQFVYPKAGKEANMLLIEAIKDGS 218

Query: 189 RGQLRFRYPIVLHKPNGQ 206
              ++   P+++H+ NG 
Sbjct: 219 IEGMKILPPLIVHEENGD 236


>gi|55821542|ref|YP_139984.1| hypothetical protein stu1566 [Streptococcus thermophilus LMG 18311]
 gi|55823470|ref|YP_141911.1| hypothetical protein str1566 [Streptococcus thermophilus CNRZ1066]
 gi|55737527|gb|AAV61169.1| conserved hypothetical protein [Streptococcus thermophilus LMG
           18311]
 gi|55739455|gb|AAV63096.1| conserved hypothetical protein [Streptococcus thermophilus
           CNRZ1066]
          Length = 254

 Score = 58.9 bits (141), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 49/221 (22%), Positives = 104/221 (47%), Gaps = 34/221 (15%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G GA GL  ++R  EA I+L E    +A  A++++ L    Q+  +++++  D+
Sbjct: 50  IVDLCSGNGAVGLFASTRT-EAPIILVELQERLADMAKRSVTL---NQLEDQVTVVNDDL 105

Query: 75  TLVGENRNLAGLKNNFYDH--------VIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEK 126
                         N  DH        ++ NPP+ +   T T  K   E +++       
Sbjct: 106 -------------KNLLDHAPRSQVDLILCNPPYFK--ATETSKKNLSEHYLLARHEITT 150

Query: 127 WIRTACAI----MRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRIL 181
            +   C +    ++S+G+++++ RP   + I++   +  +    I  ++P+ G  A+ +L
Sbjct: 151 NLEEICQVARHALKSNGRIAVVHRPDRFLDIIDTMRQYNLAPKRIQFIYPKVGREANMLL 210

Query: 182 VTG-RKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRS 221
           +   + G    L+   P+ +HK NG  Y+  + ++  GK++
Sbjct: 211 IEAIKDGSTDGLKILPPLFVHKENGD-YTDEIFEIYFGKKT 250


>gi|116871566|ref|YP_848347.1| methyltransferase small domain-containing protein [Listeria
           welshimeri serovar 6b str. SLCC5334]
 gi|116740444|emb|CAK19564.1| methyltransferase small domain protein [Listeria welshimeri serovar
           6b str. SLCC5334]
          Length = 250

 Score = 58.9 bits (141), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 105/212 (49%), Gaps = 21/212 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G G   L +++R  EAQI+  E    +A  A++++A     Q+  +I ++E D+
Sbjct: 51  IIDLCSGNGIIPLLLSTR-TEAQIVGVEIQERLADMAKRSVAY---NQLEDQIEIMEYDL 106

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDK------IKEEAHVMLEDSFEKWI 128
                N+    +     D V  NPP+     T   ++       + E    LED+    I
Sbjct: 107 -----NKITDLIPKERADIVTCNPPYFATPATSLKNENEHYRIARHEIMCTLEDT----I 157

Query: 129 RTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRKG 187
           R A ++++  G+ + + RP+ L+ I++   + R+    I  +HPR    A+ +LV G K 
Sbjct: 158 RVAASLLKQGGKANFVHRPERLLDIIDLMRKYRLEPKRIQLVHPRIDREANTVLVEGIKD 217

Query: 188 MRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
            +  +++  P++++   G+ Y+  + +++ G+
Sbjct: 218 GKPGVKYVPPVIVYDELGE-YTPVIKEILYGE 248


>gi|312864588|ref|ZP_07724819.1| GIY-YIG catalytic domain protein [Streptococcus downei F0415]
 gi|311099715|gb|EFQ57928.1| GIY-YIG catalytic domain protein [Streptococcus downei F0415]
          Length = 335

 Score = 58.9 bits (141), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 48/210 (22%), Positives = 106/210 (50%), Gaps = 18/210 (8%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G GA GL  AS   +A+I+  E    +A   ++++ L     +S+++++I  D+
Sbjct: 50  IVDLCSGNGAVGL-FASTKTKAKIMEVELQERLADMGQRSIELNG---LSEQVTMINDDL 105

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAI 134
             + ++   + +     D ++ NPP+ +   T T  K   + +++        +   C +
Sbjct: 106 KNLMDHTPRSKV-----DLILCNPPYFK--ATKTSKKNASQHYLLARHEIATNLEEICQV 158

Query: 135 ----MRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTG-RKGM 188
               +++ G+L+L+ RP   ++I++   + ++    +  ++P+  + A+ ILV   + G 
Sbjct: 159 SQQALKTKGRLALVHRPDRFLEILDTLKKYKLAPKRVQFVYPKADKEANMILVEAIKDGS 218

Query: 189 RGQLRFRYPIVLHKPNGQPYSRFVTDLING 218
              L+   P+V+HKPNG  Y+  + D+  G
Sbjct: 219 PDGLKILPPLVVHKPNGD-YTDAIHDIYFG 247


>gi|325295295|ref|YP_004281809.1| methyltransferase small [Desulfurobacterium thermolithotrophum DSM
           11699]
 gi|325065743|gb|ADY73750.1| methyltransferase small [Desulfurobacterium thermolithotrophum DSM
           11699]
          Length = 249

 Score = 58.9 bits (141), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 52/209 (24%), Positives = 93/209 (44%), Gaps = 20/209 (9%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
            +LA  V   G+  + DLG G G              ILL ++ P +  +A     L  N
Sbjct: 34  FLLADFVKVKGTEKIIDLGTGCGVI-----------PILLLKKYPQLKAFA--IDVLEEN 80

Query: 61  AQISKRISLIE-VDVTLVGENRNLAGLKNNF----YDHVIMNPPFNER-IGTMTPDKIKE 114
             ISK+   I  V       + N+  +K  F    +D VI NPPF E   G ++    + 
Sbjct: 81  INISKKNGEINGVSERFTALHLNVKEVKKVFKSGEFDIVITNPPFIEVGRGNLSQKDHRA 140

Query: 115 EAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPRE 173
            A   L  S E +I+ A  ++++ G+L ++   Q  + ++    + ++    +  +HP  
Sbjct: 141 IARQELTASLEDFIKAASYLLKNKGKLYILLPVQRFVDVIFLTRKYKVEPKRLRIIHPEA 200

Query: 174 GECASRILVTGRKGMRGQLRFRYPIVLHK 202
            + A+  L+ GRKG    +   +P++++K
Sbjct: 201 EKEANLFLLEGRKGGGKGISIEFPLIVYK 229


>gi|126701171|ref|YP_001090068.1| hypothetical protein CD3547 [Clostridium difficile 630]
 gi|255308578|ref|ZP_05352749.1| hypothetical protein CdifA_18451 [Clostridium difficile ATCC 43255]
 gi|115252608|emb|CAJ70451.1| putative methyltransferase [Clostridium difficile]
          Length = 248

 Score = 58.9 bits (141), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 48/220 (21%), Positives = 98/220 (44%), Gaps = 10/220 (4%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+         + DLG G G   + +A +    +I+  E    +   A +++ L   
Sbjct: 33  VLLANFTKIKKDAKVVDLGTGTGIIPILIAGKSEAKKIIGVEIQEDVYEMATRSIKLNG- 91

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
             + +R+ +I  D+  + +  ++ G     Y  V  NPP+    G   P+  K  +   +
Sbjct: 92  --LEERVEIINEDIKYIDKVLDING-----YHVVTSNPPYMHIDGIKNPNDKKAISRHEV 144

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASR 179
             + E  IR A  ++   G+  +I RP  L+ I+    + ++    I  +HPR  +  + 
Sbjct: 145 RCNLEDVIRAASRLVMPRGKFFMIHRPTRLVDIITLGRKYKLEPKVIQFVHPRPQKAPNL 204

Query: 180 ILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
           +LV   K  R +L+   P+ ++  +G  Y++ +  + N K
Sbjct: 205 VLVQFVKDGRPELKILDPLYVYGEDGN-YTKELKAIYNNK 243


>gi|228477190|ref|ZP_04061828.1| methyltransferase [Streptococcus salivarius SK126]
 gi|228251209|gb|EEK10380.1| methyltransferase [Streptococcus salivarius SK126]
          Length = 254

 Score = 58.9 bits (141), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 50/221 (22%), Positives = 103/221 (46%), Gaps = 34/221 (15%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G GA GL  ++R  EA I L E    +A  A++++ L    Q+  ++S++  D+
Sbjct: 50  IVDLCSGNGAVGLFASTRT-EAPITLVELQERLADMAKRSVTL---NQLEDQVSVVNDDL 105

Query: 75  TLVGENRNLAGLKNNFYDH--------VIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEK 126
                         N  DH        ++ NPP+ +   T T  K   E +++       
Sbjct: 106 -------------KNLLDHAPRSQVDLILCNPPYFK--ATETSKKNLSEHYLLARHEITT 150

Query: 127 WIRTACAI----MRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRIL 181
            +   C +    ++S+G+++++ RP   + I++   +  +    I  ++P+ G  A+ +L
Sbjct: 151 NLEEICQVARHALKSNGRIAMVHRPDRFLDIIDTMRQYNLAPKRIQFIYPKMGREANMLL 210

Query: 182 VTG-RKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRS 221
           +   + G    L+   P+ +HK NG  Y+  + ++  GK++
Sbjct: 211 IEAIKDGSTDGLKILPPLFVHKENGD-YTDEIFEIYFGKKA 250


>gi|283797151|ref|ZP_06346304.1| putative N-6 adenine-specific DNA methylase [Clostridium sp. M62/1]
 gi|291075568|gb|EFE12932.1| putative N-6 adenine-specific DNA methylase [Clostridium sp. M62/1]
          Length = 250

 Score = 58.9 bits (141), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 45/191 (23%), Positives = 87/191 (45%), Gaps = 10/191 (5%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DLG G G   + + ++   +     E    MA  AR+++ L     +  +I ++  D+  
Sbjct: 56  DLGTGTGIIPILLEAKTEGSYFAGLEIQENMAEMARRSVWLNG---LEGKIEIVTGDIKE 112

Query: 77  VGENRNLAGLKNNFYDHVIMNPPF-NERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIM 135
            G     A      +D V  NPP+ N+  G   PD  K  A   +  + E  +R    ++
Sbjct: 113 AGRIFGAAS-----FDVVTSNPPYMNDSHGLKNPDLPKAIARHEVLCTLEDVVREGAKVL 167

Query: 136 RSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRKGMRGQLRF 194
           R  G+  ++ RP  LI+I+ A  + ++    +  +HP   + A+ +L+   KG R  ++ 
Sbjct: 168 RPGGRFYMVHRPHRLIEIITAFTKYKLEPKRMKLVHPFVDKDANMVLIEAVKGGRSMIKV 227

Query: 195 RYPIVLHKPNG 205
             P+++++  G
Sbjct: 228 EKPLIVYREPG 238


>gi|126652964|ref|ZP_01725106.1| YabB [Bacillus sp. B14905]
 gi|126590294|gb|EAZ84416.1| YabB [Bacillus sp. B14905]
          Length = 249

 Score = 58.9 bits (141), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 53/212 (25%), Positives = 101/212 (47%), Gaps = 17/212 (8%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G G   L +++R   AQI   E  P +   A +++      Q+  +I +I  DV
Sbjct: 50  IVDLCSGNGVIPLFLSARTR-AQITGVELQPRLLDMAERSVRY---NQLENQIQMILGDV 105

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVM----LEDSFEKWIRT 130
             + +   +       YD V  NPP+   +     DK   E H +    L  + E+ I++
Sbjct: 106 KEIPKQLGIEK-----YDVVTCNPPY--FLAHEASDKNLSEHHAIARHELYLTLEEAIQS 158

Query: 131 ACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTGRKGMR 189
           A  +++  G+ + + RP  L+ IV A  A R+    +  ++P+EG+ A+ +L+ G K  +
Sbjct: 159 ASKLLKQGGKAAFVHRPGRLLDIVTAMRANRLEPKRMQLIYPKEGKEANTLLIEGIKDGK 218

Query: 190 GQLRFRYPIVLHKPNGQPYSRFVTDLINGKRS 221
             L+   P+ ++    + Y+  V +++ GK  
Sbjct: 219 PDLKILPPLYVYNEKNE-YTAEVREILYGKEQ 249


>gi|47096983|ref|ZP_00234558.1| conserved hypothetical protein [Listeria monocytogenes str. 1/2a
           F6854]
 gi|254899511|ref|ZP_05259435.1| methyltransferase small domain protein [Listeria monocytogenes
           J0161]
 gi|254913286|ref|ZP_05263298.1| conserved hypothetical protein [Listeria monocytogenes J2818]
 gi|254937667|ref|ZP_05269364.1| conserved hypothetical protein [Listeria monocytogenes F6900]
 gi|47014646|gb|EAL05604.1| conserved hypothetical protein [Listeria monocytogenes str. 1/2a
           F6854]
 gi|258610267|gb|EEW22875.1| conserved hypothetical protein [Listeria monocytogenes F6900]
 gi|293591287|gb|EFF99621.1| conserved hypothetical protein [Listeria monocytogenes J2818]
          Length = 250

 Score = 58.9 bits (141), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 52/218 (23%), Positives = 107/218 (49%), Gaps = 33/218 (15%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G G   L +++R  +A+I+  E    +A  A+++++     Q+ ++I +IE D+
Sbjct: 51  IIDLCSGNGIIPLLLSTRT-KAKIVGVEIQERLADMAKRSISY---NQLEEQIEMIEYDL 106

Query: 75  TLVGENRNLAGL-KNNFYDHVIMNPPFNERIGTMTPDK-----------IKEEAHVMLED 122
                 +N+  L      D V  NPP+       TPD             + E    LED
Sbjct: 107 ------KNITDLIPKERADIVTCNPPY-----FATPDTSLKNTNEHFRIARHEVMCTLED 155

Query: 123 SFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRIL 181
           +    IR A ++++  G+ + + RP+ L+ I++   + R+    I  +HPR    A+ +L
Sbjct: 156 T----IRVAASLLKQGGKANFVHRPERLLDIIDIMRKYRLEPKRIQFVHPRSDREANTVL 211

Query: 182 VTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
           V G K  +  +++  P++++   G+ Y+  + +++ G+
Sbjct: 212 VEGIKDGKPGVKYVPPVIVYDELGE-YTPVIKEILYGE 248


>gi|332982765|ref|YP_004464206.1| RNA methylase [Mahella australiensis 50-1 BON]
 gi|332700443|gb|AEE97384.1| RNA methylase [Mahella australiensis 50-1 BON]
          Length = 252

 Score = 58.9 bits (141), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 49/209 (23%), Positives = 98/209 (46%), Gaps = 14/209 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+         +ADLG G+G   L ++ +   ++I   E    MA  A++++ L   
Sbjct: 35  VLLANFARIKPGDIVADLGTGSGVIPLLLSCKTAASKIYGLEIQHEMADMAQRSVRL--- 91

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNER-IGTMTPDKIKEEAHVM 119
             +  R+ +IE D+   G   ++ G+  +  D VI NPP+ +   G ++P   +  A   
Sbjct: 92  NDLESRVDIIEGDIRKAG---DIIGM--SLVDAVISNPPYRKAGSGHVSPSDARAIATYE 146

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE---ITPLHPREGEC 176
           LE + +  I+ A  ++++ G+  +I RP  L+  +  C  R   +E   +  + P   + 
Sbjct: 147 LECTLDDVIKAASTLLKNKGRFYMIQRPARLVDAI--CGMRKAGIEPKRLRMVQPFADKK 204

Query: 177 ASRILVTGRKGMRGQLRFRYPIVLHKPNG 205
            +  L+   KG +  +    P+V++   G
Sbjct: 205 PTMFLIESIKGAQPHMDIMPPLVIYDAKG 233


>gi|238915995|ref|YP_002929512.1| hypothetical protein EUBELI_00028 [Eubacterium eligens ATCC 27750]
 gi|238871355|gb|ACR71065.1| Hypothetical protein EUBELI_00028 [Eubacterium eligens ATCC 27750]
          Length = 239

 Score = 58.5 bits (140), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 51/211 (24%), Positives = 96/211 (45%), Gaps = 18/211 (8%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++L++   A     + D+G G G   + + S+   +     E     A  AR+ + L   
Sbjct: 30  VLLSTYAMAGKKDRVLDMGTGNGIIPVLMQSKNPGSTYSALEIQEGSAQLARRNVEL--- 86

Query: 61  AQISKRISLIEVDV----TLVGENRNLAGLKNNFYDHVIMNPPF-NERIGTMTPDKIKEE 115
             +  RIS+++ D+    T+ GE           ++ V  NPP+ NE  G + PD  K  
Sbjct: 87  NHLEDRISVVKGDIKEASTIFGEAS---------FNVVTSNPPYMNENHGIVNPDSAKAI 137

Query: 116 AHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREG 174
           A   L  S +  IR A   ++S G++ ++ RP  L+ I +   +  +    +  ++P   
Sbjct: 138 ARHELLCSLDDVIREASRCLKSKGKMYMVHRPNRLVDIFDTMRKYHLEPKRMRLVYPYVN 197

Query: 175 ECASRILVTGRKGMRGQLRFRYPIVLHKPNG 205
           + A+ +L+   KG   QL    P++++K +G
Sbjct: 198 KAANMVLIEAVKGGNSQLIVEEPLIVYKTDG 228


>gi|323486486|ref|ZP_08091809.1| methyltransferase type 11 [Clostridium symbiosum WAL-14163]
 gi|323694373|ref|ZP_08108546.1| methyltransferase type 11 [Clostridium symbiosum WAL-14673]
 gi|323400189|gb|EGA92564.1| methyltransferase type 11 [Clostridium symbiosum WAL-14163]
 gi|323501613|gb|EGB17502.1| methyltransferase type 11 [Clostridium symbiosum WAL-14673]
          Length = 245

 Score = 58.5 bits (140), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 48/201 (23%), Positives = 91/201 (45%), Gaps = 11/201 (5%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DLG G G   + + ++         E    MA  A +++ L     +  RI +I  D+  
Sbjct: 51  DLGTGTGIIPILLEAKTKGEHFTGLEIQEEMADMASRSVELNG---LKDRIDIIRGDIKE 107

Query: 77  VGENRNLAGLKNNFYDHVIMNPPF-NERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIM 135
            G     A      +D V  NPP+ N+  G   PD+ K  A   +  + +  +R    ++
Sbjct: 108 AGLIFGGAS-----FDVVTTNPPYMNDCHGLKNPDEAKAIARHEVLCTLDDVVREGARVL 162

Query: 136 RSSGQLSLIARPQSLIQIVNA-CARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRF 194
           R  G+  ++ RP  LI+I+ A  A R+    +  +HP   + A+ +L+   +G R  ++ 
Sbjct: 163 RPGGRFYMVHRPHRLIEIITALTAYRLEPKRMKLVHPFVDKEANMVLIEAVRGGRSMIKV 222

Query: 195 RYPIVLHKPNGQPYSRFVTDL 215
             P+++++  G  Y+  + D+
Sbjct: 223 EKPLIVYREQGV-YTDEIYDI 242


>gi|116628253|ref|YP_820872.1| hypothetical protein STER_1524 [Streptococcus thermophilus LMD-9]
 gi|116101530|gb|ABJ66676.1| Predicted O-methyltransferase [Streptococcus thermophilus LMD-9]
          Length = 254

 Score = 58.5 bits (140), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 49/221 (22%), Positives = 103/221 (46%), Gaps = 34/221 (15%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G GA GL  ++R  EA I L E    +A  A++++ L    Q+  +++++  D+
Sbjct: 50  IVDLCSGNGAVGLFASTRT-EAPITLVELQERLADMAKRSVTL---NQLEDQVTVVNDDL 105

Query: 75  TLVGENRNLAGLKNNFYDH--------VIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEK 126
                         N  DH        ++ NPP+ +   T T  K   E +++       
Sbjct: 106 -------------KNLLDHAPRSQVDLILCNPPYFK--ATETSKKNLSEHYLLARHEITT 150

Query: 127 WIRTACAI----MRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRIL 181
            +   C +    ++S+G+++++ RP   + I++   +  +    I  ++P+ G  A+ +L
Sbjct: 151 NLEEICQVARHALKSNGRIAMVHRPDRFLDIIDTMRQYNLAPKRIQFIYPKMGREANMLL 210

Query: 182 VTG-RKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRS 221
           +   + G    L+   P+ +HK NG  Y+  + ++  GK++
Sbjct: 211 IEAIKDGSTDGLKILPPLFVHKENGD-YTDEIFEIYFGKKT 250


>gi|255102757|ref|ZP_05331734.1| hypothetical protein CdifQCD-6_18241 [Clostridium difficile
           QCD-63q42]
          Length = 248

 Score = 58.5 bits (140), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 48/220 (21%), Positives = 98/220 (44%), Gaps = 10/220 (4%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+         + DLG G G   + +A +    +I+  E    +   A +++ L   
Sbjct: 33  VLLANFTKIKKDAKVVDLGTGTGIIPILIAGKSEAKKIIGVEIQEDVYEMATRSIKLNG- 91

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
             + +R+ +I  D+  + +  ++ G     Y  V  NPP+    G   P+  K  +   +
Sbjct: 92  --LEERVEIINEDIKYIDKVLDING-----YHVVTSNPPYMHIDGIKNPNDKKAISRHEV 144

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASR 179
             + E  IR A  ++   G+  +I RP  L+ I+    + ++    I  +HPR  +  + 
Sbjct: 145 RCNLEDVIRAAYRLVMPRGKFFMIHRPTRLVDIITLGRKYKLEPKVIQFVHPRPQKAPNL 204

Query: 180 ILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
           +LV   K  R +L+   P+ ++  +G  Y++ +  + N K
Sbjct: 205 VLVQFVKDGRPELKILDPLYVYGEDGN-YTKELKAIYNNK 243


>gi|164688849|ref|ZP_02212877.1| hypothetical protein CLOBAR_02497 [Clostridium bartlettii DSM
           16795]
 gi|164602053|gb|EDQ95518.1| hypothetical protein CLOBAR_02497 [Clostridium bartlettii DSM
           16795]
          Length = 249

 Score = 58.5 bits (140), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 44/206 (21%), Positives = 91/206 (44%), Gaps = 9/206 (4%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+      +  + DLG G G   + +A +   ++I+  E    +   A +++ L   
Sbjct: 35  VLLANFAKVKNNAKVVDLGTGTGIIPILIAGKSKASKIIGVEIQEEVYEMATRSVKL--- 91

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
             +  R+ +I  D+  + +   + G     Y     NPP+    G   P+  K  +   +
Sbjct: 92  NDLEDRVEIINADIKTIDKELEVHG-----YHVATSNPPYMHMDGIKNPNDKKAISRHEI 146

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASR 179
             + E  IR A  ++   G+  +I RP  L+ I+    + R+    +  +HP+ G+  + 
Sbjct: 147 MCNLEDVIRAASRLVMPRGKFFMIHRPTRLVDIIELGRKYRLEPKVVQFIHPKVGKAPNL 206

Query: 180 ILVTGRKGMRGQLRFRYPIVLHKPNG 205
           +LV   K  R +L+   P+ ++  +G
Sbjct: 207 MLVEFTKDGRPELKILDPLYVYGDDG 232


>gi|315301031|ref|ZP_07872350.1| methyltransferase small domain-containing protein [Listeria
           ivanovii FSL F6-596]
 gi|313630597|gb|EFR98411.1| methyltransferase small domain-containing protein [Listeria
           ivanovii FSL F6-596]
          Length = 257

 Score = 58.2 bits (139), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 49/212 (23%), Positives = 104/212 (49%), Gaps = 21/212 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G G   L +++R  EAQI+  E  P +A  A++++      ++  +I ++E D+
Sbjct: 58  IIDLCSGNGIIPLLLSTR-TEAQIIGVEIQPRLADMAKRSVVY---NELESQIEMMEYDL 113

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDK------IKEEAHVMLEDSFEKWI 128
             + +      +     D V  NPP+     T   ++       + E    LED+    I
Sbjct: 114 KKITDI-----IPKERADIVTCNPPYFAGPATSLKNENEHYRIARHEVMCTLEDT----I 164

Query: 129 RTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRKG 187
           R A  +++  G+ + + RP+ L+ I++   + R+    I  +HPR    A+ +LV G K 
Sbjct: 165 RVASNLLKQGGKANFVHRPERLLDILDLMRKYRLEPKRIQMVHPRLDREANTVLVEGIKD 224

Query: 188 MRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
            +  +++  P++++   G+ Y+  + +++ G+
Sbjct: 225 GKPGVKYIPPVIVYDETGE-YTPVIKEILYGE 255


>gi|289433519|ref|YP_003463391.1| hypothetical protein lse_0148 [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|289169763|emb|CBH26299.1| conserved hypothetical protein [Listeria seeligeri serovar 1/2b
           str. SLCC3954]
          Length = 257

 Score = 58.2 bits (139), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 50/212 (23%), Positives = 104/212 (49%), Gaps = 21/212 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G G   L +++R  EAQI+  E  P +A  A++++      ++  +I +IE D+
Sbjct: 58  IIDLCSGNGIIPLLLSTRT-EAQIVGVEIQPRLADMAKRSVVY---NELESQIEMIEHDL 113

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDK------IKEEAHVMLEDSFEKWI 128
             + +      +     D V  NPP+     T   ++       + E    LED+    I
Sbjct: 114 KKITDI-----IPKERADIVTCNPPYFAGPATSLKNENEHYRIARHEVMCTLEDT----I 164

Query: 129 RTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRKG 187
           R A  +++  G+ + + RP+ L+ I++   + R+    I  +HPR    A+ +LV G K 
Sbjct: 165 RVASNLLKQGGKANFVHRPERLLDILDLMRKYRLEPKRIQMVHPRLDREANTVLVEGIKD 224

Query: 188 MRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
            +  +++  P++++   G+ Y+  + +++ G+
Sbjct: 225 GKPGVKYIPPVIVYDETGE-YTPVIKEILYGE 255


>gi|313639878|gb|EFS04585.1| methyltransferase small domain-containing protein [Listeria
           seeligeri FSL S4-171]
          Length = 250

 Score = 58.2 bits (139), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 50/212 (23%), Positives = 104/212 (49%), Gaps = 21/212 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G G   L +++R  EAQI+  E  P +A  A++++      ++  +I +IE D+
Sbjct: 51  IIDLCSGNGIIPLLLSTRT-EAQIVGVEIQPRLADMAKRSVVY---NELESQIEIIEHDL 106

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDK------IKEEAHVMLEDSFEKWI 128
             + +      +     D V  NPP+     T   ++       + E    LED+    I
Sbjct: 107 KKITDI-----IPKERADIVTCNPPYFAGPATSLKNENEHYRIARHEVMCTLEDT----I 157

Query: 129 RTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRKG 187
           R A  +++  G+ + + RP+ L+ I++   + R+    I  +HPR    A+ +LV G K 
Sbjct: 158 RVASNLLKQGGKANFVHRPERLLDILDLMRKYRLEPKRIQMVHPRVDREANTVLVEGIKD 217

Query: 188 MRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
            +  +++  P++++   G+ Y+  + +++ G+
Sbjct: 218 GKPGVKYMPPVIVYDEAGE-YTPVIKEILYGE 248


>gi|302873026|ref|YP_003841659.1| methyltransferase small [Clostridium cellulovorans 743B]
 gi|307688819|ref|ZP_07631265.1| methyltransferase small [Clostridium cellulovorans 743B]
 gi|302575883|gb|ADL49895.1| methyltransferase small [Clostridium cellulovorans 743B]
          Length = 244

 Score = 58.2 bits (139), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 53/220 (24%), Positives = 102/220 (46%), Gaps = 17/220 (7%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+  N   S  + DL  G G     +A +     I+  E        A +T+     
Sbjct: 34  VLLANFANVKRSHRVIDLCTGTGIIPFILAGKTESNSIVGIEIQDEFVEMADRTVEY--- 90

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKN-NFYDHVIMNPPFN-ERIGTMTPDKIKEEAHV 118
            ++ +R+S    D+      ++LA LK     D V +NPP+  +  G + P+     A  
Sbjct: 91  NKLQERVSFHCRDL------KDLAFLKTLGLVDVVTVNPPYKLQNSGLINPNDKNAIARH 144

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE---ITPLHPREGE 175
            +  + E  I  + A+++ +G+L ++ RP  L  I   C  R  ++E   +  +HP  G+
Sbjct: 145 EILCTLEDVIIASKAVLKDNGRLYMVHRPDRLADIF--CLMRKHNIEPKRVRMVHPSVGK 202

Query: 176 CASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDL 215
             + +LV G+K     L++  P+ +H+ +G  Y+R + ++
Sbjct: 203 APNIVLVEGQKFGGAFLKWDTPLYVHEEDGS-YTREIDEI 241


>gi|313611411|gb|EFR86094.1| methyltransferase small domain-containing protein [Listeria
           monocytogenes FSL F2-208]
          Length = 250

 Score = 58.2 bits (139), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 52/218 (23%), Positives = 106/218 (48%), Gaps = 33/218 (15%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G G   L +++R  +A+I+  E    +A  A++++      Q+ ++I +IE D+
Sbjct: 51  IIDLCSGNGIIPLLLSTRT-KAKIVGVEIQERLADMAKRSILY---NQLEEQIEMIEYDL 106

Query: 75  TLVGENRNLAGL-KNNFYDHVIMNPPFNERIGTMTPDK-----------IKEEAHVMLED 122
                 +N+  L      D V  NPP+       TPD             + E    LED
Sbjct: 107 ------KNITDLIPKERADIVTCNPPY-----FATPDTSLKNTNEHFRIARHEVMCTLED 155

Query: 123 SFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRIL 181
           +    IR A ++++  G+ + + RP+ L+ I++   + R+    I  +HPR    A+ +L
Sbjct: 156 T----IRVAASLLKQGGKANFVHRPERLLDIIDIMRKYRLEPKRIQFVHPRSDREANTVL 211

Query: 182 VTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
           V G K  +  +++  P++++   G+ Y+  + +++ G+
Sbjct: 212 VEGIKDGKPGVKYVPPVIIYDELGE-YTPVIKEILYGE 248


>gi|46906401|ref|YP_012790.1| hypothetical protein LMOf2365_0180 [Listeria monocytogenes serotype
           4b str. F2365]
 gi|47092852|ref|ZP_00230635.1| conserved hypothetical protein [Listeria monocytogenes str. 4b
           H7858]
 gi|46879665|gb|AAT02967.1| conserved hypothetical protein [Listeria monocytogenes serotype 4b
           str. F2365]
 gi|47018756|gb|EAL09506.1| conserved hypothetical protein [Listeria monocytogenes str. 4b
           H7858]
 gi|332310577|gb|EGJ23672.1| hypothetical protein yabB [Listeria monocytogenes str. Scott A]
          Length = 253

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 51/217 (23%), Positives = 105/217 (48%), Gaps = 31/217 (14%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G G   L +++R  +A+I+  E    +A  A++++A     Q+  +I +IE D+
Sbjct: 54  IIDLCSGNGIIPLLLSTRT-KAKIVGVEIQERLADMAKRSVAY---NQLEDQIEIIEYDL 109

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDK-----------IKEEAHVMLEDS 123
             + +      +     D V  NPP+       TPD             + E    LED+
Sbjct: 110 KKITD-----LIPKERADIVTCNPPY-----FATPDTSLKNTNEHFRIARHEVMCTLEDT 159

Query: 124 FEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILV 182
               IR A ++++  G+ + + RP+ L+ I++   + R+    I  +HPR    A+ +LV
Sbjct: 160 ----IRVAASLLKQGGKANFVHRPERLLDIIDIMRKYRLEPKRIQFVHPRSDREANTVLV 215

Query: 183 TGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
            G K  +  +++  P++++   G+ Y+  + +++ G+
Sbjct: 216 EGIKDGKPGVKYVPPVIVYDELGE-YTPVIKEILYGE 251


>gi|312863126|ref|ZP_07723364.1| methyltransferase small domain protein [Streptococcus vestibularis
           F0396]
 gi|311100662|gb|EFQ58867.1| methyltransferase small domain protein [Streptococcus vestibularis
           F0396]
          Length = 254

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/214 (22%), Positives = 105/214 (49%), Gaps = 20/214 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G GA GL  ++R  EA I L E    +A  A++++ L    Q+  +++++  D+
Sbjct: 50  IVDLCSGNGAVGLFASTRT-EAPITLVELQERLADMAQRSVTL---NQLEDQVTVVNDDL 105

Query: 75  TLVGENRNLAG-LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACA 133
                 +NL      +  D ++ NPP+ +   T T  K   E +++        +   C 
Sbjct: 106 ------KNLLDHTPRSQVDLILCNPPYFK--ATETSKKNLSEHYLLARHEITTNLEEICQ 157

Query: 134 I----MRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTG-RKG 187
           +    ++S+G+++++ RP   + I++   +  +    I  ++P+ G  A+ +L+   + G
Sbjct: 158 VARHALKSNGRIAMVHRPDRFLDIIDTMRQYNLAPKRIQFIYPKMGREANMLLIEAIKDG 217

Query: 188 MRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRS 221
               L+   P+ +HK NG  Y+  + ++  GK++
Sbjct: 218 STDGLKILPPLFVHKKNGD-YTDEIFEIYFGKKT 250


>gi|315274482|ref|ZP_07869409.1| methyltransferase small domain-containing protein [Listeria marthii
           FSL S4-120]
 gi|313615883|gb|EFR89092.1| methyltransferase small domain-containing protein [Listeria marthii
           FSL S4-120]
          Length = 254

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 102/212 (48%), Gaps = 23/212 (10%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G G   L +++R  EA+I+  E  P +A  A +++       +  +I +IE D+
Sbjct: 58  IIDLCSGNGIIPLLLSTRT-EAKIVGVEIQPRLADMANRSILY---NHLEAQIEMIEYDL 113

Query: 75  TLVGENRNLAGL-KNNFYDHVIMNPPFNERIGTMTPDK------IKEEAHVMLEDSFEKW 127
                 +N+  L      D V  NPP+     T   +        + E    LED+    
Sbjct: 114 ------KNITDLIPKERADIVTCNPPYFATPNTSLKNTNEHFRIARHEVMCTLEDT---- 163

Query: 128 IRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRK 186
           IR A ++++  G+ + + RP+ L+ I++   + R+    I  +HPR    A+ +LV G K
Sbjct: 164 IRVAASLLKQGGKANFVHRPERLLDIIDLMRKYRLEPKRIQFVHPRLDREANTVLVEGIK 223

Query: 187 GMRGQLRFRYPIVLHKPNGQPYSRFVTDLING 218
             +  +++  P++++   G+ Y+  + +++ G
Sbjct: 224 DGKPGVKYVPPVIVYDEQGE-YTPVIKEILYG 254


>gi|289526956|pdb|3LPM|A Chain A, Crystal Structure Of Putative Methyltransferase Small
           Domain Protein From Listeria Monocytogenes
 gi|289526957|pdb|3LPM|B Chain B, Crystal Structure Of Putative Methyltransferase Small
           Domain Protein From Listeria Monocytogenes
          Length = 259

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 51/217 (23%), Positives = 105/217 (48%), Gaps = 31/217 (14%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G G   L +++R  +A+I+  E    +A  A++++A     Q+  +I +IE D+
Sbjct: 53  IIDLCSGNGIIPLLLSTRT-KAKIVGVEIQERLADXAKRSVAY---NQLEDQIEIIEYDL 108

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDK-----------IKEEAHVMLEDS 123
             + +      +     D V  NPP+       TPD             + E    LED+
Sbjct: 109 KKITD-----LIPKERADIVTCNPPY-----FATPDTSLKNTNEHFRIARHEVXCTLEDT 158

Query: 124 FEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILV 182
               IR A ++++  G+ + + RP+ L+ I++   + R+    I  +HPR    A+ +LV
Sbjct: 159 ----IRVAASLLKQGGKANFVHRPERLLDIIDIXRKYRLEPKRIQFVHPRSDREANTVLV 214

Query: 183 TGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
            G K  +  +++  P++++   G+ Y+  + +++ G+
Sbjct: 215 EGIKDGKPGVKYVPPVIVYDELGE-YTPVIKEILYGE 250


>gi|258611913|ref|ZP_05243061.2| conserved hypothetical protein [Listeria monocytogenes FSL R2-503]
 gi|293596357|ref|ZP_05230919.2| conserved hypothetical protein [Listeria monocytogenes FSL J1-194]
 gi|293596997|ref|ZP_05266367.2| conserved hypothetical protein [Listeria monocytogenes HPB2262]
 gi|300764912|ref|ZP_07074901.1| conserved hypothetical protein [Listeria monocytogenes FSL N1-017]
 gi|258607093|gb|EEW19701.1| conserved hypothetical protein [Listeria monocytogenes FSL R2-503]
 gi|293584566|gb|EFF96598.1| conserved hypothetical protein [Listeria monocytogenes HPB2262]
 gi|293595157|gb|EFG02918.1| conserved hypothetical protein [Listeria monocytogenes FSL J1-194]
 gi|300514399|gb|EFK41457.1| conserved hypothetical protein [Listeria monocytogenes FSL N1-017]
          Length = 250

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 51/217 (23%), Positives = 105/217 (48%), Gaps = 31/217 (14%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G G   L +++R  +A+I+  E    +A  A++++A     Q+  +I +IE D+
Sbjct: 51  IIDLCSGNGIIPLLLSTRT-KAKIVGVEIQERLADMAKRSVAY---NQLEDQIEIIEYDL 106

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDK-----------IKEEAHVMLEDS 123
             + +      +     D V  NPP+       TPD             + E    LED+
Sbjct: 107 KKITD-----LIPKERADIVTCNPPY-----FATPDTSLKNTNEHFRIARHEVMCTLEDT 156

Query: 124 FEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILV 182
               IR A ++++  G+ + + RP+ L+ I++   + R+    I  +HPR    A+ +LV
Sbjct: 157 ----IRVAASLLKQGGKANFVHRPERLLDIIDIMRKYRLEPKRIQFVHPRSDREANTVLV 212

Query: 183 TGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
            G K  +  +++  P++++   G+ Y+  + +++ G+
Sbjct: 213 EGIKDGKPGVKYVPPVIVYDELGE-YTPVIKEILYGE 248


>gi|226222798|ref|YP_002756905.1| hypothetical protein Lm4b_00166 [Listeria monocytogenes Clip81459]
 gi|255522070|ref|ZP_05389307.1| hypothetical protein LmonocFSL_12780 [Listeria monocytogenes FSL
           J1-175]
 gi|225875260|emb|CAS03957.1| unnamed protein product [Listeria monocytogenes serotype 4b str.
           CLIP 80459]
 gi|328468493|gb|EGF39499.1| hypothetical protein LM1816_04427 [Listeria monocytogenes 1816]
 gi|328469707|gb|EGF40629.1| hypothetical protein LM220_06347 [Listeria monocytogenes 220]
          Length = 257

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 51/217 (23%), Positives = 105/217 (48%), Gaps = 31/217 (14%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G G   L +++R  +A+I+  E    +A  A++++A     Q+  +I +IE D+
Sbjct: 58  IIDLCSGNGIIPLLLSTRT-KAKIVGVEIQERLADMAKRSVAY---NQLEDQIEIIEYDL 113

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDK-----------IKEEAHVMLEDS 123
             + +      +     D V  NPP+       TPD             + E    LED+
Sbjct: 114 KKITD-----LIPKERADIVTCNPPY-----FATPDTSLKNTNEHFRIARHEVMCTLEDT 163

Query: 124 FEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILV 182
               IR A ++++  G+ + + RP+ L+ I++   + R+    I  +HPR    A+ +LV
Sbjct: 164 ----IRVAASLLKQGGKANFVHRPERLLDIIDIMRKYRLEPKRIQFVHPRSDREANTVLV 219

Query: 183 TGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
            G K  +  +++  P++++   G+ Y+  + +++ G+
Sbjct: 220 EGIKDGKPGVKYVPPVIVYDELGE-YTPVIKEILYGE 255


>gi|157150028|ref|YP_001450884.1| DNA methyltransferase signature protein [Streptococcus gordonii
           str. Challis substr. CH1]
 gi|157074822|gb|ABV09505.1| DNA methyltransferase signature protein [Streptococcus gordonii
           str. Challis substr. CH1]
          Length = 260

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 105/212 (49%), Gaps = 22/212 (10%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL AG GA GL  AS   +A+I+  E    +A  A++++ L    Q+ +++ +I  D+
Sbjct: 62  IVDLCAGNGAVGL-FASAHTQAKIIAVEIQERLADMAQRSIQL---NQLDQQMQVIHDDL 117

Query: 75  TLVGENRNLAG-LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-----EDSFEKWI 128
                 +NL   +  +  D +  NPP+           + E  H +L       + E+  
Sbjct: 118 ------KNLPHYIPCSKVDMIFCNPPY---FKVDKHSNLNESEHYLLARHEISTNLEEIC 168

Query: 129 RTACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTG-RK 186
             A  +++S+G+L+++ RP   + I++   A  +    I  ++P+ G+ A+ +L+   + 
Sbjct: 169 TVAQRVLKSNGRLAMVHRPDRFLDILDTMKAHNLAPKRIQFVYPKMGKGANMLLIEAIKD 228

Query: 187 GMRGQLRFRYPIVLHKPNGQPYSRFVTDLING 218
           G R  L+   P++LH+ +G  Y+  + ++ +G
Sbjct: 229 GSRDGLKILPPLILHEEDGS-YTPEIYEIYHG 259


>gi|270290327|ref|ZP_06196552.1| methyltransferase [Pediococcus acidilactici 7_4]
 gi|304384854|ref|ZP_07367200.1| methyltransferase [Pediococcus acidilactici DSM 20284]
 gi|270281108|gb|EFA26941.1| methyltransferase [Pediococcus acidilactici 7_4]
 gi|304329048|gb|EFL96268.1| methyltransferase [Pediococcus acidilactici DSM 20284]
          Length = 250

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/216 (22%), Positives = 101/216 (46%), Gaps = 15/216 (6%)

Query: 7   VNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKR 66
           V  +    + DL AG GA GL ++ + +   + + E    +A  A +++ L    +  + 
Sbjct: 43  VKQSSKAQIVDLCAGNGAVGLFLSKKTN-GHVTMVEIQSRLAEMAERSILLNDLGERYRV 101

Query: 67  ISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF--NERIGTMTPDKIKEEAHVMLEDSF 124
           ++L   D        +L  +K +  D ++ NPP+  N       P++    A   +  S 
Sbjct: 102 LNLPLAD--------SLGTIKTDSVDSIVCNPPYFPNHPDSKKNPNQFLAIARHEITTSL 153

Query: 125 EKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVT 183
            + + T+  +++ +G+L ++ RP  L +I+N   + R+    I  +H  EG+ A+ +L+ 
Sbjct: 154 NEILETSQKMLKMNGKLFMVHRPDRLPEIINDFTQNRLAPKRIQFVHSHEGDEANMVLIE 213

Query: 184 G-RKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLING 218
             + G    +R   PI+ +  +G  YS  V +++ G
Sbjct: 214 AIKDGRPNGVRILPPIITY--DGLEYSPTVKEMLYG 247


>gi|290892275|ref|ZP_06555270.1| conserved hypothetical protein [Listeria monocytogenes FSL J2-071]
 gi|290558101|gb|EFD91620.1| conserved hypothetical protein [Listeria monocytogenes FSL J2-071]
          Length = 250

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 52/218 (23%), Positives = 106/218 (48%), Gaps = 33/218 (15%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G G   L +++R  +A+I+  E    +A  A++++      Q+ ++I +IE D+
Sbjct: 51  IIDLCSGNGIIPLLLSTRT-KAKIVGVEIQERLADMAKRSILY---NQLEEQIEMIEYDL 106

Query: 75  TLVGENRNLAGL-KNNFYDHVIMNPPFNERIGTMTPDK-----------IKEEAHVMLED 122
                 +N+  L      D V  NPP+       TPD             + E    LED
Sbjct: 107 ------KNITDLIPKERADIVTCNPPY-----FATPDTSLKNTNEHFRIARHEVMCTLED 155

Query: 123 SFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRIL 181
           +    IR A ++++  G+ + + RP+ L+ I++   + R+    I  +HPR    A+ +L
Sbjct: 156 T----IRVAASLLKQGGKANFVHRPERLLDIIDIMRKYRLEPKRIQFVHPRSDREANTVL 211

Query: 182 VTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
           V G K  +  +++  P++++   G+ Y+  + +++ G+
Sbjct: 212 VEGIKDGKPGVKYVPPVIVYDELGE-YTPVIKEILYGE 248


>gi|24379094|ref|NP_721049.1| hypothetical protein SMU.621c [Streptococcus mutans UA159]
 gi|24376995|gb|AAN58355.1|AE014906_1 conserved hypothetical protein [Streptococcus mutans UA159]
          Length = 339

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/211 (21%), Positives = 112/211 (53%), Gaps = 18/211 (8%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G GA GL  A+R  +A+I+  E    +A  A++++ L     ++ ++S+I  D+
Sbjct: 50  IVDLCSGNGAVGLFAATRT-KAKIIEVELQERLADMAQRSIQL---NDLTNQVSMIRDDL 105

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVM----LEDSFEKWIRT 130
             +     L  +  +  D ++ NPP+ +     T  K   E +++    +  + E+  + 
Sbjct: 106 KNL-----LDHVPRSKVDLILCNPPYFK--AAETSKKNLSEHYLLARHEIATNLEEICKI 158

Query: 131 ACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILV-TGRKGM 188
           +  +++++G+L+++ RP   ++I++   + ++    +  ++P+ G+ A+ +L+ T + G 
Sbjct: 159 SQQVLKTNGRLAMVHRPDRFLEIIDTFKKYKLAPKRLQFVYPKLGKDANMLLIETIKDGS 218

Query: 189 RGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
              ++   P+++HK NG  Y+  + ++  GK
Sbjct: 219 PNGMKILPPLIVHKDNGD-YTDNIHEIYFGK 248


>gi|84515722|ref|ZP_01003083.1| N-6 Adenine-specific DNA methylase [Loktanella vestfoldensis SKA53]
 gi|84510164|gb|EAQ06620.1| N-6 Adenine-specific DNA methylase [Loktanella vestfoldensis SKA53]
          Length = 255

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 87/188 (46%), Gaps = 14/188 (7%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+ + A     + +LG G G A L +  R+    +   E     A  AR+  A  AN
Sbjct: 35  VLLAASIAARAGQSVLELGCGVGTAALCLGRRVPGLALTGVEVQTEYADLARRNAA--AN 92

Query: 61  AQISKRISLIEVDVTLVGENRNL-AGLKNNFYDHVIMNPPFNER-IGTMTPDKIKEEAHV 118
                 + +I  D+      R L AGL+   +DHVIMNPP+ +R  GT   D  ++ A +
Sbjct: 93  ---DLPLEVITADL------RTLPAGLRQRRFDHVIMNPPYFDRDSGTAASDPGRDTA-L 142

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECAS 178
             +     W+      +   G L+LI R + L ++++A   R+GS+ + P+  R      
Sbjct: 143 GGDTPLADWLDIGARRLAPKGYLTLIQRIERLPEVLSALQGRLGSVVVLPIAGRTARAPG 202

Query: 179 RILVTGRK 186
             ++  R+
Sbjct: 203 LFILRARQ 210


>gi|217965745|ref|YP_002351423.1| methyltransferase small domain protein [Listeria monocytogenes
           HCC23]
 gi|217335015|gb|ACK40809.1| methyltransferase small domain protein [Listeria monocytogenes
           HCC23]
 gi|307569708|emb|CAR82887.1| conserved hypothetical protein [Listeria monocytogenes L99]
          Length = 250

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 52/218 (23%), Positives = 106/218 (48%), Gaps = 33/218 (15%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G G   L +++R  +A+I+  E    +A  A++++      Q+ ++I +IE D+
Sbjct: 51  IIDLCSGNGIIPLLLSTRT-KAKIVGVEIQERLADMAKRSILY---NQLEEQIEMIEYDL 106

Query: 75  TLVGENRNLAGL-KNNFYDHVIMNPPFNERIGTMTPDK-----------IKEEAHVMLED 122
                 +N+  L      D V  NPP+       TPD             + E    LED
Sbjct: 107 ------KNITDLIPKERADIVTCNPPY-----FATPDTSLKNTNEHFRIARHEVMCTLED 155

Query: 123 SFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRIL 181
           +    IR A ++++  G+ + + RP+ L+ I++   + R+    I  +HPR    A+ +L
Sbjct: 156 T----IRVAASLLKQGGKANFVHRPERLLDIIDIMRKYRLEPKRIQFVHPRSDREANTVL 211

Query: 182 VTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
           V G K  +  +++  P++++   G+ Y+  + +++ G+
Sbjct: 212 VEGIKDGKPGVKYVPPVIVYDELGE-YTPVIKEILYGE 248


>gi|254977171|ref|ZP_05273643.1| hypothetical protein CdifQC_17743 [Clostridium difficile QCD-66c26]
 gi|255094501|ref|ZP_05323979.1| hypothetical protein CdifC_17856 [Clostridium difficile CIP 107932]
 gi|255316252|ref|ZP_05357835.1| hypothetical protein CdifQCD-7_17939 [Clostridium difficile
           QCD-76w55]
 gi|255518913|ref|ZP_05386589.1| hypothetical protein CdifQCD-_17478 [Clostridium difficile
           QCD-97b34]
 gi|255652092|ref|ZP_05398994.1| hypothetical protein CdifQCD_18040 [Clostridium difficile
           QCD-37x79]
 gi|260685065|ref|YP_003216350.1| hypothetical protein CD196_3336 [Clostridium difficile CD196]
 gi|260688723|ref|YP_003219857.1| hypothetical protein CDR20291_3382 [Clostridium difficile R20291]
 gi|306521826|ref|ZP_07408173.1| hypothetical protein CdifQ_20455 [Clostridium difficile QCD-32g58]
 gi|260211228|emb|CBA66742.1| conserved hypothetical protein [Clostridium difficile CD196]
 gi|260214740|emb|CBE07425.1| conserved hypothetical protein [Clostridium difficile R20291]
          Length = 248

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/220 (21%), Positives = 98/220 (44%), Gaps = 10/220 (4%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+         + DLG G G   + +A +    +I+  E    +   A +++ L   
Sbjct: 33  VLLANFTKIKKDAKVVDLGTGTGIIPILIAGKSEAKKIIGVEIQEDVYEMATRSIKLNG- 91

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
             + +R+ +I  D+  + +  ++ G     Y  V  NPP+    G   P+  K  +   +
Sbjct: 92  --LEERVEIINEDIKYIDKVLDING-----YHVVTSNPPYMHIDGIKNPNDKKAISRHEV 144

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASR 179
             + E  IR +  ++   G+  +I RP  L+ I+    + ++    I  +HPR  +  + 
Sbjct: 145 RCNLEDVIRASSRLVMPRGKFFMIHRPTRLVDIITLGRKYKLEPKVIQFVHPRPQKAPNL 204

Query: 180 ILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
           +LV   K  R +L+   P+ ++  +G  Y++ +  + N K
Sbjct: 205 VLVQFVKDGRPELKILDPLYVYGEDGN-YTKELKAIYNNK 243


>gi|39995743|ref|NP_951694.1| hypothetical protein GSU0637 [Geobacter sulfurreducens PCA]
 gi|39982507|gb|AAR33967.1| conserved hypothetical protein [Geobacter sulfurreducens PCA]
 gi|298504754|gb|ADI83477.1| O-methyltransferase, putative [Geobacter sulfurreducens KN400]
          Length = 258

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 51/207 (24%), Positives = 99/207 (47%), Gaps = 19/207 (9%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DLG G+G   L +A R   +  +  E    MAH A + + L     +++RI+++  DV  
Sbjct: 52  DLGTGSGIIPLVLARRCPGSTFVGVEFQERMAHLAERNVHLNG---LAERIAILREDVL- 107

Query: 77  VGENRNLAGLKNNF----YDHVIMNPPFNER-IGTMTPDKIKEEAHVMLEDSFEKWIRTA 131
                   GL+  F    +D V+ NPP+  R  G ++P   +++A      +   ++ +A
Sbjct: 108 --------GLRRRFPVSSFDLVLSNPPYRRRGTGKISPRAGRDDARHESTATLADFLESA 159

Query: 132 CAIMRSSGQLSLIARPQSLIQIV-NACARRIGSLEITPLHPREGECASRILVTGRKGMRG 190
             +++++G++  I  P  L +++ +A + ++  L +  +H      A   +V   KG RG
Sbjct: 160 KYLVKTTGRICFIYHPARLPELMAHAASLKLACLRLRLVHGTRTAPARMAMVEFAKGRRG 219

Query: 191 QLRFRYPIVLHKPNGQPYSRFVTDLIN 217
            L    P+V+ + +   YS  V +L+ 
Sbjct: 220 DLEVLPPLVV-RNDDYTYSAEVAELLG 245


>gi|313625539|gb|EFR95250.1| methyltransferase small domain-containing protein [Listeria innocua
           FSL J1-023]
          Length = 257

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/212 (23%), Positives = 106/212 (50%), Gaps = 21/212 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G G   L +++R  +AQI+  E    +A  A++++A     Q++ +I +IE D+
Sbjct: 58  IIDLCSGNGIIPLLLSTRT-KAQIVGVEIQERLADMAKRSVAY---NQLADQIEIIEYDL 113

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDK------IKEEAHVMLEDSFEKWI 128
             + +      +     D V  NPP+     T   ++       + E    LED+    I
Sbjct: 114 NHITD-----LIPKERADIVTCNPPYFATPSTSLKNENEHYRIARHEIMCTLEDT----I 164

Query: 129 RTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRKG 187
           R A ++++  G+ + + RP+ L+ I++   + R+    I  +HPR    A+ +LV G K 
Sbjct: 165 RVAASLLKQGGKANFVHRPERLLDIIDLMRKYRLEPKRIQFVHPRIDREANTVLVEGIKD 224

Query: 188 MRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
            +  +++  P++++   G+ Y+  + +++ G+
Sbjct: 225 GKPGVKYVPPVIVYDELGE-YTPVIKEILYGE 255


>gi|322516256|ref|ZP_08069187.1| methyltransferase [Streptococcus vestibularis ATCC 49124]
 gi|322125256|gb|EFX96626.1| methyltransferase [Streptococcus vestibularis ATCC 49124]
          Length = 254

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/213 (22%), Positives = 106/213 (49%), Gaps = 18/213 (8%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G GA GL  ++R  EA I L E    +A  A++++ L    Q+  +++++  D+
Sbjct: 50  IVDLCSGNGAVGLFASTRT-EAPITLVELQERLADMAQRSVTL---NQLEDQVTVVNDDL 105

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAI 134
             + ++   + +     D ++ NPP+ +   T T  K   E +++        +   C +
Sbjct: 106 KNLLDHTPRSQV-----DLILCNPPYFK--ATETSKKNLSEHYLLARHEITTNLEEICQV 158

Query: 135 ----MRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTG-RKGM 188
               ++S+G+++++ RP   + I++   +  +    I  ++P+ G  A+ +L+   + G 
Sbjct: 159 ARHALKSNGRIAMVHRPDRFLDIIDTMRQYNLAPKRIQFIYPKMGREANMLLIEAIKDGS 218

Query: 189 RGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRS 221
              L+   P+ +HK NG  Y+  + ++  GK++
Sbjct: 219 TDGLKILPPLFVHKKNGD-YTDEIFEIYFGKKA 250


>gi|16799285|ref|NP_469553.1| hypothetical protein lin0208 [Listeria innocua Clip11262]
 gi|16412627|emb|CAC95441.1| lin0208 [Listeria innocua Clip11262]
          Length = 250

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/212 (23%), Positives = 105/212 (49%), Gaps = 21/212 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G G   L +++R  +AQI+  E    +A  A++++A     Q+  +I +IE D+
Sbjct: 51  IIDLCSGNGIIPLLLSTRT-KAQIVGVEIQERLADMAKRSVAY---NQLEDQIEIIEYDL 106

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDK------IKEEAHVMLEDSFEKWI 128
             + +      +     D V  NPP+     T   ++       + E    LED+    I
Sbjct: 107 NHITD-----LIPKERADIVTCNPPYFATPSTSLKNENEHYRIARHEIMCTLEDT----I 157

Query: 129 RTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRKG 187
           R A ++++  G+ + + RP+ L+ I++   + R+    I  +HPR    A+ +LV G K 
Sbjct: 158 RVAASLLKQGGKANFVHRPERLLDIIDLMRKYRLEPKRIQFVHPRIDREANTVLVEGIKD 217

Query: 188 MRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
            +  +++  P++++   G+ Y+  + +++ G+
Sbjct: 218 GKPGVKYVPPVIVYDELGE-YTPVIKEILYGE 248


>gi|258404841|ref|YP_003197583.1| methyltransferase small [Desulfohalobium retbaense DSM 5692]
 gi|257797068|gb|ACV68005.1| methyltransferase small [Desulfohalobium retbaense DSM 5692]
          Length = 249

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 86/207 (41%), Gaps = 7/207 (3%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA    A     + DLGAG G  G  +A R    Q+   + +P M   AR+     A 
Sbjct: 27  LLLACFSPAPTGTQVLDLGAGCGVVGFGLALRQPGIQLTGVDCNPEMVAAARENA---AR 83

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNE-RIGTMTPDKIKEEAHVM 119
             + +R   +E D  LV +      L    +  V+ NPP+ +   G    D  +++A   
Sbjct: 84  LGLEQRAVFVEADAALVRDTAT--PLDPESFPLVVCNPPYRDPETGRSCNDAARQQARFA 141

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECAS 178
            +     ++  A  ++ + G+L L+   + L  ++      R+    +  +H R    A 
Sbjct: 142 GKQGLHAFVEAAAYVLCNRGRLCLVYLAERLPALLTLLRDHRLEPKRMRFVHSRADAAAK 201

Query: 179 RILVTGRKGMRGQLRFRYPIVLHKPNG 205
            +LV  RK    QL    P+VL+   G
Sbjct: 202 LVLVEARKNGGAQLTVEAPLVLYTAAG 228


>gi|116747562|ref|YP_844249.1| methyltransferase small [Syntrophobacter fumaroxidans MPOB]
 gi|116696626|gb|ABK15814.1| methyltransferase small [Syntrophobacter fumaroxidans MPOB]
          Length = 211

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 57/210 (27%), Positives = 88/210 (41%), Gaps = 12/210 (5%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           M+LA LV       + DLG G     L VA R     ++  E  P +   ARK + +  N
Sbjct: 1   MLLAGLVGVRPRERVVDLGTGCAVIPLIVAYRGQGRSVVGVELQPELVRLARKNVEV--N 58

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERI-GTMTPDKIKEEAHVM 119
             +   I ++E D   +      +      +D V+ NPP+     G M   + K  A   
Sbjct: 59  GFVDS-IRILEADFKEI-----TSSFPPGTFDLVLSNPPYRRLASGRMNAVRQKAVARHE 112

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIG--SLEITPLHPREGECA 177
           L  S E   R A  ++   G+L+LI  P S + ++   ARR G  +   T +H    E A
Sbjct: 113 LAGSAEDVFRAASHLLVQGGRLALIY-PASRVGLLFVLARRYGFNAKRFTVIHSNASEPA 171

Query: 178 SRILVTGRKGMRGQLRFRYPIVLHKPNGQP 207
             +    RKG   +L    P  +++ +G P
Sbjct: 172 RLVYFECRKGGGEELLVTAPFFIYREDGGP 201


>gi|118586850|ref|ZP_01544284.1| methyltransferase [Oenococcus oeni ATCC BAA-1163]
 gi|118432682|gb|EAV39414.1| methyltransferase [Oenococcus oeni ATCC BAA-1163]
          Length = 346

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/207 (21%), Positives = 98/207 (47%), Gaps = 17/207 (8%)

Query: 1   MILASLVNATGS--FHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALP 58
            ++A+ ++ + S    LAD GAG G  GL  A   +  ++ L E +  ++    KT+ L 
Sbjct: 51  FLIANFIDKSKSQRLLLADFGAGTGIIGLLYAIE-NPGKVFLIENNSQLSQLEEKTVGLN 109

Query: 59  ANAQISKRISLIEVDVTLVGENRNLAG-LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAH 117
               + KR+++I  D+       NL G  + N  D ++ NPP+ +       +  KE +H
Sbjct: 110 ---DLKKRVTVINQDIN------NLDGTFQLNSLDAIVSNPPYFDSPNYSKKNLSKERSH 160

Query: 118 VMLEDSFE--KWIRTACAIMRSSGQLSLIARPQSLIQIVNACARR-IGSLEITPLHPREG 174
              E++F+    +  +   ++S G+L  I R + ++  ++   +   G  ++  ++ ++ 
Sbjct: 161 ARHEENFDLAVLVSQSKKFLKSKGKLYFIYRAERIVDFIDLLIKNGFGISKMRFVYGKKN 220

Query: 175 ECASRILVTG-RKGMRGQLRFRYPIVL 200
             A  +LV   ++G   ++    P+++
Sbjct: 221 TGAKLVLVKAIKQGSNAKINIEKPMII 247


>gi|290580894|ref|YP_003485286.1| hypothetical protein SmuNN2025_1368 [Streptococcus mutans NN2025]
 gi|254997793|dbj|BAH88394.1| hypothetical protein [Streptococcus mutans NN2025]
          Length = 339

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/211 (21%), Positives = 112/211 (53%), Gaps = 18/211 (8%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G GA GL  A+R  +A+I+  E    +A  A++++ L     ++ ++S+I  D+
Sbjct: 50  IVDLCSGNGAVGLFAATRT-KAKIIEVELQERLADMAQRSIQL---NDLTSQVSMIRDDL 105

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVM----LEDSFEKWIRT 130
             +     L  +  +  D ++ NPP+ +     T  K   E +++    +  + E+  + 
Sbjct: 106 KNL-----LDHVPRSKVDLILCNPPYFK--AAETSKKNLSEHYLLARHEIATNLEEICKI 158

Query: 131 ACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILV-TGRKGM 188
           +  +++++G+L+++ RP   ++I++   + ++    +  ++P+ G+ A+ +L+ T + G 
Sbjct: 159 SQQVLKTNGRLAMVHRPDRFLEIIDTFKKYKLAPKRLQFVYPKLGKDANMLLIETIKDGS 218

Query: 189 RGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
              ++   P+++HK NG  Y+  + ++  GK
Sbjct: 219 PNGMKILPPLIVHKDNGD-YTDNIHEIYFGK 248


>gi|310659448|ref|YP_003937169.1| methyltransferase [Clostridium sticklandii DSM 519]
 gi|308826226|emb|CBH22264.1| putative methyltransferase [Clostridium sticklandii]
          Length = 252

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/210 (21%), Positives = 98/210 (46%), Gaps = 17/210 (8%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++L++ V     +  AD G G G   + VA +     I   E    +A  A +++ L   
Sbjct: 35  VLLSNFVTVKKGYVGADFGTGTGIIPILVAGKSKVDHIYAIEIQKEVAQMANRSIML--- 91

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKE----EA 116
            ++  R+ ++ +++        L+ +K +  D +  NPP+    G    ++ K+    E 
Sbjct: 92  NKLEDRVEILNINLK-----DALSYIKPHSLDFITSNPPYMHANGLTNENEKKKISRHEI 146

Query: 117 HVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQI-VNACARRIGSLEITPLHPREGE 175
           H  L+D     ++TA  +++ +G   ++ RP  L  I V+A A ++    +  +HP+  +
Sbjct: 147 HCNLDD----IMKTASKLLKDNGSFFMVHRPIRLCDIFVSARAHKLEPKLMKFVHPKPSK 202

Query: 176 CASRILVTGRKGMRGQLRFRYPIVLHKPNG 205
             + +L+   +  + +L+   P+ +HK +G
Sbjct: 203 APNLVLIKFVRAAKPELKILDPLYVHKEDG 232


>gi|251794055|ref|YP_003008786.1| methyltransferase small [Paenibacillus sp. JDR-2]
 gi|247541681|gb|ACS98699.1| methyltransferase small [Paenibacillus sp. JDR-2]
          Length = 231

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 97/193 (50%), Gaps = 21/193 (10%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DL  G G   + + +R  +A+I   E  P +A  AR+++A+     +S+++S+IE D+ +
Sbjct: 53  DLCTGNGVIPMLLTTRT-DARIDAVEIQPRLADMARRSVAM---NNLSEQVSIIEGDLKI 108

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNE-RIGTMTPDK----IKEEAHVMLEDSFEKWIRTA 131
             +    AG  N  YD V +NPP+   + G    +      + E H  L+D     +  A
Sbjct: 109 FMKE---AG--NGIYDAVTVNPPYMAVKAGDSNENDHYAIARHEIHCTLDD-----VVHA 158

Query: 132 CA-IMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRKGMR 189
           CA ++RS G+++++ RP   I I+    + R+    +  +HP     A+ +L+   +  +
Sbjct: 159 CARLVRSGGKVAMVHRPSRFIDIMETMRKYRLEPKRVQFIHPNAQGEANMVLIEAIRDGK 218

Query: 190 GQLRFRYPIVLHK 202
            +LR   P+ +++
Sbjct: 219 PELRLLPPVFVYE 231


>gi|172056072|ref|YP_001812532.1| methyltransferase small [Exiguobacterium sibiricum 255-15]
 gi|171988593|gb|ACB59515.1| methyltransferase small [Exiguobacterium sibiricum 255-15]
          Length = 245

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/194 (24%), Positives = 92/194 (47%), Gaps = 14/194 (7%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           L DL AG GA  L ++ R  +  I   E  P +   A +++ +    +   ++ ++E DV
Sbjct: 49  LVDLCAGNGAIPLFLSYRT-KGTITGLEIQPRLVDMAERSIQM---NEKQDQLQMVEGDV 104

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPF---NERIGTMTPDKIKEEAHVMLEDSFEKWIRTA 131
              G+      L    YD V  NPP+   NE       +      H +L  + E  IR+A
Sbjct: 105 KEAGKQ-----LGYGLYDAVTCNPPYFLANESSNRNASEHYTIARHEVL-CTLEDCIRSA 158

Query: 132 CAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRKGMRG 190
             +++  G+ + + RP+ L+ IV    + R+    +  ++P+EG+ A+ +L+ G K  + 
Sbjct: 159 ADLLKQGGKTAFVHRPERLLDIVTLMRQYRLEPKRMQLIYPKEGKEANMLLIEGIKDAKP 218

Query: 191 QLRFRYPIVLHKPN 204
            L+   P ++++ +
Sbjct: 219 GLKVLAPFIVYEQD 232


>gi|313621128|gb|EFR92190.1| methyltransferase small domain-containing protein [Listeria innocua
           FSL S4-378]
          Length = 257

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/212 (23%), Positives = 105/212 (49%), Gaps = 21/212 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G G   L +++R  +AQI+  E    +A  A++++A     Q+  +I +IE D+
Sbjct: 58  IIDLCSGNGIIPLLLSTRT-KAQIVGVEIQERLADMAKRSVAY---NQLEDQIEIIEYDL 113

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDK------IKEEAHVMLEDSFEKWI 128
             + +      +     D V  NPP+     T   ++       + E    LED+    I
Sbjct: 114 NHITD-----LIPKERADIVTCNPPYFATPSTSLKNENEHYRIARHEIMCTLEDT----I 164

Query: 129 RTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRKG 187
           R A ++++  G+ + + RP+ L+ I++   + R+    I  +HPR    A+ +LV G K 
Sbjct: 165 RVAASLLKQGGKANFVHRPERLLDIIDLMRKYRLEPKRIQFVHPRIDREANTVLVEGIKD 224

Query: 188 MRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
            +  +++  P++++   G+ Y+  + +++ G+
Sbjct: 225 GKPGVKYVPPVIVYDELGE-YTPVIKEILYGE 255


>gi|262283176|ref|ZP_06060943.1| DNA methyltransferase signature protein [Streptococcus sp.
           2_1_36FAA]
 gi|262261428|gb|EEY80127.1| DNA methyltransferase signature protein [Streptococcus sp.
           2_1_36FAA]
          Length = 248

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 105/212 (49%), Gaps = 22/212 (10%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL AG GA GL  AS   +A+I+  E    +A  A++++ L    Q+ +++ +I  D+
Sbjct: 50  IVDLCAGNGAVGL-FASAHTQAKIIAVEIQERLADMAQRSIQL---NQLDQQMQVIHDDL 105

Query: 75  TLVGENRNLAG-LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-----EDSFEKWI 128
                 +NL   +  +  D +  NPP+           + E  H +L       + E+  
Sbjct: 106 ------KNLPHYIPCSKVDMIFCNPPY---FKVDKHSNLNESEHYLLARHEISTNLEEIC 156

Query: 129 RTACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTG-RK 186
             A  +++S+G+L+++ RP   + I++   A  +    I  ++P+ G+ A+ +L+   + 
Sbjct: 157 TVAQRVLKSNGRLAMVHRPDRFLDILDTMKAHNLAPKRIQFVYPKIGKGANMLLIEAIKD 216

Query: 187 GMRGQLRFRYPIVLHKPNGQPYSRFVTDLING 218
           G R  L+   P++LH+ +G  Y+  + ++ +G
Sbjct: 217 GSRDGLKILPPLILHEEDGS-YTPEIYEIYHG 247


>gi|323706288|ref|ZP_08117854.1| methyltransferase small [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323534340|gb|EGB24125.1| methyltransferase small [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 248

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 53/226 (23%), Positives = 101/226 (44%), Gaps = 16/226 (7%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++L++ V       + DLG G G   + +A +  + +I+  E    +A+ A + + L   
Sbjct: 32  VLLSNFVYTKRGDKIVDLGCGTGIIPILIAGKSRDTRIVGVEIQSEVANIAIRNVYL--- 88

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF-NERIGTMTPDKIKEEAHVM 119
                RI +I  D+  V +   +       YD V  NPP+   + G     + +  +   
Sbjct: 89  NNFEGRIDIINDDIRNVVDKLGIEK-----YDIVTSNPPYMRHKTGFDKNSESENISRYE 143

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE---ITPLHPREGEC 176
           L    + +I+ A  +++  G+  L+ R   ++ IV     RI +LE   I  +HP  GE 
Sbjct: 144 LNGGLDDFIKVASRLLKFGGKFFLVHRVDRIVDIVYNL--RICNLEPKKIRFIHPHIGEK 201

Query: 177 ASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSL 222
            + +LV  +KG +  +    P+ +++ NG      ++  I GK S+
Sbjct: 202 PNLVLVEAKKGAKSGVVIMPPLYVYEENGGYTKELLS--IYGKTSI 245


>gi|313635230|gb|EFS01532.1| methyltransferase small domain-containing protein [Listeria
           seeligeri FSL N1-067]
          Length = 257

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/212 (23%), Positives = 104/212 (49%), Gaps = 21/212 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G G   L +++R  EAQI+  E  P +A  A++++      ++  +I +IE D+
Sbjct: 58  IIDLCSGNGIIPLLLSTRT-EAQIVGVEIQPRLADMAKRSVVY---NELESQIEIIEHDL 113

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDK------IKEEAHVMLEDSFEKWI 128
             + +      +     D V  NPP+     T   ++       + E    LED+    I
Sbjct: 114 KKITDI-----IPKERADIVTCNPPYFAGPATSLKNENEHYRIARHEVMCTLEDT----I 164

Query: 129 RTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRKG 187
           R A  +++  G+ + + RP+ L+ I++   + R+    I  +HPR    A+ +LV G K 
Sbjct: 165 RVASNLLKQGGKANFVHRPERLLDILDLMRKYRLEPKRIQMVHPRLDREANTVLVEGIKD 224

Query: 188 MRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
            +  +++  P++++   G+ Y+  + +++ G+
Sbjct: 225 GKPGVKYIPPVIVYDEAGE-YTPVIKEILYGE 255


>gi|897792|emb|CAA50273.1| y210 [Pediococcus acidilactici]
          Length = 211

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/216 (23%), Positives = 103/216 (47%), Gaps = 16/216 (7%)

Query: 7   VNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKR 66
           V  +    + DL AG GA GL ++ + H   + + E    +A  A +++ L     + +R
Sbjct: 5   VKQSSKAQIVDLCAGNGAVGLFLSKKTH-GHVTMVEIQSRLAEMAERSILL---NDLKER 60

Query: 67  ISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF--NERIGTMTPDKIKEEAHVMLEDSF 124
             ++ + +       +L  +K +  D+++ NPP+  N       P++    A   +  S 
Sbjct: 61  YRVLNLPLA-----DSLGTIKTDSVDNIVCNPPYFPNHPDSKKNPNQFLAIARHEITTSS 115

Query: 125 EKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVT 183
            K+  T+  +++ +G+L ++ RP  L +I+N   + R+    I  +H  EG+ A+ +L+ 
Sbjct: 116 MKF-ETSQKMLKMNGKLFMVHRPDRLPEIINDFTQNRLAPKRIQFVHSHEGDEANMVLIE 174

Query: 184 G-RKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLING 218
             + G    +R   PI+ +  +G  YS  V +++ G
Sbjct: 175 AIKDGRPNGVRILPPIITY--DGLEYSPTVKEMLYG 208


>gi|296116310|ref|ZP_06834926.1| putative methyltransferase [Gluconacetobacter hansenii ATCC 23769]
 gi|295977129|gb|EFG83891.1| putative methyltransferase [Gluconacetobacter hansenii ATCC 23769]
          Length = 258

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 67/141 (47%), Gaps = 3/141 (2%)

Query: 67  ISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEK 126
           I +++  +  + ++  L+G      DH   NPP+++   T +P   ++ A  +       
Sbjct: 101 IRILQATLPAMPDDPYLSGPGVRRIDHAFANPPWHDHASTPSPLSRRDRARRLPRAGLAH 160

Query: 127 WIRTACAIMRSSGQLSLIARPQSLIQ--IVNACARRIGSLEITPLHPREGECASRILVTG 184
           W+ +  A +R  G L+L A P +L+   I +     +G + + P  PR+G  A  +L+ G
Sbjct: 161 WVGSLSAQLRHHGTLTL-AVPATLLDHAISSMGDSHLGDITVFPCWPRQGVAAKIVLIRG 219

Query: 185 RKGMRGQLRFRYPIVLHKPNG 205
           R G R   R    IVLH  +G
Sbjct: 220 RMGSRTPARLLPGIVLHHADG 240


>gi|312278880|gb|ADQ63537.1| DNA methyltransferase signature protein [Streptococcus thermophilus
           ND03]
          Length = 254

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/221 (21%), Positives = 103/221 (46%), Gaps = 34/221 (15%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G GA GL  ++R  EA I+L E    +A  A++++ L    Q+  +++++  D+
Sbjct: 50  IVDLCSGNGAVGLFASTRT-EAPIILVELQERLADMAKRSVTL---NQLEDQVTVVNDDL 105

Query: 75  TLVGENRNLAGLKNNFYDH--------VIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEK 126
                         N  DH        ++ NPP+ +   T T  K   E +++       
Sbjct: 106 -------------KNLLDHAPRSQVDLILCNPPYFK--ATETSKKNLSEHYLLARHEITT 150

Query: 127 WIRTACAI----MRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRIL 181
            +   C +    ++S+G+++++ RP   + I++   +  +    I  ++P+ G  A+ +L
Sbjct: 151 NLEEICQVARHALKSNGRIAMVHRPDRFLDIIDTMRQYNLAPKRIQFIYPKMGREANMLL 210

Query: 182 VTG-RKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRS 221
           +   + G    L+   P+ +HK N   Y+  + ++  GK++
Sbjct: 211 IEAIKDGSTDGLKILPPLFVHKENDD-YTDEIFEIYFGKKT 250


>gi|266620882|ref|ZP_06113817.1| putative N-6 adenine-specific DNA methylase [Clostridium hathewayi
           DSM 13479]
 gi|288867462|gb|EFC99760.1| putative N-6 adenine-specific DNA methylase [Clostridium hathewayi
           DSM 13479]
          Length = 245

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 97/201 (48%), Gaps = 11/201 (5%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DLG G G   + + ++         E    MA  A +++AL     + +++S+++ D+  
Sbjct: 51  DLGTGTGIIPILLEAKYEGEHYTGLEIQDEMADMAARSVAL---NHLEEKVSIVKGDIK- 106

Query: 77  VGENRNLAGLKNNFYDHVIMNPPF-NERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIM 135
             E   L G  +  +D V  NPP+ N+  G   PD  K  +   +  + +   R A  ++
Sbjct: 107 --EASRLFGAAS--FDVVTSNPPYMNDAHGLKNPDLPKAISRHEVLCTLDDVTREAARLL 162

Query: 136 RSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRKGMRGQLRF 194
           R  G+  ++ RP  LI+I+ A  + ++    +  +HP   + A+ +L+   +G +  ++ 
Sbjct: 163 RPGGRFYMVHRPHRLIEIITALTKYKLEPKRMKMVHPFVEKDANMVLIEAVRGGKSMIKV 222

Query: 195 RYPIVLHKPNGQPYSRFVTDL 215
             PIV+++  G  Y++ + D+
Sbjct: 223 EAPIVVYQEPGV-YTQEIYDI 242


>gi|322373476|ref|ZP_08048012.1| methyltransferase [Streptococcus sp. C150]
 gi|321278518|gb|EFX55587.1| methyltransferase [Streptococcus sp. C150]
          Length = 254

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 48/221 (21%), Positives = 103/221 (46%), Gaps = 34/221 (15%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G GA GL  ++R  +A I L E    +A  A++++ L    Q+  +++++  D+
Sbjct: 50  IVDLCSGNGAVGLFTSTRT-KAPITLVELQERLADMAKRSVTL---NQLEDQVTVVNDDL 105

Query: 75  TLVGENRNLAGLKNNFYDH--------VIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEK 126
                         N  DH        ++ NPP+ +   T T  K   E +++       
Sbjct: 106 -------------KNLLDHAPRSQVDLILCNPPYFK--ATETSKKNLSEHYLLARHEITT 150

Query: 127 WIRTACAI----MRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRIL 181
            +   C +    ++S+G+++++ RP   + I++   +  +    I  ++P+ G  A+ +L
Sbjct: 151 NLEEICQVARHALKSNGRIAMVHRPDRFLDIIDTMRQYNLAPKRIQFIYPKMGREANMLL 210

Query: 182 VTG-RKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRS 221
           +   + G    L+   P+ +HK NG  Y+  + ++  GK++
Sbjct: 211 IEAIKDGSTDGLKILPPLFVHKENGD-YTDEIFEIYFGKKA 250


>gi|306830920|ref|ZP_07464082.1| methyltransferase [Streptococcus gallolyticus subsp. gallolyticus
           TX20005]
 gi|304426943|gb|EFM30053.1| methyltransferase [Streptococcus gallolyticus subsp. gallolyticus
           TX20005]
          Length = 253

 Score = 56.2 bits (134), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 48/210 (22%), Positives = 105/210 (50%), Gaps = 16/210 (7%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G GA GL  ++R  +A I+  E    +A+ A +++ L    Q+  ++ +I  D+
Sbjct: 50  IVDLCSGNGAVGLFASTRT-KAPIIEVELQERLANMAERSIQL---NQLENQVQMINDDL 105

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEE---AHVMLEDSFEKWIRTA 131
             +  +   +G+     D ++ NPP+  ++  M+   + E    A   +  + E+    A
Sbjct: 106 KNLLNHVPRSGV-----DLILCNPPY-FKVSEMSKKNLSEHYLLARHEIATNLEEICEVA 159

Query: 132 CAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTG-RKGMR 189
              ++S+G+L+++ RP   + I++   +  +    I  ++P+ G+ A+ +L+   + G  
Sbjct: 160 RHALKSNGRLAMVHRPDRFLDIIDTMRQYNLAPKRIQFVYPKMGKDANMLLIEAIKDGST 219

Query: 190 GQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
             L+   P+ +HK NG  Y+  + ++  GK
Sbjct: 220 DGLKILPPLFVHKENGD-YTDDIFEIYYGK 248


>gi|325685957|gb|EGD28020.1| O-methyltransferase [Lactobacillus delbrueckii subsp. lactis DSM
           20072]
          Length = 336

 Score = 56.2 bits (134), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 96/195 (49%), Gaps = 13/195 (6%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + +L +G  AA L +A+  ++A     E    M   AR+++ L     +  RI++ + +V
Sbjct: 50  VVELCSGNAAASLYMAA-FNKAHYDDVELQEDMVSKARRSVELN---DMQDRITVYQGNV 105

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIG--TMTPDKIKEEAHVMLEDSFEKWIRTAC 132
              G     + L+ + YD V++NPP+ +      + PD+ K  A   LE + E+ I  + 
Sbjct: 106 KDAG-----SFLRKDSYDVVVVNPPYFKAPAGHKLNPDRSKAIARHELEINLEEIIAVSA 160

Query: 133 AIMRSSGQLSLIARPQSLIQIVNACARR-IGSLEITPLHPREGECASRILVTG-RKGMRG 190
            +++  G++ ++ RP+ L +I+N   +  +    + P   R G+ A+ ++V   R G   
Sbjct: 161 GLLKMKGKMFMVHRPERLGEIINYGFKHDLAVKTVQPFVSRRGQDANLVIVEAVRSGKGD 220

Query: 191 QLRFRYPIVLHKPNG 205
            L  R  I +H+ +G
Sbjct: 221 GLVLRDAIEVHEADG 235


>gi|313124042|ref|YP_004034301.1| o-methyltransferase [Lactobacillus delbrueckii subsp. bulgaricus
           ND02]
 gi|312280605|gb|ADQ61324.1| Predicted O-methyltransferase [Lactobacillus delbrueckii subsp.
           bulgaricus ND02]
          Length = 336

 Score = 56.2 bits (134), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 96/195 (49%), Gaps = 13/195 (6%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + +L +G  AA L +A+  ++A     E    M   AR+++ L     +  RI++ + +V
Sbjct: 50  VVELCSGNAAASLYMAA-FNKAHYDDVELQEDMVSKARRSVELN---DMQDRITVYQGNV 105

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIG--TMTPDKIKEEAHVMLEDSFEKWIRTAC 132
              G     + L+ + YD V++NPP+ +      + PD+ K  A   LE + E+ I  + 
Sbjct: 106 KDAG-----SFLRKDSYDVVVVNPPYFKAPAGHKLNPDRSKAIARHELEINLEEIIAVSA 160

Query: 133 AIMRSSGQLSLIARPQSLIQIVNACARR-IGSLEITPLHPREGECASRILVTG-RKGMRG 190
            +++  G++ ++ RP+ L +I+N   +  +    + P   R G+ A+ ++V   R G   
Sbjct: 161 GLLKMKGKMFMVHRPERLGEIINYGFKHDLAVKTVQPFVSRRGQDANLVIVEAVRSGKGD 220

Query: 191 QLRFRYPIVLHKPNG 205
            L  R  I +H+ +G
Sbjct: 221 GLVLRDAIEVHEADG 235


>gi|154482642|ref|ZP_02025090.1| hypothetical protein EUBVEN_00309 [Eubacterium ventriosum ATCC
           27560]
 gi|149736542|gb|EDM52428.1| hypothetical protein EUBVEN_00309 [Eubacterium ventriosum ATCC
           27560]
          Length = 214

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 44/191 (23%), Positives = 88/191 (46%), Gaps = 10/191 (5%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DLG G G   + + ++         E  P  A  AR+++ L     +  RI +++ D+  
Sbjct: 20  DLGTGTGIIPILLEAKTEGQDFEALEIQPESAEMARRSVML---NNLQDRIKIVDGDIK- 75

Query: 77  VGENRNLAGLKNNFYDHVIMNPPF-NERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIM 135
             E   + G  +  ++ V  NPP+  E  G   PD+ K  A   ++ + E  IR +  ++
Sbjct: 76  --EASKIFGAAS--FNVVTTNPPYMTENHGVKNPDEPKAIARHEIKCNLEDVIRESAKLL 131

Query: 136 RSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRKGMRGQLRF 194
           +  G+  ++ RP+ L +I++     RI    +  +HP     A+ +L+ G +G +  +  
Sbjct: 132 KPKGRFYMVHRPRRLAEIISLMKEYRIEPKRLRMIHPFADRDANMLLIEGVRGGKSMMVV 191

Query: 195 RYPIVLHKPNG 205
             P++++   G
Sbjct: 192 EPPLIVYDEPG 202


>gi|227431626|ref|ZP_03913662.1| methyltransferase [Leuconostoc mesenteroides subsp. cremoris ATCC
           19254]
 gi|227352618|gb|EEJ42808.1| methyltransferase [Leuconostoc mesenteroides subsp. cremoris ATCC
           19254]
          Length = 254

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 51/207 (24%), Positives = 102/207 (49%), Gaps = 14/207 (6%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DLG+G GA GL  A ++   +I L E  P +A  A++++ L     + +R+S+++ D+  
Sbjct: 54  DLGSGTGAVGLFYAPKV-TGEIKLVEIQPELAEMAQRSIEL---NNLHERVSVVQADMKN 109

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNERIGTMTP--DKIKEEAHVMLEDSFEKWIRTACAI 134
           +        +K    + V+ NPP+     T     DK  E A   L  +  +  + A  +
Sbjct: 110 I-----FNEIKPGSVETVLTNPPYFPLTETTKTNIDKHYEIARHELMINIPELAKIANKL 164

Query: 135 MRSSGQLSLIARPQSLIQIVNA-CARRIGSLEITPLHPREGECASRILVTGRKGMR-GQL 192
           ++++G++ ++ RP+ L  I  A  AR++    +  ++ +    A+ +L+   K  R G +
Sbjct: 165 LKNNGKVYMVHRPERLADIFAAFAARKLMIKRVQFVYGKANREANMVLIEAIKSGRPGGV 224

Query: 193 RFRYPIVLHKPNGQPYSRFVTDLINGK 219
           R   P++ +  +   Y+  V D++ GK
Sbjct: 225 RIMPPLIAYTDDND-YTSEVHDILYGK 250


>gi|256853994|ref|ZP_05559359.1| conserved hypothetical protein [Enterococcus faecalis T8]
 gi|257081740|ref|ZP_05576101.1| conserved hypothetical protein [Enterococcus faecalis E1Sol]
 gi|257087666|ref|ZP_05582027.1| conserved hypothetical protein [Enterococcus faecalis D6]
 gi|307290300|ref|ZP_07570216.1| methyltransferase small domain protein [Enterococcus faecalis
           TX0411]
 gi|312900059|ref|ZP_07759376.1| methyltransferase small domain protein [Enterococcus faecalis
           TX0470]
 gi|256710937|gb|EEU25980.1| conserved hypothetical protein [Enterococcus faecalis T8]
 gi|256989770|gb|EEU77072.1| conserved hypothetical protein [Enterococcus faecalis E1Sol]
 gi|256995696|gb|EEU82998.1| conserved hypothetical protein [Enterococcus faecalis D6]
 gi|306498721|gb|EFM68222.1| methyltransferase small domain protein [Enterococcus faecalis
           TX0411]
 gi|311292816|gb|EFQ71372.1| methyltransferase small domain protein [Enterococcus faecalis
           TX0470]
 gi|315025535|gb|EFT37467.1| methyltransferase small domain protein [Enterococcus faecalis
           TX2137]
 gi|315030484|gb|EFT42416.1| methyltransferase small domain protein [Enterococcus faecalis
           TX4000]
 gi|315148659|gb|EFT92675.1| methyltransferase small domain protein [Enterococcus faecalis
           TX4244]
 gi|327535914|gb|AEA94748.1| methyltransferase [Enterococcus faecalis OG1RF]
          Length = 244

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 101/205 (49%), Gaps = 13/205 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+         + DL AG GA GL V SR   A+I   E  P +A   ++++ L   
Sbjct: 32  VLLANFPQLPKKGKIVDLCAGNGAVGLFV-SRKTAAKIDQIELQPRLADMGQRSILL--- 87

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPP-FNER-IGTMTPDKIKEEAHV 118
            ++ K++++ E D+    E      +K +  D V+ NPP F ER      P+     A  
Sbjct: 88  NKLEKQVTMYERDLKQATE-----VIKKDSVDLVLCNPPYFKERPTSQKNPNPHLAIARH 142

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECA 177
            +  S ++ +  +  +++++G+L+++ RP   + I++A     I   +   ++P+ G+ A
Sbjct: 143 EIHTSLQEVVTVSADLLKTNGRLAMVHRPDRFLDILHAMENANIAPKKARFVYPKPGKEA 202

Query: 178 SRILVTG-RKGMRGQLRFRYPIVLH 201
           + +L+ G ++G +   R   P+  +
Sbjct: 203 NVLLIEGIKQGKKDGFRVLPPLFTY 227


>gi|229549187|ref|ZP_04437912.1| methyltransferase [Enterococcus faecalis ATCC 29200]
 gi|229305424|gb|EEN71420.1| methyltransferase [Enterococcus faecalis ATCC 29200]
          Length = 244

 Score = 55.8 bits (133), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 101/205 (49%), Gaps = 13/205 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+         + DL AG GA GL V SR   A+I   E  P +A   ++++ L   
Sbjct: 32  VLLANFPQLPKKGKIVDLCAGNGAVGLFV-SRKTAAKIDQIELQPRLADMGQRSILL--- 87

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPP-FNER-IGTMTPDKIKEEAHV 118
            ++ K++++ E D+    E      +K +  D V+ NPP F ER      P+     A  
Sbjct: 88  NKLKKQVTMYERDLKQATE-----VIKKDSVDLVLCNPPYFKERPTSQKNPNPHLAIARH 142

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECA 177
            +  S ++ +  +  +++++G+L+++ RP   + I++A     I   +   ++P+ G+ A
Sbjct: 143 EIHTSLQEVVTVSADLLKTNGRLAMVHRPDRFLDILHAMENANIAPKKARFVYPKPGKEA 202

Query: 178 SRILVTG-RKGMRGQLRFRYPIVLH 201
           + +L+ G ++G +   R   P+  +
Sbjct: 203 NVLLIEGIKQGKKDGFRVLPPLFTY 227


>gi|322377023|ref|ZP_08051516.1| methyltransferase [Streptococcus sp. M334]
 gi|321282830|gb|EFX59837.1| methyltransferase [Streptococcus sp. M334]
          Length = 249

 Score = 55.8 bits (133), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 45/200 (22%), Positives = 100/200 (50%), Gaps = 23/200 (11%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + D  AG GA GL  ++R H AQIL  E    +A  A +++          R++ +E  +
Sbjct: 51  IVDFCAGNGAVGLFASTRTH-AQILAVEIQERLADMAERSV----------RLNGLEEQM 99

Query: 75  TLVGEN-RNL-AGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-----EDSFEKW 127
            ++ ++ +N+ A ++ +  D ++ NPP+           + E  H +L       + ++ 
Sbjct: 100 EVICDDLKNMPAYIQGSKVDMILCNPPY---FKVDPHSNLNESEHYLLARHEITTNLQEI 156

Query: 128 IRTACAIMRSSGQLSLIARPQSLIQIVNACARR-IGSLEITPLHPREGECASRILVTG-R 185
            R+A +I++S+G+L+++ RP  L+ I++   R  +    +  ++P+  + A+ +L+   +
Sbjct: 157 CRSAQSILKSNGRLAMVHRPDRLLDILDTLQRHNLAPKRLQFVYPKREKEANMLLIEAIK 216

Query: 186 KGMRGQLRFRYPIVLHKPNG 205
            G     +   P+++H  +G
Sbjct: 217 DGSTSGFKVLPPLIVHNDDG 236


>gi|29377172|ref|NP_816326.1| hypothetical protein EF2692 [Enterococcus faecalis V583]
 gi|227519516|ref|ZP_03949565.1| methyltransferase [Enterococcus faecalis TX0104]
 gi|227554183|ref|ZP_03984230.1| methyltransferase [Enterococcus faecalis HH22]
 gi|229544921|ref|ZP_04433646.1| methyltransferase [Enterococcus faecalis TX1322]
 gi|255971904|ref|ZP_05422490.1| conserved hypothetical protein [Enterococcus faecalis T1]
 gi|255974898|ref|ZP_05425484.1| conserved hypothetical protein [Enterococcus faecalis T2]
 gi|256616802|ref|ZP_05473648.1| conserved hypothetical protein [Enterococcus faecalis ATCC 4200]
 gi|256763322|ref|ZP_05503902.1| conserved hypothetical protein [Enterococcus faecalis T3]
 gi|256957924|ref|ZP_05562095.1| conserved hypothetical protein [Enterococcus faecalis DS5]
 gi|256961056|ref|ZP_05565227.1| conserved hypothetical protein [Enterococcus faecalis Merz96]
 gi|256963802|ref|ZP_05567973.1| conserved hypothetical protein [Enterococcus faecalis HIP11704]
 gi|257079861|ref|ZP_05574222.1| conserved hypothetical protein [Enterococcus faecalis JH1]
 gi|257090883|ref|ZP_05585244.1| conserved hypothetical protein [Enterococcus faecalis CH188]
 gi|257416867|ref|ZP_05593861.1| conserved hypothetical protein [Enterococcus faecalis AR01/DG]
 gi|257420089|ref|ZP_05597083.1| conserved hypothetical protein [Enterococcus faecalis T11]
 gi|293384554|ref|ZP_06630420.1| methyltransferase [Enterococcus faecalis R712]
 gi|293386783|ref|ZP_06631354.1| methyltransferase [Enterococcus faecalis S613]
 gi|294780413|ref|ZP_06745779.1| methyltransferase small domain protein [Enterococcus faecalis
           PC1.1]
 gi|300860329|ref|ZP_07106416.1| methyltransferase small domain protein [Enterococcus faecalis TUSoD
           Ef11]
 gi|307269629|ref|ZP_07550965.1| methyltransferase small domain protein [Enterococcus faecalis
           TX4248]
 gi|307271749|ref|ZP_07553020.1| methyltransferase small domain protein [Enterococcus faecalis
           TX0855]
 gi|307276934|ref|ZP_07558044.1| methyltransferase small domain protein [Enterococcus faecalis
           TX2134]
 gi|307278756|ref|ZP_07559822.1| methyltransferase small domain protein [Enterococcus faecalis
           TX0860]
 gi|307288686|ref|ZP_07568666.1| methyltransferase small domain protein [Enterococcus faecalis
           TX0109]
 gi|312902521|ref|ZP_07761727.1| methyltransferase small domain protein [Enterococcus faecalis
           TX0635]
 gi|312906380|ref|ZP_07765388.1| methyltransferase small domain protein [Enterococcus faecalis DAPTO
           512]
 gi|312953719|ref|ZP_07772554.1| methyltransferase small domain protein [Enterococcus faecalis
           TX0102]
 gi|312979461|ref|ZP_07791149.1| methyltransferase small domain protein [Enterococcus faecalis DAPTO
           516]
 gi|29344638|gb|AAO82396.1| conserved hypothetical protein [Enterococcus faecalis V583]
 gi|227073041|gb|EEI11004.1| methyltransferase [Enterococcus faecalis TX0104]
 gi|227176682|gb|EEI57654.1| methyltransferase [Enterococcus faecalis HH22]
 gi|229309813|gb|EEN75800.1| methyltransferase [Enterococcus faecalis TX1322]
 gi|255962922|gb|EET95398.1| conserved hypothetical protein [Enterococcus faecalis T1]
 gi|255967770|gb|EET98392.1| conserved hypothetical protein [Enterococcus faecalis T2]
 gi|256596329|gb|EEU15505.1| conserved hypothetical protein [Enterococcus faecalis ATCC 4200]
 gi|256684573|gb|EEU24268.1| conserved hypothetical protein [Enterococcus faecalis T3]
 gi|256948420|gb|EEU65052.1| conserved hypothetical protein [Enterococcus faecalis DS5]
 gi|256951552|gb|EEU68184.1| conserved hypothetical protein [Enterococcus faecalis Merz96]
 gi|256954298|gb|EEU70930.1| conserved hypothetical protein [Enterococcus faecalis HIP11704]
 gi|256987891|gb|EEU75193.1| conserved hypothetical protein [Enterococcus faecalis JH1]
 gi|256999695|gb|EEU86215.1| conserved hypothetical protein [Enterococcus faecalis CH188]
 gi|257158695|gb|EEU88655.1| conserved hypothetical protein [Enterococcus faecalis ARO1/DG]
 gi|257161917|gb|EEU91877.1| conserved hypothetical protein [Enterococcus faecalis T11]
 gi|291078100|gb|EFE15464.1| methyltransferase [Enterococcus faecalis R712]
 gi|291083786|gb|EFE20749.1| methyltransferase [Enterococcus faecalis S613]
 gi|294452513|gb|EFG20949.1| methyltransferase small domain protein [Enterococcus faecalis
           PC1.1]
 gi|300849368|gb|EFK77118.1| methyltransferase small domain protein [Enterococcus faecalis TUSoD
           Ef11]
 gi|306500352|gb|EFM69689.1| methyltransferase small domain protein [Enterococcus faecalis
           TX0109]
 gi|306504562|gb|EFM73766.1| methyltransferase small domain protein [Enterococcus faecalis
           TX0860]
 gi|306506357|gb|EFM75517.1| methyltransferase small domain protein [Enterococcus faecalis
           TX2134]
 gi|306511627|gb|EFM80626.1| methyltransferase small domain protein [Enterococcus faecalis
           TX0855]
 gi|306514046|gb|EFM82631.1| methyltransferase small domain protein [Enterococcus faecalis
           TX4248]
 gi|310627534|gb|EFQ10817.1| methyltransferase small domain protein [Enterococcus faecalis DAPTO
           512]
 gi|310628366|gb|EFQ11649.1| methyltransferase small domain protein [Enterococcus faecalis
           TX0102]
 gi|310634191|gb|EFQ17474.1| methyltransferase small domain protein [Enterococcus faecalis
           TX0635]
 gi|311287832|gb|EFQ66388.1| methyltransferase small domain protein [Enterococcus faecalis DAPTO
           516]
 gi|315032638|gb|EFT44570.1| methyltransferase small domain protein [Enterococcus faecalis
           TX0017]
 gi|315035201|gb|EFT47133.1| methyltransferase small domain protein [Enterococcus faecalis
           TX0027]
 gi|315143784|gb|EFT87800.1| methyltransferase small domain protein [Enterococcus faecalis
           TX2141]
 gi|315149930|gb|EFT93946.1| methyltransferase small domain protein [Enterococcus faecalis
           TX0012]
 gi|315151818|gb|EFT95834.1| methyltransferase small domain protein [Enterococcus faecalis
           TX0031]
 gi|315159330|gb|EFU03347.1| methyltransferase small domain protein [Enterococcus faecalis
           TX0312]
 gi|315162045|gb|EFU06062.1| methyltransferase small domain protein [Enterococcus faecalis
           TX0645]
 gi|315165360|gb|EFU09377.1| methyltransferase small domain protein [Enterococcus faecalis
           TX1302]
 gi|315168679|gb|EFU12696.1| methyltransferase small domain protein [Enterococcus faecalis
           TX1341]
 gi|315573814|gb|EFU86005.1| methyltransferase small domain protein [Enterococcus faecalis
           TX0309B]
 gi|315579670|gb|EFU91861.1| methyltransferase small domain protein [Enterococcus faecalis
           TX0630]
 gi|315580250|gb|EFU92441.1| methyltransferase small domain protein [Enterococcus faecalis
           TX0309A]
 gi|329570684|gb|EGG52401.1| methyltransferase small domain protein [Enterococcus faecalis
           TX1467]
          Length = 244

 Score = 55.8 bits (133), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 101/205 (49%), Gaps = 13/205 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+         + DL AG GA GL V SR   A+I   E  P +A   ++++ L   
Sbjct: 32  VLLANFPQLPKKGKIVDLCAGNGAVGLFV-SRKTAAKIDQIELQPRLADMGQRSILL--- 87

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPP-FNER-IGTMTPDKIKEEAHV 118
            ++ K++++ E D+    E      +K +  D V+ NPP F ER      P+     A  
Sbjct: 88  NKLEKQVTMYERDLKQATE-----VIKKDSVDLVLCNPPYFKERPTSQKNPNPHLAIARH 142

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECA 177
            +  S ++ +  +  +++++G+L+++ RP   + I++A     I   +   ++P+ G+ A
Sbjct: 143 EIHTSLQEVVTVSADLLKTNGRLAMVHRPDRFLDILHAMENANIAPKKARFVYPKPGKEA 202

Query: 178 SRILVTG-RKGMRGQLRFRYPIVLH 201
           + +L+ G ++G +   R   P+  +
Sbjct: 203 NVLLIEGIKQGKKDGFRVLPPLFTY 227


>gi|307243788|ref|ZP_07525920.1| methyltransferase small domain protein [Peptostreptococcus stomatis
           DSM 17678]
 gi|306492842|gb|EFM64863.1| methyltransferase small domain protein [Peptostreptococcus stomatis
           DSM 17678]
          Length = 249

 Score = 55.8 bits (133), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 46/208 (22%), Positives = 98/208 (47%), Gaps = 13/208 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+      +  L DLG G G   + +A +   ++I+  E    +A  A +++ L   
Sbjct: 35  VLLANFTRVKKNAKLVDLGTGTGIIPILLAGKSSASKIIGIEIQDEVAEMASRSVKL--- 91

Query: 61  AQISKRISLIEVDVTLVGENRNLAG-LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVM 119
            Q+  R+ ++ +D+      ++  G L     D V+ NPP+    G +  +  K  +   
Sbjct: 92  NQLEDRVEILNMDM------KDAVGVLGKGQMDLVVSNPPYMHSNGLINENDKKAISRHG 145

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR--RIGSLEITPLHPREGECA 177
           L+   E  IR A  +++ +G+  ++ RP  L+ ++ A AR  ++ + +I  +H R     
Sbjct: 146 LKCDIEDVIRVASDLVKPNGKFFMVNRPNRLVDML-AIARSYKLEAKQIRFVHSRVASAP 204

Query: 178 SRILVTGRKGMRGQLRFRYPIVLHKPNG 205
             +L+   K  + ++R   P+ ++  +G
Sbjct: 205 KMVLIEYVKCAKPEIRVLSPLYVYNEDG 232


>gi|325846714|ref|ZP_08169629.1| methyltransferase small domain protein [Anaerococcus hydrogenalis
           ACS-025-V-Sch4]
 gi|325481472|gb|EGC84513.1| methyltransferase small domain protein [Anaerococcus hydrogenalis
           ACS-025-V-Sch4]
          Length = 233

 Score = 55.8 bits (133), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 56/226 (24%), Positives = 101/226 (44%), Gaps = 29/226 (12%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+      +  L D+GAG G   LA  S  + + +   E     A    + L L + 
Sbjct: 28  ILLANFSKMKKNKTLIDVGAGNGILSLACLSYYNLSNVYGIEIQEKKAEIFNENLKLNSI 87

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDK-----IKEE 115
                        + ++ ++ NL    NNF D++I NPP+ ++   +  DK      ++E
Sbjct: 88  NN-----------IEIINKDLNLTNFPNNFCDYIITNPPYYKKGANIKNDKEEFLLSRQE 136

Query: 116 AHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE---ITPLHPR 172
             + L D F    +T    ++  G+L +I +P+ L+ I+    +  G+L+   I  +  +
Sbjct: 137 IKMNLADIFSFSNKT----LKDKGKLFMIHKPERLVDII----KESGNLKLKRIKFVQSK 188

Query: 173 EGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLING 218
             E    IL+   K     L+F   ++++  NG  YS+ V  LING
Sbjct: 189 SNEKPVFILLEFVKNANEGLKFEDTLIIYDENGN-YSQEVR-LING 232


>gi|257084336|ref|ZP_05578697.1| conserved hypothetical protein [Enterococcus faecalis Fly1]
 gi|256992366|gb|EEU79668.1| conserved hypothetical protein [Enterococcus faecalis Fly1]
          Length = 244

 Score = 55.8 bits (133), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 101/205 (49%), Gaps = 13/205 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+         + DL AG GA GL V SR   A+I   E  P +A   ++++ L   
Sbjct: 32  VLLANFPQLPKKGKIVDLCAGNGAVGLFV-SRKTAAKIDQIELQPRLADMGQRSILL--- 87

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPP-FNER-IGTMTPDKIKEEAHV 118
            ++ K++++ E D+    E      +K +  D V+ NPP F ER      P+     A  
Sbjct: 88  NKLEKQVTMYERDLEQATE-----VIKKDSVDLVLCNPPYFKERPTSQKNPNPHLAIARH 142

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECA 177
            +  S ++ +  +  +++++G+L+++ RP   + I++A     I   +   ++P+ G+ A
Sbjct: 143 EIHTSLQEVVTVSADLLKTNGRLAMVHRPDRFLDILHAMENANIAPKKARFVYPKPGKEA 202

Query: 178 SRILVTG-RKGMRGQLRFRYPIVLH 201
           + +L+ G ++G +   R   P+  +
Sbjct: 203 NVLLIEGIKQGKKDGFRVLPPLFTY 227


>gi|227878830|ref|ZP_03996737.1| O-methyltransferase [Lactobacillus crispatus JV-V01]
 gi|227861578|gb|EEJ69190.1| O-methyltransferase [Lactobacillus crispatus JV-V01]
          Length = 351

 Score = 55.8 bits (133), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 53/199 (26%), Positives = 97/199 (48%), Gaps = 19/199 (9%)

Query: 15  LADLGAGAGAAGLAVA--SRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEV 72
           +ADL AG  AA + +A  +R H   I +         Y++   ++  N ++  RIS+ + 
Sbjct: 58  VADLCAGNCAATIYMAYFNRAHYDAIEIQNEV-----YSQAVRSVKLN-EMENRISVFQD 111

Query: 73  DVTLVGENRNLAGLKNNFYDHVIMNPPFNE--RIGTMTPDKIKEEAHVMLEDSFEKWIRT 130
           +V   G       L+ + YD V +NPP+ +  +   + PD+ K  A   L  + E+ I  
Sbjct: 112 NVLNAGH-----FLRKDSYDVVTVNPPYFKAPKGHEVNPDRKKAIARHELLINLEQIIEV 166

Query: 131 ACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE-ITPLHPREGECASRILVTGRK--G 187
           A  +++  G++ ++ RP+ L +I   C +   S++ + P  P  GE A+ I+V   K  G
Sbjct: 167 ASGLLKMKGKMLMVHRPERLGEIAYYCMKHDLSIKMVQPFVPHRGEDANLIIVEAVKHTG 226

Query: 188 MRGQLRFRYPIVLHKPNGQ 206
             G +  +  + +H+ NG 
Sbjct: 227 TDGTV-LKDAVEVHESNGD 244


>gi|322389141|ref|ZP_08062703.1| methyltransferase [Streptococcus parasanguinis ATCC 903]
 gi|321144151|gb|EFX39567.1| methyltransferase [Streptococcus parasanguinis ATCC 903]
          Length = 248

 Score = 55.8 bits (133), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 49/198 (24%), Positives = 97/198 (48%), Gaps = 19/198 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL AG GA GL  ++R  EAQIL  E    +A  A +++AL     +++++S+I  D+
Sbjct: 50  IVDLCAGNGAVGLFASTRT-EAQILGVEIQERLADMATRSIALNG---LNQQMSMITDDL 105

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-----EDSFEKWIR 129
             +   R++ G K    D ++ NPP+           + E  H +L       + ++   
Sbjct: 106 KHLP--RHIKGSK---VDIILCNPPY---FKVDEHSNLNESEHYLLARHEITTNLDEICH 157

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTG-RKG 187
            A  +++S+G+L+++ RP   + I+    R  +    I  ++P+  + A+ +L+   + G
Sbjct: 158 VAQRVLKSNGRLAMVHRPDRFLDIIETMKRYNLAPKRIQFVYPKVTKEANMLLIEAIKDG 217

Query: 188 MRGQLRFRYPIVLHKPNG 205
               L+   P+ +H  +G
Sbjct: 218 SLDGLKILPPLFIHNEDG 235


>gi|94990730|ref|YP_598830.1| methyltransferase [Streptococcus pyogenes MGAS10270]
 gi|94544238|gb|ABF34286.1| Methyltransferase [Streptococcus pyogenes MGAS10270]
          Length = 284

 Score = 55.8 bits (133), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 48/214 (22%), Positives = 107/214 (50%), Gaps = 20/214 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G GA GL  ++R  +A I+  E    +A   ++++ L    Q+  ++++I  D+
Sbjct: 76  IVDLCSGNGAVGLFASTRT-KAAIVEVELQERLADMGQRSIQL---NQLEDQVTMICDDL 131

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-----EDSFEKWIR 129
             +  +   +G+     D ++ NPP+     +    K     H +L       + E+  +
Sbjct: 132 KNLLNHVPRSGV-----DLMLCNPPY---FKSHESSKKNVSEHYLLARHEVTTNLEEICQ 183

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTG-RKG 187
            AC  ++S+G+L+++ RP   ++I+++  A  +    +  ++P+ G+ A+ +L+   + G
Sbjct: 184 VACHALKSNGRLAMVHRPDRFLEIIDSLRANGLAPKRVQFVYPKLGKSANMLLIEAIKDG 243

Query: 188 MRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRS 221
               +    P+V+HK NG+ Y+  + ++  G  S
Sbjct: 244 SIEGMTILPPLVVHKENGE-YTDHIFEIYFGAAS 276


>gi|296876846|ref|ZP_06900894.1| methyltransferase [Streptococcus parasanguinis ATCC 15912]
 gi|296432348|gb|EFH18147.1| methyltransferase [Streptococcus parasanguinis ATCC 15912]
          Length = 248

 Score = 55.5 bits (132), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 48/211 (22%), Positives = 103/211 (48%), Gaps = 20/211 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL AG GA GL  ++R  EAQI+  E    +A  A +++AL     +++++S+I  D+
Sbjct: 50  IVDLCAGNGAVGLFASTRT-EAQIIGVEIQERLADMATRSIAL---NDLNRQMSMITDDL 105

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-----EDSFEKWIR 129
             + ++     +K +  D ++ NPP+           + E  H +L       + ++   
Sbjct: 106 KHLPQH-----IKGSKVDIILCNPPY---FKVDEHSNLNESEHYLLARHEITTNLDEICH 157

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTG-RKG 187
            A  +++S+G+L+++ RP   + I+    R  +    I  ++P+  + A+ +L+   + G
Sbjct: 158 VAQRVLKSNGRLAMVHRPDRFLDIIETMKRYNLAPKRIQFVYPKVTKEANMLLIEAIKDG 217

Query: 188 MRGQLRFRYPIVLHKPNGQPYSRFVTDLING 218
               L+   P+ +H  +G  Y+  + ++  G
Sbjct: 218 SLDGLKILPPLFIHNEDGS-YTEEIHEIYYG 247


>gi|256843352|ref|ZP_05548840.1| conserved hypothetical protein [Lactobacillus crispatus 125-2-CHN]
 gi|256849829|ref|ZP_05555260.1| conserved hypothetical protein [Lactobacillus crispatus MV-1A-US]
 gi|262046925|ref|ZP_06019885.1| O-methyltransferase [Lactobacillus crispatus MV-3A-US]
 gi|293381203|ref|ZP_06627211.1| GIY-YIG catalytic domain protein [Lactobacillus crispatus 214-1]
 gi|256614772|gb|EEU19973.1| conserved hypothetical protein [Lactobacillus crispatus 125-2-CHN]
 gi|256713318|gb|EEU28308.1| conserved hypothetical protein [Lactobacillus crispatus MV-1A-US]
 gi|260572907|gb|EEX29467.1| O-methyltransferase [Lactobacillus crispatus MV-3A-US]
 gi|290922243|gb|EFD99237.1| GIY-YIG catalytic domain protein [Lactobacillus crispatus 214-1]
          Length = 343

 Score = 55.5 bits (132), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 53/199 (26%), Positives = 97/199 (48%), Gaps = 19/199 (9%)

Query: 15  LADLGAGAGAAGLAVA--SRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEV 72
           +ADL AG  AA + +A  +R H   I +         Y++   ++  N ++  RIS+ + 
Sbjct: 50  VADLCAGNCAATIYMAYFNRAHYDAIEIQNEV-----YSQAVRSVKLN-EMENRISVFQD 103

Query: 73  DVTLVGENRNLAGLKNNFYDHVIMNPPFNE--RIGTMTPDKIKEEAHVMLEDSFEKWIRT 130
           +V   G       L+ + YD V +NPP+ +  +   + PD+ K  A   L  + E+ I  
Sbjct: 104 NVLNAGH-----FLRKDSYDVVTVNPPYFKAPKGHEVNPDRKKAIARHELLINLEQIIEV 158

Query: 131 ACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE-ITPLHPREGECASRILVTGRK--G 187
           A  +++  G++ ++ RP+ L +I   C +   S++ + P  P  GE A+ I+V   K  G
Sbjct: 159 ASGLLKMKGKMLMVHRPERLGEIAYYCMKHDLSIKMVQPFVPHRGEDANLIIVEAVKHTG 218

Query: 188 MRGQLRFRYPIVLHKPNGQ 206
             G +  +  + +H+ NG 
Sbjct: 219 TDGTV-LKDAVEVHESNGD 236


>gi|116491004|ref|YP_810548.1| O-methyltransferase [Oenococcus oeni PSU-1]
 gi|116091729|gb|ABJ56883.1| Predicted O-methyltransferase [Oenococcus oeni PSU-1]
          Length = 330

 Score = 55.5 bits (132), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 45/207 (21%), Positives = 97/207 (46%), Gaps = 17/207 (8%)

Query: 1   MILASLVNATGS--FHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALP 58
            ++A+ ++ + S    LAD GAG G  GL  A   +  ++ L E +  ++    KT+ L 
Sbjct: 35  FLIANFIDKSKSQRLLLADFGAGTGIIGLLYAIE-NPGKVFLIENNSQLSQLEEKTVGLN 93

Query: 59  ANAQISKRISLIEVDVTLVGENRNLAG-LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAH 117
               + KR+++I  D+       NL G  + N  D ++ NPP+ +       +  KE +H
Sbjct: 94  ---DLKKRVTVINQDIN------NLDGTFQLNSLDAIVSNPPYFDSPNYSKKNLSKERSH 144

Query: 118 VMLEDSFE--KWIRTACAIMRSSGQLSLIARPQSLIQIVNACARR-IGSLEITPLHPREG 174
              E++F+    +  +   ++S G+L  I R + +   ++   +   G  ++  ++ ++ 
Sbjct: 145 ARHEENFDLAVLVSQSKKFLKSKGKLYFIYRAERIADFIDLLIKNGFGISKMRFVYGKKN 204

Query: 175 ECASRILVTG-RKGMRGQLRFRYPIVL 200
             A  +LV   ++G   ++    P+++
Sbjct: 205 TGAKLVLVKAIKQGSNAKINIEKPMII 231


>gi|322418198|ref|YP_004197421.1| type 11 methyltransferase [Geobacter sp. M18]
 gi|320124585|gb|ADW12145.1| Methyltransferase type 11 [Geobacter sp. M18]
          Length = 267

 Score = 55.5 bits (132), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 49/211 (23%), Positives = 92/211 (43%), Gaps = 18/211 (8%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA           ADLG G G   L +A       +   E   +MA  A + +AL   
Sbjct: 42  LLLADFAGVRQGERCADLGTGCGVIALLLARLTENCSVTAIEFQQVMADIAARNVALNG- 100

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNF----YDHVIMNPPFNE-RIGTMTPDKIKEE 115
             +S+R+ ++E DV           LK +F    +D V+ NPP+     G ++P   ++E
Sbjct: 101 --LSERVEIVEEDVI---------SLKGHFPVDSFDLVVSNPPYRRPGTGKVSPRAGRDE 149

Query: 116 AHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIV-NACARRIGSLEITPLHPREG 174
           A      +   ++  A  +++ SG++ LI     L +++  A  +++  L +  +H    
Sbjct: 150 ARHETSATLADFLAAAKYLVKPSGRICLIYHTCRLAELMAQAALQKLAPLRLRMVHGNSQ 209

Query: 175 ECASRILVTGRKGMRGQLRFRYPIVLHKPNG 205
             A   ++   KG  G+L+   P+++    G
Sbjct: 210 MDARMFMIELAKGRTGELKVEPPLLVRSEGG 240


>gi|290890484|ref|ZP_06553559.1| hypothetical protein AWRIB429_0949 [Oenococcus oeni AWRIB429]
 gi|290479880|gb|EFD88529.1| hypothetical protein AWRIB429_0949 [Oenococcus oeni AWRIB429]
          Length = 330

 Score = 55.5 bits (132), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 45/207 (21%), Positives = 97/207 (46%), Gaps = 17/207 (8%)

Query: 1   MILASLVNATGS--FHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALP 58
            ++A+ ++ + S    LAD GAG G  GL  A   +  ++ L E +  ++    KT+ L 
Sbjct: 35  FLIANFIDKSKSQRLLLADFGAGTGIIGLLYAIE-NPGKVFLIENNSQLSQLEEKTVGLN 93

Query: 59  ANAQISKRISLIEVDVTLVGENRNLAG-LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAH 117
               + KR+++I  D+       NL G  + N  D ++ NPP+ +       +  KE +H
Sbjct: 94  ---DLKKRVTVINQDIN------NLDGTFQLNSLDAIVSNPPYFDSPNYSKKNLSKERSH 144

Query: 118 VMLEDSFE--KWIRTACAIMRSSGQLSLIARPQSLIQIVNACARR-IGSLEITPLHPREG 174
              E++F+    +  +   ++S G+L  I R + +   ++   +   G  ++  ++ ++ 
Sbjct: 145 ARHEENFDLAVLVSQSKKFLKSKGKLYFIYRAERIADFIDLLIKNGFGISKMRFVYGKKN 204

Query: 175 ECASRILVTG-RKGMRGQLRFRYPIVL 200
             A  +LV   ++G   ++    P+++
Sbjct: 205 TGAKLVLVKAIKQGSNAKINIEKPMII 231


>gi|309809495|ref|ZP_07703353.1| GIY-YIG catalytic domain protein [Lactobacillus iners SPIN
           2503V10-D]
 gi|308170167|gb|EFO72202.1| GIY-YIG catalytic domain protein [Lactobacillus iners SPIN
           2503V10-D]
          Length = 334

 Score = 55.5 bits (132), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 53/214 (24%), Positives = 104/214 (48%), Gaps = 20/214 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL  G GAA L + S  + A     E  P +A  A+++++L    Q+  RI++  ++ 
Sbjct: 50  VVDLCCGNGAATLYM-SYFNLAHYDAVEIQPEIASQAKRSVSL---NQLENRITVHCINA 105

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPF-----NERIGTMTPDKIKEEAHVMLEDSFEKWIR 129
               +N     L  + +D V +NPP+       RI    P++ K  A   +  + E+ I 
Sbjct: 106 LDAPKN-----LGKDKFDVVTVNPPYFKVPDGHRIN---PNQQKAIARHEILINLEQVII 157

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTG-RKG 187
            A  +++  G+L ++ RP+ L +I++ C +  +G   I P  P+ G+ A+ ++V      
Sbjct: 158 VASQLLKMKGKLFIVHRPERLAEIIHYCLSNHMGVKNIQPFAPQRGQNANLLVVEAVNNA 217

Query: 188 MRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRS 221
               L  + PIV+H  N   ++  + ++I+  ++
Sbjct: 218 TFDGLVLKDPIVVHN-NDNSFTEEIENIIHENKA 250


>gi|294496905|ref|YP_003560605.1| methyltransferase [Bacillus megaterium QM B1551]
 gi|294346842|gb|ADE67171.1| methyltransferase [Bacillus megaterium QM B1551]
          Length = 248

 Score = 55.5 bits (132), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 95/199 (47%), Gaps = 18/199 (9%)

Query: 14  HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVD 73
           +L DL +G G   L ++ R  + +I+  E    +   A++++A     Q+  +I +I  D
Sbjct: 49  NLVDLCSGNGVIPLFLSKRT-KGKIIGVEIQERLHSMAQRSIAY---NQLDGQIKMIHGD 104

Query: 74  VTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLED-----SFEKWI 128
           +    +      L    YD V  NPP+     T   ++I E  H  +       S E  I
Sbjct: 105 LKNAPQE-----LGYGKYDVVTCNPPY---FTTSNKEEINENEHFAIARHEIHCSLEDVI 156

Query: 129 RTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRKG 187
           R +  +++  G+++L+ RP  L+ IV    + R+    +  ++P++G+ A+ +L+ G K 
Sbjct: 157 RASSQLVKQGGKVALVHRPGRLLDIVTLMRQYRLEPKRLQFVYPKDGKEANTLLIEGTKD 216

Query: 188 MRGQLRFRYPIVLHKPNGQ 206
               L+   P+V+++ N +
Sbjct: 217 GSPDLKILPPLVVYQDNDE 235


>gi|255023245|ref|ZP_05295231.1| methyltransferase small domain protein [Listeria monocytogenes FSL
           J1-208]
          Length = 250

 Score = 55.5 bits (132), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 51/218 (23%), Positives = 105/218 (48%), Gaps = 33/218 (15%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G G   L +++R  +A+I+  E    +A  A++++       + ++I ++E D+
Sbjct: 51  IIDLCSGNGIIPLLLSTRT-KAKIVGVEIQERLADMAKRSILY---NHLEEQIEMMEYDL 106

Query: 75  TLVGENRNLAGL-KNNFYDHVIMNPPFNERIGTMTPDK-----------IKEEAHVMLED 122
                 +N+  L      D V  NPP+       TPD             + E    LED
Sbjct: 107 ------KNITDLIPKERADIVTCNPPY-----FATPDTSLKNTNEHFRIARHEVMCTLED 155

Query: 123 SFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRIL 181
           +    IR A ++++  G+ + + RP+ L+ I++   + R+    I  +HPR    A+ +L
Sbjct: 156 T----IRVAASLLKQGGKANFVHRPERLLDIIDTMRKYRLEPKRIQFVHPRLDREANTVL 211

Query: 182 VTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
           V G K  +  +++  P++++   G+ Y+  + +++ GK
Sbjct: 212 VEGIKDGKPGVKYVPPVIVYDELGE-YTPVIKEILYGK 248


>gi|258593160|emb|CBE69479.1| SAM-dependent methyltransferase [NC10 bacterium 'Dutch sediment']
          Length = 266

 Score = 55.5 bits (132), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 54/211 (25%), Positives = 94/211 (44%), Gaps = 10/211 (4%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA       +  + DLG G G     +A R  E +I+  E  P +A  AR+ + L   
Sbjct: 44  LLLAQWAAPRSTDRVLDLGCGNGVIAFLLAHRHPELRIVGLEVQPALADRARRGVHLNG- 102

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERI-GTMTPDKIKEEAHVM 119
             +  RI ++E D+        +AG     +D V+ NPP+ E   G ++PD    +A   
Sbjct: 103 --LQGRIEIVEGDLRQAKGLLPIAG-----FDMVLCNPPYRELASGRLSPDPEIRQAKHE 155

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECAS 178
           L  + E+ I     ++   G+  LI     L+ ++++  A R+    +  +H   G  A 
Sbjct: 156 LTATLEEAIAAVRYLLAPKGRACLIYHASRLVDLLSSLRAVRLEPKRLRLVHSYPGAEAE 215

Query: 179 RILVTGRKGMRGQLRFRYPIVLHKPNGQPYS 209
             LV  R+  R  L+   P+ +++  G P S
Sbjct: 216 LSLVEARRHGRPGLQILAPLFVYQARGGPLS 246


>gi|295702272|ref|YP_003595347.1| methyltransferase [Bacillus megaterium DSM 319]
 gi|294799931|gb|ADF36997.1| methyltransferase [Bacillus megaterium DSM 319]
          Length = 248

 Score = 55.5 bits (132), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 95/199 (47%), Gaps = 18/199 (9%)

Query: 14  HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVD 73
           +L DL +G G   L ++ R  + +I+  E    +   A++++A     Q+  +I +I  D
Sbjct: 49  NLVDLCSGNGVIPLFLSKRT-KGKIIGVEIQERLHSMAQRSIAY---NQLDGQIKMIHGD 104

Query: 74  VTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLED-----SFEKWI 128
           +    +      L    YD V  NPP+     T   ++I E  H  +       S E  I
Sbjct: 105 LKNAPQE-----LGYGQYDVVTCNPPY---FTTSNKEEINENEHFAIARHEIHCSLEDVI 156

Query: 129 RTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRKG 187
           R +  +++  G+++L+ RP  L+ IV    + R+    +  ++P++G+ A+ +L+ G K 
Sbjct: 157 RASSQLVKQGGKVALVHRPGRLLDIVTLMRQYRLEPKRLQFVYPKDGKEANTLLIEGTKD 216

Query: 188 MRGQLRFRYPIVLHKPNGQ 206
               L+   P+V+++ N +
Sbjct: 217 GSPDLKILPPLVVYQDNDE 235


>gi|326389210|ref|ZP_08210778.1| RNA methylase [Thermoanaerobacter ethanolicus JW 200]
 gi|325994573|gb|EGD52997.1| RNA methylase [Thermoanaerobacter ethanolicus JW 200]
          Length = 267

 Score = 55.5 bits (132), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 52/219 (23%), Positives = 105/219 (47%), Gaps = 15/219 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+ V A     + DLG G+G   + +A++  +  I   E    MA  A +++ +   
Sbjct: 51  VLLANFVTAKKGDKIVDLGCGSGIIPILIAAKTQDTFIYGVEIQEDMADMATRSVVI--- 107

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNE-RIGTMTPDKIKEEAHVM 119
            ++ +RI +I+ DV   G  + L   K   +D V  NPP+   + G     K +  A   
Sbjct: 108 NKMEERIKIIKGDVR--GLEKILGYEK---FDIVTSNPPYMPVKTGFDKKQKSENIARYE 162

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPL---HPREGEC 176
           +    E++I+ A  +++  G+  +I R + L+ I+     R  +LE   L   HP     
Sbjct: 163 IYGGLEEFIKAASKLLKFGGKFFMIHRTERLVDILYFL--RKYNLEPKKLRFVHPYVDSK 220

Query: 177 ASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDL 215
            + +L+  +KG +  L    P+ +++ +G+ Y++ + ++
Sbjct: 221 PNLLLIESKKGSQPGLNILAPLYVYEKSGE-YTKEIIEI 258


>gi|116618301|ref|YP_818672.1| O-methyltransferase [Leuconostoc mesenteroides subsp. mesenteroides
           ATCC 8293]
 gi|116097148|gb|ABJ62299.1| Predicted O-methyltransferase [Leuconostoc mesenteroides subsp.
           mesenteroides ATCC 8293]
          Length = 254

 Score = 55.1 bits (131), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 102/207 (49%), Gaps = 14/207 (6%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DLG+G GA GL  A ++   +I L E  P +A  A++++ L     + +R+S+++ D+  
Sbjct: 54  DLGSGTGAVGLFYAPKV-TGEIKLVEIQPELAEMAQRSIEL---NNLHERVSVVQADMKD 109

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNERIGTMTP--DKIKEEAHVMLEDSFEKWIRTACAI 134
           +        +K    + ++ NPP+     T     DK  E A   L  +  +  + A  +
Sbjct: 110 I-----FNEIKPGSVETILTNPPYFPLTETTKTNIDKHYEIARHELMINLPELAQIANKL 164

Query: 135 MRSSGQLSLIARPQSLIQIVNA-CARRIGSLEITPLHPREGECASRILVTGRKGMR-GQL 192
           ++++G++ ++ RP+ L  I  A  AR++    +  ++ +    A+ +L+   K  R G +
Sbjct: 165 LKNNGKVYMVHRPERLADIFAAFAARKLMIKRVQFVYGKANREANMVLIEAIKSGRPGGV 224

Query: 193 RFRYPIVLHKPNGQPYSRFVTDLINGK 219
           R   P++ +  +   Y+  V D++ GK
Sbjct: 225 RIMPPLIAYTDDND-YTSEVHDILYGK 250


>gi|225868914|ref|YP_002744862.1| hypothetical protein SZO_13480 [Streptococcus equi subsp.
           zooepidemicus]
 gi|225702190|emb|CAW99907.1| conserved hypothetical protein [Streptococcus equi subsp.
           zooepidemicus]
          Length = 255

 Score = 55.1 bits (131), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 47/213 (22%), Positives = 107/213 (50%), Gaps = 18/213 (8%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G GA GL  AS   +A I+  E  P +A   ++++ L    Q+  ++++I  D+
Sbjct: 50  IVDLCSGNGAVGL-FASTQTKASIVEIELQPRLADMGQRSIRL---NQLEDQVTMICDDL 105

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAI 134
           T + ++   +G+     D ++ NPP+ +   + T  K   E +++        +   C +
Sbjct: 106 TNLLQHVPRSGV-----DIILCNPPYFK--SSQTSKKNLSEHYLLARHEITTNLAKICQV 158

Query: 135 ----MRSSGQLSLIARPQSLIQIVNACARR-IGSLEITPLHPREGECASRILVTG-RKGM 188
               ++S+G+L+++ RP   ++I++      +    +  ++P+ G+ A+ +L+   + G 
Sbjct: 159 ARHALKSNGRLAMVHRPDRFLEILDTLKTNGLAPKRLQFVYPKLGKEANMLLIEAIKDGS 218

Query: 189 RGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRS 221
              L+   P+++HK NG  Y+  + ++  G + 
Sbjct: 219 MEGLKILPPLIVHKDNGD-YTDTIKEIYFGAKD 250


>gi|295113644|emb|CBL32281.1| Predicted O-methyltransferase [Enterococcus sp. 7L76]
          Length = 244

 Score = 55.1 bits (131), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 100/205 (48%), Gaps = 13/205 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+         + DL AG GA GL V SR   A I   E  P +A   ++++ L   
Sbjct: 32  VLLANFPQLPKKGKIVDLCAGNGAVGLFV-SRKTAAMIDQIELQPRLADMGQRSILL--- 87

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPP-FNER-IGTMTPDKIKEEAHV 118
            ++ K++++ E D+    E      +K +  D V+ NPP F ER      P+     A  
Sbjct: 88  NKLEKQVTMYERDLKQATE-----VIKKDSVDLVLCNPPYFKERPTSQKNPNPHLAIARH 142

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECA 177
            +  S ++ +  +  +++++G+L+++ RP   + I++A     I   +   ++P+ G+ A
Sbjct: 143 EIHTSLQEVVTVSADLLKTNGRLAMVHRPDRFLDILHAMENANIAPKKARFVYPKPGKEA 202

Query: 178 SRILVTG-RKGMRGQLRFRYPIVLH 201
           + +L+ G ++G +   R   P+  +
Sbjct: 203 NVLLIEGIKQGKKDGFRVLPPLFTY 227


>gi|303241042|ref|ZP_07327552.1| putative RNA methylase [Acetivibrio cellulolyticus CD2]
 gi|302591467|gb|EFL61205.1| putative RNA methylase [Acetivibrio cellulolyticus CD2]
          Length = 251

 Score = 55.1 bits (131), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 48/217 (22%), Positives = 99/217 (45%), Gaps = 11/217 (5%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+  +      + DLG G G   + +A +     I+  E    +A  A +++ +   
Sbjct: 35  VLLANFADVKKGNSVIDLGTGTGIISILLAGKTEAKSIVGLEIQEDIAEMADRSVKMNC- 93

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF-NERIGTMTPDKIKEEAHVM 119
             +  R+ ++  D+       ++     + +D V+ NPP+ N+  G +     K  A   
Sbjct: 94  --LEDRVKIVCGDI-----KESVGRFGASSFDVVVSNPPYMNQGGGLINIRDTKAIARHE 146

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECAS 178
           +  S E  +++A  ++ S GQ +++ RP  L  I+    +  I    I  +HP   +  +
Sbjct: 147 ILCSLEDVVKSASKLLVSGGQFAMVHRPDRLADIIWFMRKYTIEPKYIRFVHPTPYKKPN 206

Query: 179 RILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDL 215
            IL+ G +  R QL+   P+ ++  NG  YS+ + ++
Sbjct: 207 LILIKGSRQGRPQLKMMDPLYVYDGNGN-YSKEINEI 242


>gi|315170379|gb|EFU14396.1| methyltransferase small domain protein [Enterococcus faecalis
           TX1342]
 gi|315174969|gb|EFU18986.1| methyltransferase small domain protein [Enterococcus faecalis
           TX1346]
          Length = 244

 Score = 55.1 bits (131), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 100/205 (48%), Gaps = 13/205 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+         + DL AG GA GL V SR   A I   E  P +A   ++++ L   
Sbjct: 32  VLLANFPQLPKKGKIVDLCAGNGAVGLFV-SRKTAATIDQIELQPRLADMGQRSILL--- 87

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPP-FNER-IGTMTPDKIKEEAHV 118
            ++ K++++ E D+    E      +K +  D V+ NPP F ER      P+     A  
Sbjct: 88  NKLEKQVTMYERDLKQATE-----VIKKDSVDLVLCNPPYFKERPTSQKNPNPHLAIARH 142

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECA 177
            +  S ++ +  +  +++++G+L+++ RP   + I++A     I   +   ++P+ G+ A
Sbjct: 143 EIHTSLQEVVTVSADLLKTNGRLAMVHRPDRFLDILHAMENANIAPKKARFVYPKPGKEA 202

Query: 178 SRILVTG-RKGMRGQLRFRYPIVLH 201
           + +L+ G ++G +   R   P+  +
Sbjct: 203 NVLLIEGIKQGKKDGFRVLPPLFTY 227


>gi|325126010|gb|ADY85340.1| Hypothetical conserved protein [Lactobacillus delbrueckii subsp.
           bulgaricus 2038]
          Length = 336

 Score = 55.1 bits (131), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 96/195 (49%), Gaps = 13/195 (6%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + +L +G  AA L +A+  ++A     E    +   AR+++ L     +  RI++ + +V
Sbjct: 50  VVELCSGNAAASLYMAA-FNKAHYDDVELQEDIVSKARRSVELN---DMQDRITVHQGNV 105

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIG--TMTPDKIKEEAHVMLEDSFEKWIRTAC 132
              G     + L+ + YD V++NPP+ +      + PD+ K  A   LE + E+ I  + 
Sbjct: 106 KDAG-----SFLRKDSYDVVVVNPPYFKAPAGHKLNPDRSKAIARHELEINLEEIIAVSA 160

Query: 133 AIMRSSGQLSLIARPQSLIQIVNACARR-IGSLEITPLHPREGECASRILVTG-RKGMRG 190
            +++  G++ ++ RP+ L +I+N   +  +    + P   R G+ A+ ++V   R G   
Sbjct: 161 GLLKMKGKMFMVHRPERLGEIINYGFKHDLAVKTVQPFVSRRGQDANLVIVEAVRSGKGD 220

Query: 191 QLRFRYPIVLHKPNG 205
            L  R  I +H+ NG
Sbjct: 221 GLVLRDAIEVHEANG 235


>gi|297543642|ref|YP_003675944.1| methyltransferase small [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
 gi|296841417|gb|ADH59933.1| methyltransferase small [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
          Length = 248

 Score = 55.1 bits (131), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 88/205 (42%), Gaps = 34/205 (16%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+ V A     + DLG G G   + +A++ ++  I   E    MA  A +++ +   
Sbjct: 32  VLLANFVTAKKGDKIVDLGCGTGIIPILIAAKTYDTFIYGVEIQEDMADMATRSVVI--- 88

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNE-RIGTMTPDKIKEEAHVM 119
             + KRI +I+ DV   G  + L   K   +D V  NPP+   + G     K +  A   
Sbjct: 89  NNMEKRIKIIQGDVR--GIEKTLGYEK---FDIVTSNPPYMPVKAGFDKKRKSENIARYE 143

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASR 179
           +    E++I+ A  +++  G+  ++ R + L+ I+    +         L P+       
Sbjct: 144 IYGGLEEFIKAASKLLKFGGKFFMVYRAERLVDILYFLRK-------YNLEPK------- 189

Query: 180 ILVTGRKGMRGQLRFRYPIVLHKPN 204
                      +LRF YP V  KPN
Sbjct: 190 -----------KLRFVYPYVDSKPN 203


>gi|257421689|ref|ZP_05598679.1| conserved hypothetical protein [Enterococcus faecalis X98]
 gi|257163513|gb|EEU93473.1| conserved hypothetical protein [Enterococcus faecalis X98]
 gi|315155561|gb|EFT99577.1| methyltransferase small domain protein [Enterococcus faecalis
           TX0043]
          Length = 244

 Score = 55.1 bits (131), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 100/205 (48%), Gaps = 13/205 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+         + DL AG GA GL V SR   A I   E  P +A   ++++ L   
Sbjct: 32  VLLANFPQLPKKGKIVDLCAGNGAVGLFV-SRKTAATIDQIELQPRLADMGQRSILL--- 87

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPP-FNER-IGTMTPDKIKEEAHV 118
            ++ K++++ E D+    E      +K +  D V+ NPP F ER      P+     A  
Sbjct: 88  NKLEKQVTMYERDLKQATE-----VIKKDSVDLVLCNPPYFKERPTSQKNPNPHLAIARH 142

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECA 177
            +  S ++ +  +  +++++G+L+++ RP   + I++A     I   +   ++P+ G+ A
Sbjct: 143 EIHTSLQEVVTVSADLLKTNGRLAMVHRPDRFLDILHAMENANIAPKKARFVYPKPGKEA 202

Query: 178 SRILVTG-RKGMRGQLRFRYPIVLH 201
           + +L+ G ++G +   R   P+  +
Sbjct: 203 NVLLIEGIKQGKKDGFRVLPPLFTY 227


>gi|195977785|ref|YP_002123029.1| methyltransferase [Streptococcus equi subsp. zooepidemicus
           MGCS10565]
 gi|195974490|gb|ACG62016.1| methyltransferase [Streptococcus equi subsp. zooepidemicus
           MGCS10565]
          Length = 255

 Score = 55.1 bits (131), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 47/213 (22%), Positives = 107/213 (50%), Gaps = 18/213 (8%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G GA GL  AS   +A I+  E  P +A   ++++ L    Q+  ++++I  D+
Sbjct: 50  IVDLCSGNGAVGL-FASTQTKASIVEIELQPRLADMGQRSIRL---NQLEDQVTMICDDL 105

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAI 134
           T + ++   +G+     D ++ NPP+ +   + T  K   E +++        +   C +
Sbjct: 106 TNLLQHVPRSGV-----DIILCNPPYFK--SSQTSKKNLSEHYLLARHEITTNLAKICQV 158

Query: 135 ----MRSSGQLSLIARPQSLIQIVNACARR-IGSLEITPLHPREGECASRILVTG-RKGM 188
               ++S+G+L+++ RP   ++I++      +    +  ++P+ G+ A+ +L+   + G 
Sbjct: 159 ARHALKSNGRLAMVHRPDRFLEILDTLKTNGLAPKRLQFVYPKLGKEANMLLIEAIKDGS 218

Query: 189 RGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRS 221
              L+   P+++HK NG  Y+  + ++  G + 
Sbjct: 219 MEGLKILPPLIVHKDNGD-YTDTIKEIYFGAKD 250


>gi|15901380|ref|NP_345984.1| hypothetical protein SP_1536 [Streptococcus pneumoniae TIGR4]
 gi|111658379|ref|ZP_01409066.1| hypothetical protein SpneT_02000458 [Streptococcus pneumoniae
           TIGR4]
 gi|221232247|ref|YP_002511400.1| hypothetical protein SPN23F_14990 [Streptococcus pneumoniae ATCC
           700669]
 gi|225854976|ref|YP_002736488.1| methyltransferase [Streptococcus pneumoniae JJA]
 gi|307127744|ref|YP_003879775.1| methyltransferase [Streptococcus pneumoniae 670-6B]
 gi|14973025|gb|AAK75624.1| conserved hypothetical protein [Streptococcus pneumoniae TIGR4]
 gi|220674708|emb|CAR69281.1| conserved hypothetical protein [Streptococcus pneumoniae ATCC
           700669]
 gi|225722822|gb|ACO18675.1| methyltransferase [Streptococcus pneumoniae JJA]
 gi|306484806|gb|ADM91675.1| methyltransferase [Streptococcus pneumoniae 670-6B]
 gi|332074291|gb|EGI84768.1| methyltransferase small domain protein [Streptococcus pneumoniae
           GA17545]
          Length = 249

 Score = 55.1 bits (131), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 45/200 (22%), Positives = 100/200 (50%), Gaps = 23/200 (11%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + D  AG GA GL  ++R  +AQIL  E    +A  A +++          R++ +E  +
Sbjct: 51  IVDFCAGNGAVGLFASTRT-QAQILSVEIQERLADMAERSV----------RLNGLEEQM 99

Query: 75  TLVGEN-RNL-AGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-----EDSFEKW 127
            ++ ++ +N+ A ++ +  D ++ NPP+           + E  H +L       + E+ 
Sbjct: 100 QVICDDLKNMPAHIQGSKVDMILCNPPY---FKVNPYSNLNESEHYLLARHEITTNLEEI 156

Query: 128 IRTACAIMRSSGQLSLIARPQSLIQIVNACARR-IGSLEITPLHPREGECASRILVTG-R 185
            R+A +I++S+G+L+++ RP  L+ I++   R  +    +  ++P+  + A+ +L+   +
Sbjct: 157 CRSAQSILKSNGRLAMVHRPDRLLDILDTLKRHNLAPKRLQFVYPKREKEANMLLIEAIK 216

Query: 186 KGMRGQLRFRYPIVLHKPNG 205
            G     +   P+++H  +G
Sbjct: 217 DGSTSGFKVLPPLIVHNDDG 236


>gi|307265689|ref|ZP_07547242.1| putative RNA methylase [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306919333|gb|EFN49554.1| putative RNA methylase [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 248

 Score = 55.1 bits (131), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 52/219 (23%), Positives = 105/219 (47%), Gaps = 15/219 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+ V A     + DLG G+G   + +A++  +  I   E    MA  A +++ +   
Sbjct: 32  VLLANFVTAKKGDKIVDLGCGSGIIPILIAAKTQDTFIYGVEIQEDMADMATRSVVI--- 88

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFN-ERIGTMTPDKIKEEAHVM 119
            ++ +RI +I+ DV   G  + L   K   +D V  NPP+   + G     K +  A   
Sbjct: 89  NKMEERIKIIKGDVR--GLEKILGYEK---FDIVTSNPPYMLVKTGFDKKQKSENIARYE 143

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPL---HPREGEC 176
           +    E++I+ A  +++  G+  +I R + L+ I+     R  +LE   L   HP     
Sbjct: 144 IYGGLEEFIKAASKLLKFGGKFFMIHRTERLVDILYFL--RKYNLEPKKLRFVHPYVDSK 201

Query: 177 ASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDL 215
            + +L+  +KG +  L    P+ +++ +G+ Y++ + ++
Sbjct: 202 PNLLLIESKKGSQPGLNILAPLYVYEKSGE-YTKEIIEI 239


>gi|229917426|ref|YP_002886072.1| methyltransferase small [Exiguobacterium sp. AT1b]
 gi|229468855|gb|ACQ70627.1| methyltransferase small [Exiguobacterium sp. AT1b]
          Length = 245

 Score = 54.7 bits (130), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 48/196 (24%), Positives = 93/196 (47%), Gaps = 16/196 (8%)

Query: 14  HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVD 73
            L DL AG GA  L ++ R  +  I   E    +   A +++A+     + +RI +++ D
Sbjct: 48  QLVDLCAGTGAIPLFLSYRT-KGTITGVEIQSKLVDMANRSMAV---NHLEERIRVVKGD 103

Query: 74  VTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLED----SFEKWIR 129
           V         A L +  YD +  NPP+   +   T  + + E H +       + E  I+
Sbjct: 104 VKTAA-----AQLGHARYDVITCNPPYF--LANETSLRNQNEHHTIARHEVLCTLEDCIK 156

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTGRKGM 188
           TA  +++  G+++ + RP+ L+ I+    A RI    +  ++P+ G  A+ +L+ G K  
Sbjct: 157 TASQLVKPGGKVAFVHRPERLLDILTLMRAYRIEPKRMQLVYPKAGREANTLLIEGSKDG 216

Query: 189 RGQLRFRYPIVLHKPN 204
           +  L+   P V+++ +
Sbjct: 217 KAGLKILPPFVVYEED 232


>gi|297616264|ref|YP_003701423.1| methyltransferase small [Syntrophothermus lipocalidus DSM 12680]
 gi|297144101|gb|ADI00858.1| methyltransferase small [Syntrophothermus lipocalidus DSM 12680]
          Length = 246

 Score = 54.7 bits (130), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 57/223 (25%), Positives = 103/223 (46%), Gaps = 15/223 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+         + +LGAG+G   + +  R     I   E    +   A +T+ L   
Sbjct: 33  VLLAAFATLGRGSQVCELGAGSGVISVLLVQRDKSCSIKALEVQDSLWDRAVRTVKLNG- 91

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGT-MTPD--KIKEEAH 117
             +   I +I+ D+  V E     G     +D V+ NPPF  RIG  + P+  ++    H
Sbjct: 92  --LEDNIEVIKGDIRRVREIFPAGG-----FDLVVANPPF-WRIGEGLLPEDPEVAAACH 143

Query: 118 VMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGEC 176
            ++  + E+ I  A  ++R  G+L+LI R   L +++    + R+    I  +HP +G  
Sbjct: 144 EVVV-TLEEVIGAAAYLLRLGGKLALIQRAARLDEVIRLSHQYRVPVKRIRMVHPHQGRP 202

Query: 177 ASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
           A+ +L  G KG +  +    P+V+++  G  Y+  V  L  G+
Sbjct: 203 ANLVLTEGTKGAKPGVTVLSPLVIYEDTG-IYTSEVISLYYGE 244


>gi|148988582|ref|ZP_01820015.1| putative manganese-dependent inorganic pyrophosphatase
           [Streptococcus pneumoniae SP6-BS73]
 gi|148997401|ref|ZP_01825006.1| hypothetical protein CGSSp11BS70_00897 [Streptococcus pneumoniae
           SP11-BS70]
 gi|149011774|ref|ZP_01832970.1| putative manganese-dependent inorganic pyrophosphatase
           [Streptococcus pneumoniae SP19-BS75]
 gi|168487506|ref|ZP_02712014.1| methyltransferase [Streptococcus pneumoniae CDC1087-00]
 gi|168575268|ref|ZP_02721231.1| methyltransferase [Streptococcus pneumoniae MLV-016]
 gi|169834069|ref|YP_001694941.1| methyltransferase [Streptococcus pneumoniae Hungary19A-6]
 gi|182684492|ref|YP_001836239.1| hypothetical protein SPCG_1522 [Streptococcus pneumoniae CGSP14]
 gi|225857162|ref|YP_002738673.1| methyltransferase [Streptococcus pneumoniae P1031]
 gi|225859291|ref|YP_002740801.1| methyltransferase [Streptococcus pneumoniae 70585]
 gi|303255322|ref|ZP_07341392.1| hypothetical protein CGSSpBS455_07568 [Streptococcus pneumoniae
           BS455]
 gi|303260163|ref|ZP_07346135.1| hypothetical protein CGSSp9vBS293_05012 [Streptococcus pneumoniae
           SP-BS293]
 gi|303262553|ref|ZP_07348494.1| hypothetical protein CGSSp14BS292_09837 [Streptococcus pneumoniae
           SP14-BS292]
 gi|303264955|ref|ZP_07350870.1| hypothetical protein CGSSpBS397_09428 [Streptococcus pneumoniae
           BS397]
 gi|303266418|ref|ZP_07352306.1| hypothetical protein CGSSpBS457_07396 [Streptococcus pneumoniae
           BS457]
 gi|303269406|ref|ZP_07355176.1| hypothetical protein CGSSpBS458_05719 [Streptococcus pneumoniae
           BS458]
 gi|307068180|ref|YP_003877146.1| putative O-methyltransferase [Streptococcus pneumoniae AP200]
 gi|147756456|gb|EDK63497.1| hypothetical protein CGSSp11BS70_00897 [Streptococcus pneumoniae
           SP11-BS70]
 gi|147764205|gb|EDK71137.1| putative manganese-dependent inorganic pyrophosphatase
           [Streptococcus pneumoniae SP19-BS75]
 gi|147925783|gb|EDK76858.1| putative manganese-dependent inorganic pyrophosphatase
           [Streptococcus pneumoniae SP6-BS73]
 gi|168996571|gb|ACA37183.1| methyltransferase [Streptococcus pneumoniae Hungary19A-6]
 gi|182629826|gb|ACB90774.1| hypothetical protein SPCG_1522 [Streptococcus pneumoniae CGSP14]
 gi|183569677|gb|EDT90205.1| methyltransferase [Streptococcus pneumoniae CDC1087-00]
 gi|183578745|gb|EDT99273.1| methyltransferase [Streptococcus pneumoniae MLV-016]
 gi|225720462|gb|ACO16316.1| methyltransferase [Streptococcus pneumoniae 70585]
 gi|225725402|gb|ACO21254.1| methyltransferase [Streptococcus pneumoniae P1031]
 gi|301802254|emb|CBW35006.1| conserved hypothetical protein [Streptococcus pneumoniae INV200]
 gi|302597690|gb|EFL64766.1| hypothetical protein CGSSpBS455_07568 [Streptococcus pneumoniae
           BS455]
 gi|302636270|gb|EFL66764.1| hypothetical protein CGSSp14BS292_09837 [Streptococcus pneumoniae
           SP14-BS292]
 gi|302638660|gb|EFL69123.1| hypothetical protein CGSSpBS293_05012 [Streptococcus pneumoniae
           SP-BS293]
 gi|302641074|gb|EFL71451.1| hypothetical protein CGSSpBS458_05719 [Streptococcus pneumoniae
           BS458]
 gi|302643996|gb|EFL74255.1| hypothetical protein CGSSpBS457_07396 [Streptococcus pneumoniae
           BS457]
 gi|302645474|gb|EFL75706.1| hypothetical protein CGSSpBS397_09428 [Streptococcus pneumoniae
           BS397]
 gi|306409717|gb|ADM85144.1| Predicted O-methyltransferase [Streptococcus pneumoniae AP200]
 gi|332073874|gb|EGI84352.1| methyltransferase small domain protein [Streptococcus pneumoniae
           GA41301]
 gi|332199581|gb|EGJ13656.1| methyltransferase small domain protein [Streptococcus pneumoniae
           GA41317]
 gi|332200977|gb|EGJ15048.1| methyltransferase small domain protein [Streptococcus pneumoniae
           GA47901]
          Length = 249

 Score = 54.7 bits (130), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 45/200 (22%), Positives = 100/200 (50%), Gaps = 23/200 (11%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + D  AG GA GL  ++R  +AQIL  E    +A  A +++          R++ +E  +
Sbjct: 51  IVDFCAGNGAVGLFASTRT-QAQILSVEIQERLADMAERSV----------RLNGLEEQM 99

Query: 75  TLVGEN-RNL-AGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-----EDSFEKW 127
            ++ ++ +N+ A ++ +  D ++ NPP+           + E  H +L       + E+ 
Sbjct: 100 QVICDDLKNMPAHIQGSKVDMILCNPPY---FKVDPYSNLNESEHYLLARHEITTNLEEI 156

Query: 128 IRTACAIMRSSGQLSLIARPQSLIQIVNACARR-IGSLEITPLHPREGECASRILVTG-R 185
            R+A +I++S+G+L+++ RP  L+ I++   R  +    +  ++P+  + A+ +L+   +
Sbjct: 157 CRSAQSILKSNGRLAMVHRPDRLLDILDTLKRHNLAPKRLQFVYPKREKEANMLLIEAIK 216

Query: 186 KGMRGQLRFRYPIVLHKPNG 205
            G     +   P+++H  +G
Sbjct: 217 DGSTSGFKVLPPLIVHNDDG 236


>gi|260439407|ref|ZP_05793223.1| putative N-6 adenine-specific DNA methylase [Butyrivibrio crossotus
           DSM 2876]
 gi|292808203|gb|EFF67408.1| putative N-6 adenine-specific DNA methylase [Butyrivibrio crossotus
           DSM 2876]
          Length = 245

 Score = 54.7 bits (130), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 47/220 (21%), Positives = 99/220 (45%), Gaps = 11/220 (5%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++L S         + DL  G G   + +  R   ++    E   +    A++++     
Sbjct: 35  VLLCSFTKVNEGDKVLDLCTGNGVIPILLKGRTKGSRFSGLEIQDINVDMAKRSVEYNG- 93

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF-NERIGTMTPDKIKEEAHVM 119
             I + + +++ DV    E   + G  +  +D V  NPP+ NE  G   PD  K  A   
Sbjct: 94  --IGEFVDIVKGDVK---EASGIFGEAS--FDVVTCNPPYMNENHGLKNPDSHKAIARHE 146

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECAS 178
           +  + E  +R    +++  G+ +++ RPQ L +I+    + ++    I  +HP   + A+
Sbjct: 147 ILCTLEDVVREGAKVLKPGGRFNMVHRPQRLTEIIGIMEKYKLQPKRIRFVHPFIEKEAN 206

Query: 179 RILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLING 218
            +L+ G +G R  ++   P+++++  G+ Y+  +  L  G
Sbjct: 207 LVLIEGVRGGRPMIKVEPPVIVYESAGK-YTDEIASLYTG 245


>gi|16077102|ref|NP_387915.1| methyltransferase [Bacillus subtilis subsp. subtilis str. 168]
 gi|221307843|ref|ZP_03589690.1| hypothetical protein Bsubs1_00170 [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221312165|ref|ZP_03593970.1| hypothetical protein BsubsN3_00170 [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221317098|ref|ZP_03598392.1| hypothetical protein BsubsJ_00170 [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221321361|ref|ZP_03602655.1| hypothetical protein BsubsS_00170 [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|586873|sp|P37543|YABB_BACSU RecName: Full=Uncharacterized protein yabB
 gi|467424|dbj|BAA05270.1| unknown [Bacillus subtilis]
 gi|2632301|emb|CAB11810.1| putative methyltransferase [Bacillus subtilis subsp. subtilis str.
           168]
 gi|291482405|dbj|BAI83480.1| hypothetical protein BSNT_00068 [Bacillus subtilis subsp. natto
           BEST195]
          Length = 247

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/214 (24%), Positives = 100/214 (46%), Gaps = 23/214 (10%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL  G G   L +++R  +A IL  E    +   A +++      ++  +I +I  D+
Sbjct: 49  IVDLCTGNGIVPLLLSTR-SKADILGVEIQERLHDMAVRSVEY---NKLDDQIQIIHDDL 104

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKE-------EAHVMLEDSFEKW 127
             + E      L +N YD V  NPP+  +    T   + E       E H  LED     
Sbjct: 105 KNMPEK-----LGHNRYDVVTCNPPYF-KTPKQTEQNMNEHLRIARHEIHCTLED----V 154

Query: 128 IRTACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTGRK 186
           I  +  +++  G+ +L+ RP  L++I     A +I    +  ++P++G+ A+ ILV G K
Sbjct: 155 ISVSSKLLKQGGKAALVHRPGRLLEIFELMKAYQIEPKRVQFVYPKQGKEANTILVEGIK 214

Query: 187 GMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKR 220
           G R  L+   P+ ++    + Y++ +  ++ G +
Sbjct: 215 GGRPDLKILPPLFVYDEQNE-YTKEIRTILYGDK 247


>gi|296329535|ref|ZP_06872021.1| methyltransferase [Bacillus subtilis subsp. spizizenii ATCC 6633]
 gi|305672732|ref|YP_003864403.1| O-methyltransferase [Bacillus subtilis subsp. spizizenii str. W23]
 gi|296153278|gb|EFG94141.1| methyltransferase [Bacillus subtilis subsp. spizizenii ATCC 6633]
 gi|305410975|gb|ADM36093.1| O-methyltransferase [Bacillus subtilis subsp. spizizenii str. W23]
          Length = 247

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/218 (24%), Positives = 102/218 (46%), Gaps = 31/218 (14%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL  G G   L +++R  +A IL  E    +   A +++      ++  +I +I  D+
Sbjct: 49  IVDLCTGNGIVPLLLSTR-SKADILGVEIQERLHDMAVRSVEY---NKLQDQIQIIHDDL 104

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKE-----------EAHVMLEDS 123
             + E      L +N YD V  NPP+ +     TP + ++           E H  LED 
Sbjct: 105 KNMPEK-----LGHNRYDVVTCNPPYFK-----TPKQTEQNMNEHLRIARHEIHCTLED- 153

Query: 124 FEKWIRTACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILV 182
               I  +  +++  G+ +L+ RP  L++I     A +I    +  ++P++G+ A+ ILV
Sbjct: 154 ---VISVSSKLLKQGGKAALVHRPGRLLEIFELMKAYQIEPKRVQFVYPKQGKEANTILV 210

Query: 183 TGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKR 220
            G KG R  L+   P+ ++    + Y++ +  ++ G +
Sbjct: 211 EGIKGGRPDLKILPPLFVYDEQNE-YTKEIRTILYGDK 247


>gi|321313704|ref|YP_004205991.1| methyltransferase [Bacillus subtilis BSn5]
 gi|320019978|gb|ADV94964.1| methyltransferase [Bacillus subtilis BSn5]
          Length = 247

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/214 (24%), Positives = 100/214 (46%), Gaps = 23/214 (10%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL  G G   L +++R  +A IL  E    +   A +++      ++  +I +I  D+
Sbjct: 49  IVDLCTGNGIVPLLLSTR-SKADILGVEIQERLHDMAIRSVEY---NKLDDQIEIIHDDL 104

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKE-------EAHVMLEDSFEKW 127
             + E      L +N YD V  NPP+  +    T   + E       E H  LED     
Sbjct: 105 KNMPEK-----LGHNRYDVVTCNPPYF-KTPKQTEQNMNEHLRIARHEIHCTLED----V 154

Query: 128 IRTACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTGRK 186
           I  +  +++  G+ +L+ RP  L++I     A +I    +  ++P++G+ A+ ILV G K
Sbjct: 155 ISVSSKLLKQGGKAALVHRPGRLLEIFELMKAYQIEPKRVQFVYPKQGKEANTILVEGIK 214

Query: 187 GMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKR 220
           G R  L+   P+ ++    + Y++ +  ++ G +
Sbjct: 215 GGRPDLKILPPLFVYDEQNE-YTKEIRTILYGDK 247


>gi|323481620|gb|ADX81059.1| methyltransferase small domain protein [Enterococcus faecalis 62]
          Length = 244

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 101/205 (49%), Gaps = 13/205 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+         + DL AG GA GL V SR   A+I   E  P +A   ++++ L   
Sbjct: 32  VLLANFPQLPKKGKIVDLCAGNGAVGLFV-SRKTAAKIDQIELQPRLADMGQRSILL--- 87

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGT--MTPDKIKEEAHV 118
            ++ K++++ E D+    E      +K +  D V+ NPP+ +   T    P+     A  
Sbjct: 88  NKLEKQVTMYERDLKQATE-----VIKKDSVDLVLCNPPYFKEQPTSQKNPNPHLAIARH 142

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECA 177
            +  S ++ +  +  +++++G+L+++ RP   + I++A     I   +   ++P+ G+ A
Sbjct: 143 EIHTSLQEVVTVSADLLKTNGRLAMVHRPDRFLDILHAMENANIAPKKARFVYPKPGKEA 202

Query: 178 SRILVTG-RKGMRGQLRFRYPIVLH 201
           + +L+ G ++G +   R   P+  +
Sbjct: 203 NVLLIEGIKQGKKDGFRVLPPLFTY 227


>gi|146319220|ref|YP_001198932.1| O-methyltransferase [Streptococcus suis 05ZYH33]
 gi|146321422|ref|YP_001201133.1| O-methyltransferase [Streptococcus suis 98HAH33]
 gi|145690026|gb|ABP90532.1| Predicted O-methyltransferase [Streptococcus suis 05ZYH33]
 gi|145692228|gb|ABP92733.1| Predicted O-methyltransferase [Streptococcus suis 98HAH33]
 gi|292558853|gb|ADE31854.1| Predicted O-methyltransferase [Streptococcus suis GZ1]
          Length = 260

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 49/212 (23%), Positives = 103/212 (48%), Gaps = 20/212 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G GA GL  ++R  +AQI+  E    +A+  R+++AL     +  ++S+I  D+
Sbjct: 62  IVDLCSGNGAVGLFASTRT-KAQIIQVELQERLANMNRRSIALNG---LEDQVSVINDDL 117

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLE-----DSFEKWIR 129
                N     L++   D ++ NPP+           + E  H +L       + +   +
Sbjct: 118 A----NLPQYDLRSKV-DLMLCNPPY---FKVDKESNLNESEHYLLARHEIATNLDSICQ 169

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTG-RKG 187
            A  +++S+G+L+++ RP   + I++     ++    I  ++P+  + A+ +L+   + G
Sbjct: 170 VAQQVLKSNGRLAMVHRPDRFLDILDTLRTYKLAPKRIQFVYPKASKEANMLLIEAIKDG 229

Query: 188 MRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
               L    P+V+H+ NG  Y+  + ++  GK
Sbjct: 230 SVDGLHILPPLVVHEENGD-YTPAIREIYYGK 260


>gi|289577354|ref|YP_003475981.1| methyltransferase small [Thermoanaerobacter italicus Ab9]
 gi|289527067|gb|ADD01419.1| methyltransferase small [Thermoanaerobacter italicus Ab9]
          Length = 248

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 88/205 (42%), Gaps = 34/205 (16%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+ V A     + DLG G G   + +A++ ++  I   E    MA  A +++ +   
Sbjct: 32  VLLANFVTAKKGDKIVDLGCGTGIIPILIAAKTYDTFIYGVEIQEDMADMATRSVVI--- 88

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNE-RIGTMTPDKIKEEAHVM 119
             + KRI +I+ DV   G  + L   K   +D V  NPP+   + G     K +  A   
Sbjct: 89  NNMEKRIKIIQGDVR--GIEKTLGYEK---FDIVTSNPPYMPVKAGFDKKRKSENIARYE 143

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASR 179
           +    E++I+ A  +++  G+  ++ R + L+ I+    +         L P+       
Sbjct: 144 IYGGLEEFIKAASKLLKFGGKFFMVHRAERLVDILYFLRK-------YNLEPK------- 189

Query: 180 ILVTGRKGMRGQLRFRYPIVLHKPN 204
                      +LRF YP V  KPN
Sbjct: 190 -----------KLRFVYPYVDSKPN 203


>gi|253752261|ref|YP_003025402.1| methyltransferase [Streptococcus suis SC84]
 gi|253754087|ref|YP_003027228.1| methyltransferase [Streptococcus suis P1/7]
 gi|253756021|ref|YP_003029161.1| methyltransferase [Streptococcus suis BM407]
 gi|251816550|emb|CAZ52186.1| putative methyltransferase [Streptococcus suis SC84]
 gi|251818485|emb|CAZ56314.1| putative methyltransferase [Streptococcus suis BM407]
 gi|251820333|emb|CAR46874.1| putative methyltransferase [Streptococcus suis P1/7]
 gi|319758651|gb|ADV70593.1| putative methyltransferase [Streptococcus suis JS14]
          Length = 249

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 49/212 (23%), Positives = 103/212 (48%), Gaps = 20/212 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G GA GL  ++R  +AQI+  E    +A+  R+++AL     +  ++S+I  D+
Sbjct: 51  IVDLCSGNGAVGLFASTRT-KAQIIQVELQERLANMNRRSIALNG---LEDQVSVINDDL 106

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLE-----DSFEKWIR 129
                N     L++   D ++ NPP+           + E  H +L       + +   +
Sbjct: 107 A----NLPQYDLRSKV-DLMLCNPPY---FKVDKESNLNESEHYLLARHEIATNLDSICQ 158

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTG-RKG 187
            A  +++S+G+L+++ RP   + I++     ++    I  ++P+  + A+ +L+   + G
Sbjct: 159 VAQQVLKSNGRLAMVHRPDRFLDILDTLRTYKLAPKRIQFVYPKASKEANMLLIEAIKDG 218

Query: 188 MRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
               L    P+V+H+ NG  Y+  + ++  GK
Sbjct: 219 SVDGLHILPPLVVHEENGD-YTPAIREIYYGK 249


>gi|223933343|ref|ZP_03625331.1| methyltransferase small [Streptococcus suis 89/1591]
 gi|302024241|ref|ZP_07249452.1| methyltransferase [Streptococcus suis 05HAS68]
 gi|223897993|gb|EEF64366.1| methyltransferase small [Streptococcus suis 89/1591]
          Length = 249

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 49/212 (23%), Positives = 103/212 (48%), Gaps = 20/212 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G GA GL  ++R  +AQI+  E    +A   R+++AL     + +++S+I  D+
Sbjct: 51  IVDLCSGNGAVGLFASTRT-KAQIMQVELQERLADMNRRSIALNG---LEEQVSVINDDL 106

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLE-----DSFEKWIR 129
                N     L++   D ++ NPP+           + E  H +L       + +   +
Sbjct: 107 A----NLPQYDLRSKV-DLMLCNPPY---FKVDKDSNLNESEHYLLARHEIATNLDSICQ 158

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTG-RKG 187
            A  +++S+G+L+++ RP   + I++     ++    I  ++P+  + A+ +L+   + G
Sbjct: 159 VAQQVLKSNGRLAMVHRPDRFLDILDKLRTYKLAPKRIQFVYPKASKEANMLLIEAIKDG 218

Query: 188 MRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
               L    P+V+H+ NG  Y+  + ++  GK
Sbjct: 219 SVDGLHILPPLVVHEENGD-YTPAIREIYYGK 249


>gi|311070681|ref|YP_003975604.1| methyltransferase [Bacillus atrophaeus 1942]
 gi|310871198|gb|ADP34673.1| methyltransferase [Bacillus atrophaeus 1942]
          Length = 247

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/214 (24%), Positives = 100/214 (46%), Gaps = 23/214 (10%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL  G G   L +++R  +A I+  E    +   A +++      ++  +I +I  D+
Sbjct: 49  IVDLCTGNGIVPLLLSTR-SKADIIGVEIQERLHDMAVRSVEF---NKLQNQIKIIHDDL 104

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKE-------EAHVMLEDSFEKW 127
             + E      L +N YD V  NPP+  +    T   + E       E H  LED     
Sbjct: 105 KNMPEE-----LGHNKYDVVTCNPPYF-KTPKQTEQNLNEHLRIARHEIHCTLED----V 154

Query: 128 IRTACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTGRK 186
           I  +  +++  G+ +L+ RP  L++I     A +I    +  ++P++G+ A+ ILV G K
Sbjct: 155 ISVSSKLLKQGGKAALVHRPGRLLEIFELMKAYQIEPKRVQFVYPKQGKEANTILVEGIK 214

Query: 187 GMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKR 220
           G R  L+   P+ ++    + Y++ +  ++ G +
Sbjct: 215 GGRPDLKILPPLFVYDDQNE-YTKEIRTILYGDK 247


>gi|291550588|emb|CBL26850.1| Predicted O-methyltransferase [Ruminococcus torques L2-14]
          Length = 247

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/191 (23%), Positives = 84/191 (43%), Gaps = 10/191 (5%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           D+G G G   + +A +         E     A  AR+++A   +  +  RIS++  D+  
Sbjct: 51  DMGTGNGIIPVLLAGKTKGKHFTGLEIQAETAEMARRSVA---HNHLEDRISIVTGDIKE 107

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFN-ERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIM 135
             E       K  F+D +  NPP+     G   PD  K  A   +  + +  +R +  ++
Sbjct: 108 AAER-----FKPAFFDVITTNPPYMLADHGLRNPDDSKAIARHEVLCTLDDILRESMRLL 162

Query: 136 RSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRKGMRGQLRF 194
           +  G+  +I RP  L +I+      +I    I  +HP   +  + +LV G +G + ++  
Sbjct: 163 QDKGRFYMIHRPFRLTEILTKMHEYKIEPKRIQFIHPYIDKEPTMVLVEGMRGAKPRVTI 222

Query: 195 RYPIVLHKPNG 205
             PI+++  +G
Sbjct: 223 EPPIIMYTKDG 233


>gi|149007551|ref|ZP_01831186.1| hypothetical protein CGSSp18BS74_11029 [Streptococcus pneumoniae
           SP18-BS74]
 gi|147760910|gb|EDK67880.1| hypothetical protein CGSSp18BS74_11029 [Streptococcus pneumoniae
           SP18-BS74]
          Length = 198

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/198 (22%), Positives = 99/198 (50%), Gaps = 23/198 (11%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           D  AG GA GL  ++R  +AQIL  E    +A  A +++          R++ +E  + +
Sbjct: 2   DFCAGNGAVGLFASTRT-QAQILSVEIQERLADMAERSV----------RLNGLEEQMQV 50

Query: 77  VGEN-RNL-AGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-----EDSFEKWIR 129
           + ++ +N+ A ++ +  D ++ NPP+           + E  H +L       + E+  R
Sbjct: 51  ICDDLKNMPAHIQGSKVDMILCNPPY---FKVNPYSNLNESEHYLLARHEITTNLEEICR 107

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNACARR-IGSLEITPLHPREGECASRILVTG-RKG 187
           +A +I++S+G+L+++ RP  L+ I++   R  +    +  ++P+  + A+ +L+   + G
Sbjct: 108 SAQSILKSNGRLAMVHRPDRLLDILDTLKRHNLAPKRLQFVYPKREKEANMLLIEAIKDG 167

Query: 188 MRGQLRFRYPIVLHKPNG 205
                +   P+++H  +G
Sbjct: 168 STSGFKVLPPLIVHNDDG 185


>gi|288904868|ref|YP_003430090.1| hypothetical protein GALLO_0657 [Streptococcus gallolyticus UCN34]
 gi|288731594|emb|CBI13149.1| conserved hypothetical protein [Streptococcus gallolyticus UCN34]
          Length = 257

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 104/211 (49%), Gaps = 18/211 (8%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G GA GL  ++R  +A I+  E    +A+ A +++ L    Q+  ++ +I  D+
Sbjct: 50  IVDLCSGNGAVGLFASTRT-KAPIIEVELQERLANMAERSIQL---NQLENQVQMINDDL 105

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAI 134
             +  +   +G+     D ++ NPP+ +   + T  K   E +++        +   C +
Sbjct: 106 KNLLNHVPRSGV-----DLILCNPPYFKV--SETSKKNLSEHYLLARHEIATNLEEICEV 158

Query: 135 ----MRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTG-RKGM 188
               ++S+G+L+++ RP   + I++   +  +    I  ++P+ G+ A+ +L+   + G 
Sbjct: 159 ARHALKSNGRLAMVHRPDRFLDIIDTMRQYNLAPKRIQFVYPKMGKDANMLLIEAIKDGS 218

Query: 189 RGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
              L+   P+ +HK NG  Y+  + ++  GK
Sbjct: 219 TDGLKILPPLFVHKENGD-YTDDIFEIYYGK 248


>gi|322385787|ref|ZP_08059431.1| methyltransferase [Streptococcus cristatus ATCC 51100]
 gi|321270525|gb|EFX53441.1| methyltransferase [Streptococcus cristatus ATCC 51100]
          Length = 248

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/212 (22%), Positives = 102/212 (48%), Gaps = 20/212 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL AG GA GL  ++R  +AQIL  E    +A  A++++ L     +++++ +I  D+
Sbjct: 50  IVDLCAGNGAVGLFASTRT-QAQILAVEIQERLADMAQRSIEL---NHLTQQMQVIHDDL 105

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLE-----DSFEKWIR 129
             +G     A +  +  D ++ NPP+           +    H +L       + E+   
Sbjct: 106 KNLG-----AYISGSKVDIILCNPPY---FKVDEHSNLNGSEHYLLARHEVATNLEEICT 157

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNACA-RRIGSLEITPLHPREGECASRILVTG-RKG 187
            A  +++S+G+L+++ RP   + I+       +    I  ++P++G  A+ +L+   + G
Sbjct: 158 IAQRVLKSNGRLAMVHRPDRFLDILETMKNHNLAPKRIQFVYPKQGREANMLLIEAIKDG 217

Query: 188 MRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
               L+   P+ +H+ +G  Y+  + ++  GK
Sbjct: 218 SPDGLKILPPLFIHEQDGS-YTPEIQEIYYGK 248


>gi|148265792|ref|YP_001232498.1| methyltransferase small [Geobacter uraniireducens Rf4]
 gi|146399292|gb|ABQ27925.1| methyltransferase small [Geobacter uraniireducens Rf4]
          Length = 256

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/200 (25%), Positives = 91/200 (45%), Gaps = 28/200 (14%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DLG+G G   L +A    +  +   E   L+A  A + +++     +  RIS++  D+T 
Sbjct: 47  DLGSGCGIIPLILAREAEDVTVTGVEFQALLADLALRNVSING---LGDRISILAADIT- 102

Query: 77  VGENRNLAGLKNNF----YDHVIMNPPFNERIGT--MTP----DKIKEEAHVMLEDSFEK 126
                    LK  F    +D V+ NPP+  R GT  ++P    DK + E+   L D    
Sbjct: 103 --------SLKGVFPVSSFDLVVSNPPYR-RAGTGRVSPRAGRDKARHESTACLTD---- 149

Query: 127 WIRTACAIMRSSGQLSLIARPQSLIQIV-NACARRIGSLEITPLHPREGECASRILVTGR 185
           ++  A  +++  G++  I  P  L+++   A   ++  L +  +H  +   A   LV   
Sbjct: 150 FLTAAKYLVKPGGRICFIYHPSRLVELFAEAALLKLAPLRLRMVHGNDISGAGMFLVELV 209

Query: 186 KGMRGQLRFRYPIVLHKPNG 205
           KG RG L    P++++  +G
Sbjct: 210 KGRRGDLSVLPPLIVYAGDG 229


>gi|225870080|ref|YP_002746027.1| hypothetical protein SEQ_0675 [Streptococcus equi subsp. equi 4047]
 gi|225699484|emb|CAW93016.1| conserved hypothetical protein [Streptococcus equi subsp. equi
           4047]
          Length = 255

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/215 (22%), Positives = 110/215 (51%), Gaps = 22/215 (10%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G GA GL  +++  +A I+  E  P +A   ++++ L    Q+  ++++I  D+
Sbjct: 50  IVDLCSGNGAVGLFDSTQT-KASIVEIELQPRLADMGQRSIRL---NQLEDQVTMICDDL 105

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAI 134
           T + ++   +G+     D ++ NPP+ +   + T  K   E +++        +   C I
Sbjct: 106 TNLLQHVPRSGV-----DIILYNPPYFK--SSQTSKKNLSEHYLLARHEITTNLAKICQI 158

Query: 135 ----MRSSGQLSLIARPQSLIQIVNACARRIGSL---EITPLHPREGECASRILVTG-RK 186
               ++S+G+L+++ RP   ++I++    +I  L    +  ++P+ G+ A+ +L+   + 
Sbjct: 159 ARHALKSNGRLAMVHRPDRFLEILDTL--KINGLAPKRLQFVYPKLGKEANMLLIEAIKD 216

Query: 187 GMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRS 221
           G    L+   P+++HK NG  Y+  + ++  G + 
Sbjct: 217 GSMEGLKILPPLIVHKDNGD-YTDTIKEIYFGAKD 250


>gi|189425799|ref|YP_001952976.1| methyltransferase small [Geobacter lovleyi SZ]
 gi|189422058|gb|ACD96456.1| methyltransferase small [Geobacter lovleyi SZ]
          Length = 245

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/220 (23%), Positives = 98/220 (44%), Gaps = 10/220 (4%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++L    NA+    + DLG G G   L +A     A I   E+    A  AR+ + L   
Sbjct: 33  LLLCDFANASQETSIVDLGTGCGVMALVLARMAAAAHITAFEQDDAAASLARQNVGLNG- 91

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNER-IGTMTPDKIKEEAHVM 119
             +++R++++  DV  V  +     L  +  D V+ NPP+ ++  G + P   K  A   
Sbjct: 92  --LAERVTVLHDDVLQVRRH-----LPVSSCDLVVSNPPYRKQGRGRLNPHPGKLAARHE 144

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQI-VNACARRIGSLEITPLHPREGECAS 178
                  ++  A  +++ SG++ ++  P  L+++ V A A+++  L +  +H      A 
Sbjct: 145 TTAGLADFLAAAKYLVKPSGRICMVHHPDRLVELMVEAAAQKLAVLRLRMVHGLPAAPAK 204

Query: 179 RILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLING 218
             LV   KG         P +L + + + Y+  VT ++ G
Sbjct: 205 VFLVELTKGRTSANLQILPPLLVRSDTEHYTDEVTKILLG 244


>gi|325977803|ref|YP_004287519.1| hypothetical protein SGGBAA2069_c06030 [Streptococcus gallolyticus
           subsp. gallolyticus ATCC BAA-2069]
 gi|325177731|emb|CBZ47775.1| hypothetical protein SGGBAA2069_c06030 [Streptococcus gallolyticus
           subsp. gallolyticus ATCC BAA-2069]
          Length = 249

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 104/211 (49%), Gaps = 18/211 (8%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G GA GL  ++R  +A I+  E    +A+ A +++ L    Q+  ++ +I  D+
Sbjct: 50  IVDLCSGNGAVGLFASTRT-KAPIIEVELQERLANMAERSIQL---NQLENQVQIINDDL 105

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAI 134
             +  +   +G+     D ++ NPP+ +   + T  K   E +++        +   C +
Sbjct: 106 KNLLNHVPRSGV-----DLILCNPPYFKV--SETSKKNLSEHYLLARHEIATNLEEICEV 158

Query: 135 ----MRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTG-RKGM 188
               ++S+G+L+++ RP   + I++   +  +    I  ++P+ G+ A+ +L+   + G 
Sbjct: 159 ARHALKSNGRLAMVHRPDRFLDIIDTMRQYNLAPKRIQFVYPKMGKDANMLLIEAIKDGS 218

Query: 189 RGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
              L+   P+ +HK NG  Y+  + ++  GK
Sbjct: 219 TDGLKILPPLFVHKENGD-YTDDIFEIYYGK 248


>gi|212637878|ref|YP_002314398.1| methyltransferase [Anoxybacillus flavithermus WK1]
 gi|212559358|gb|ACJ32413.1| Methyltransferase (UbiE/COQ5 family) [Anoxybacillus flavithermus
           WK1]
          Length = 244

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/199 (23%), Positives = 96/199 (48%), Gaps = 18/199 (9%)

Query: 14  HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVD 73
           +L DL  G G   L ++ R  + +I+  E    +   A++++      ++ K+I +I  D
Sbjct: 46  NLVDLCTGNGVIPLLLSKRT-KGKIVGVEIQEKIYDMAKRSVQY---NELEKQIEIIHGD 101

Query: 74  VTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLED-----SFEKWI 128
           +  +      A L ++ +D V  NPP+     T   ++I +  H  +       + E  I
Sbjct: 102 IKHMP-----AYLGHSKFDVVTCNPPY---FPTPNEEEINKNEHFAIARHEIYCTLEDVI 153

Query: 129 RTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRKG 187
           R +  +++  G+ + + RP+ L+ IV    + R+    +  ++P+EG+ A+ IL+ G K 
Sbjct: 154 RVSSQLLKQGGKAAFVHRPERLLDIVTLMRQYRLEPKRLRFVYPKEGKEANTILIEGMKD 213

Query: 188 MRGQLRFRYPIVLHKPNGQ 206
               L+   P+ +++ NG+
Sbjct: 214 GNKGLKILPPLFVYEQNGE 232


>gi|306833037|ref|ZP_07466169.1| methyltransferase [Streptococcus bovis ATCC 700338]
 gi|304424936|gb|EFM28070.1| methyltransferase [Streptococcus bovis ATCC 700338]
          Length = 253

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 105/211 (49%), Gaps = 18/211 (8%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G GA GL  ++R  +A I+  E    +A+ A +++ L    Q+  ++ +I  D+
Sbjct: 50  IVDLCSGNGAVGLFASTRT-KAPIIEVELQERLANMAERSIQL---NQLENQVQMINDDL 105

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAI 134
             + ++   +G+     D ++ NPP+ +   + T  K   E +++        +   C +
Sbjct: 106 KNLLKHVPRSGV-----DLILCNPPYFKV--SETSKKNLSEHYLLARHEIATNLEEICEV 158

Query: 135 ----MRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTG-RKGM 188
               ++S+G+L+++ RP   + I++   +  +    I  ++P+ G+ A+ +L+   + G 
Sbjct: 159 ARHALKSNGRLAMVHRPDRFLDIIDTMRQYNLAPKRIQFVYPKIGKDANMLLIEAIKDGS 218

Query: 189 RGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
              L+   P+ +HK NG  Y+  + ++  GK
Sbjct: 219 TDGLKILPPLFVHKENGD-YTDDIFEIYYGK 248


>gi|329121039|ref|ZP_08249670.1| SAM-dependent methyltransferase [Dialister micraerophilus DSM
           19965]
 gi|327471201|gb|EGF16655.1| SAM-dependent methyltransferase [Dialister micraerophilus DSM
           19965]
          Length = 246

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/207 (22%), Positives = 94/207 (45%), Gaps = 11/207 (5%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA  V+      +ADLG G G   L + S L    I   E +P+MA  A++ ++    
Sbjct: 36  VLLAHYVSIKNKDKIADLGTGTGIIPL-LLSALGAKDIAAFEINPIMADIAKRNVSGNKK 94

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNE-RIGTMTPDKIKEEAHVM 119
             I   I ++E D   + E        +     V+ NPP+ + + G ++  +    A   
Sbjct: 95  NDI---IKVLECDYKKIKEYYPTGSFTS-----VVANPPYRDIKTGKISNKEAVATACYE 146

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECAS 178
           +  + E   +TA  +++  G+L+++ R   L  ++    + ++ +  I  ++ R+   A 
Sbjct: 147 INATIEDVFKTAQYLLKYGGRLTMVHRADRLCDLITYGRKYKMEAKRIRFIYARKKHNAV 206

Query: 179 RILVTGRKGMRGQLRFRYPIVLHKPNG 205
           R+LV  + G   ++    P+ LH  +G
Sbjct: 207 RVLVEWKYGGNVEVTVEPPLFLHYDDG 233


>gi|312867278|ref|ZP_07727488.1| methyltransferase small domain protein [Streptococcus parasanguinis
           F0405]
 gi|311097407|gb|EFQ55641.1| methyltransferase small domain protein [Streptococcus parasanguinis
           F0405]
          Length = 248

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/198 (23%), Positives = 97/198 (48%), Gaps = 19/198 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL AG GA GL  ++R  EAQI+  E    +A  A +++AL     +++++S+I  D+
Sbjct: 50  IVDLCAGNGAVGLFASTRT-EAQIIGVEIQERLADMATRSIAL---NDLNQQMSMITDDL 105

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-----EDSFEKWIR 129
             + ++  + G K    D ++ NPP+           + E  H +L       + ++   
Sbjct: 106 KHLPQH--IGGSK---VDIILCNPPY---FKVDEHSNLNESEHYLLARHEITTNLDEICH 157

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTG-RKG 187
            A  +++S+G+L+++ RP   + I+    R  +    I  ++P+  + A+ +L+   + G
Sbjct: 158 VAQRVLKSNGRLAMVHRPDRFLDIIETMKRYNLAPKRIQFVYPKVTKEANMLLIEAIKDG 217

Query: 188 MRGQLRFRYPIVLHKPNG 205
               L+   P+ +H  +G
Sbjct: 218 SLDGLKILPPLFIHNEDG 235


>gi|257066645|ref|YP_003152901.1| methyltransferase small [Anaerococcus prevotii DSM 20548]
 gi|256798525|gb|ACV29180.1| methyltransferase small [Anaerococcus prevotii DSM 20548]
          Length = 233

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/199 (23%), Positives = 86/199 (43%), Gaps = 23/199 (11%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           D+GAG+G       S     ++   E     A   R+ +AL                + +
Sbjct: 44  DIGAGSGVLSFLTNSLYKLKKVYAVEIQKAKADLLRENIALNNIEN-----------IEI 92

Query: 77  VGENRNLAGLKNNFYDHVIMNPPF---NERIGTMTPDKI--KEEAHVMLEDSFEKWIRTA 131
           + ++ N    K N  D++I NPP+    + IG    + +  ++E ++ LED F      A
Sbjct: 93  INDDLNNIDFKENSLDYIITNPPYYKITDNIGNKEEEFLISRQEKYLKLEDIFA----FA 148

Query: 132 CAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQ 191
              ++  G+L +I +P+ +++I N     I    +  +  R  E    ILV   K  R  
Sbjct: 149 NKTLKDKGKLFMIHKPERMVEIFNKSG-NIKPKRVRFVESRVYEKPQFILVEFVKNARDG 207

Query: 192 LRFRYPIVLHKPNGQPYSR 210
           L+   P+V+++  G+ YS+
Sbjct: 208 LKIEDPLVIYE--GKSYSK 224


>gi|283851152|ref|ZP_06368436.1| methyltransferase small [Desulfovibrio sp. FW1012B]
 gi|283573548|gb|EFC21524.1| methyltransferase small [Desulfovibrio sp. FW1012B]
          Length = 259

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 91/202 (45%), Gaps = 17/202 (8%)

Query: 17  DLGAGAGAAGLA--VASRLHEAQILLAERSPLMAHYARKTLALPANAQ---ISKRISLIE 71
           DLG G G AGL   +A +  EA +L  ++ P M   AR+      NA+   ++ R     
Sbjct: 44  DLGTGCGPAGLGWMLARQDPEATVLGLDKDPAMVEAARE------NARRLGLADRFDARL 97

Query: 72  VDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPD-KIKEEAHVMLEDSFEKWIRT 130
           +DV  +G +   AGL     D V+ NPP+        P+ + +E A    +     +   
Sbjct: 98  LDVRDLGTD---AGLVPGSCDLVLANPPYRHPGSGRRPEHQGREAARFETDGDLPAFAAA 154

Query: 131 ACAIMRSSGQLSLIARPQSLIQIVNA-CARRIGSLEITPLHPREGECASRILVTGRKGMR 189
           A   +   G+ + +   + L+ ++ +  A+ +    I P+ PR    A +ILV  RK  R
Sbjct: 155 AFLALADKGRFACVHLAERLVHVIASLAAQNLEPKYILPVSPRRDAPARQILVLARKNGR 214

Query: 190 GQLRFRYPIVLHKPNGQPYSRF 211
             LR   P+ L++  G P +R 
Sbjct: 215 PGLRLDAPLALYEGTG-PETRL 235


>gi|307706206|ref|ZP_07643023.1| methyltransferase small domain protein [Streptococcus mitis SK321]
 gi|307618396|gb|EFN97546.1| methyltransferase small domain protein [Streptococcus mitis SK321]
          Length = 249

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/199 (22%), Positives = 100/199 (50%), Gaps = 21/199 (10%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + D  AG GA GL  ++R  +AQIL  E    +A  A +++ L     + +++ +I  D+
Sbjct: 51  IVDFCAGNGAVGLFASTRT-QAQILAVEIQERLADMAERSVRLNG---LEEQMGVICDDL 106

Query: 75  TLVGENRNL-AGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-----EDSFEKWI 128
                 +N+ A ++ +  D ++ NPP+           + E  H +L       + ++  
Sbjct: 107 ------KNMPAYIQGSKVDMILCNPPY---FKVDPHSNLNESEHYLLARHEITTNLQEIC 157

Query: 129 RTACAIMRSSGQLSLIARPQSLIQIVNACARR-IGSLEITPLHPREGECASRILVTG-RK 186
           R+A +I++S+G+L+++ RP  L+ I+++  R  +    +  ++P+  + A+ +L+   + 
Sbjct: 158 RSAQSILKSNGRLAMVHRPDRLLDILDSLQRHNLAPKRLQFVYPKREKEANMLLIEAIKD 217

Query: 187 GMRGQLRFRYPIVLHKPNG 205
           G     +   P+++H  +G
Sbjct: 218 GSTSGFKVLPPLIVHNDDG 236


>gi|300173179|ref|YP_003772345.1| RNA methyltransferase [Leuconostoc gasicomitatum LMG 18811]
 gi|299887558|emb|CBL91526.1| RNA methyltransferase [Leuconostoc gasicomitatum LMG 18811]
          Length = 253

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 54/218 (24%), Positives = 104/218 (47%), Gaps = 16/218 (7%)

Query: 7   VNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKR 66
           V   G     DLGAG GA GL  A ++    I L E  P +A  A++++A+     +  R
Sbjct: 44  VKGKGRGLTVDLGAGTGAVGLFYAPKV-AGLIKLVEIQPELAEMAKRSIAMNG---LQDR 99

Query: 67  ISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF---NERIGTMTPDKIKEEAHVMLEDS 123
           +S+++ D+  + ++     ++    + V+ NPP+   N    T   D+  E A   L   
Sbjct: 100 VSVLQSDMKAIFDD-----IQPGSAETVLSNPPYFPLNNTTKT-NQDEHYELARHELTID 153

Query: 124 FEKWIRTACAIMRSSGQLSLIARPQSLIQIVNA-CARRIGSLEITPLHPREGECASRILV 182
                + A  +++++G+  ++ RP+ L  I +A  AR++    I  ++ +    A+ +L+
Sbjct: 154 LPGLAQVANKLLKNNGKFYMVHRPERLADIFSAFSARKLMIKRIQFVYGKSDREANMVLI 213

Query: 183 TGRKGMR-GQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
              K  R G +R   PIV +    + Y+  V +++ G+
Sbjct: 214 EAIKAGRLGGVRIMPPIVAYTQTNE-YTNQVQNILYGQ 250


>gi|114565621|ref|YP_752775.1| SAM-dependent methyltransferases [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
 gi|114336556|gb|ABI67404.1| SAM-dependent methyltransferases [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
          Length = 251

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 57/207 (27%), Positives = 88/207 (42%), Gaps = 10/207 (4%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA      G     DLG G G   L +A R    ++   E    M   ARK +A    
Sbjct: 39  ILLAHFPVLDGIKQAVDLGTGNGVIALLLAYRAPSLRVTGIEIQESMIKRARKNIAF--- 95

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNER-IGTMTPDKIKEEAHVM 119
             + +RI LI+ D+  + E      L     + V+ NPPF ++  G ++ +  K  A   
Sbjct: 96  NHLEERIDLIQADIKNIKEY-----LPPQGAELVVSNPPFWKKGEGKLSLNPEKAVARHE 150

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNA-CARRIGSLEITPLHPREGECAS 178
           LE      +R A  I+   G   LI R + L +I     A  +    I P++P     A 
Sbjct: 151 LEVELADLVRAAAYILLPRGCFCLIQRAERLQEIARLFSANGLVLRRIRPVYPLPEREAR 210

Query: 179 RILVTGRKGMRGQLRFRYPIVLHKPNG 205
            IL+ G+KG  G L    P+ +++  G
Sbjct: 211 MILLEGQKGGAGGLTILPPLFVYENPG 237


>gi|167038525|ref|YP_001666103.1| methyltransferase small [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|167038733|ref|YP_001661718.1| methyltransferase small [Thermoanaerobacter sp. X514]
 gi|256751395|ref|ZP_05492274.1| methyltransferase small [Thermoanaerobacter ethanolicus CCSD1]
 gi|300913682|ref|ZP_07130999.1| putative RNA methylase [Thermoanaerobacter sp. X561]
 gi|307723303|ref|YP_003903054.1| RNA methylase [Thermoanaerobacter sp. X513]
 gi|320116921|ref|YP_004187080.1| RNA methylase [Thermoanaerobacter brockii subsp. finnii Ako-1]
 gi|166852973|gb|ABY91382.1| methyltransferase small [Thermoanaerobacter sp. X514]
 gi|166857359|gb|ABY95767.1| methyltransferase small [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|256749777|gb|EEU62802.1| methyltransferase small [Thermoanaerobacter ethanolicus CCSD1]
 gi|300890367|gb|EFK85512.1| putative RNA methylase [Thermoanaerobacter sp. X561]
 gi|307580364|gb|ADN53763.1| RNA methylase [Thermoanaerobacter sp. X513]
 gi|319930012|gb|ADV80697.1| RNA methylase [Thermoanaerobacter brockii subsp. finnii Ako-1]
          Length = 248

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/219 (23%), Positives = 104/219 (47%), Gaps = 15/219 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+ V A     + DLG G G   + +A++ ++  I   E    MA  A +++ +   
Sbjct: 32  VLLANFVTAKKGDKIVDLGCGTGIIPILIAAKTYDTFIYGVEIQEDMADMATRSVVI--- 88

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNE-RIGTMTPDKIKEEAHVM 119
            ++ +RI +I+ DV   G  + L   K   +D V  NPP+   + G     + +  A   
Sbjct: 89  NKMEERIKIIKGDVR--GLEKILGYEK---FDIVTSNPPYMPVKTGFDKKQESENIARYE 143

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPL---HPREGEC 176
           +    E +I+ A  +++  G+  +I R + L+ I+     R  +LE   L   HP     
Sbjct: 144 IYGGLEDFIKAASKLLKFGGKFFMIHRTERLVDILYFL--RKYNLEPKKLRFVHPYVDSK 201

Query: 177 ASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDL 215
            + +L+  +KG +  L    P+ +++ +G+ Y++ + ++
Sbjct: 202 PNLLLIESKKGSQPGLNILAPLYVYEKSGE-YTKEIIEI 239


>gi|307704420|ref|ZP_07641332.1| methyltransferase small domain protein [Streptococcus mitis SK597]
 gi|307622033|gb|EFO01058.1| methyltransferase small domain protein [Streptococcus mitis SK597]
          Length = 249

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/200 (22%), Positives = 100/200 (50%), Gaps = 23/200 (11%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + D  AG GA GL  ++R  +AQIL  E    +A  A +++          R++ +E  +
Sbjct: 51  IVDFCAGNGAVGLFASTRT-QAQILAVEIQERLADMAERSV----------RLNGLEEQM 99

Query: 75  TLVGEN-RNL-AGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-----EDSFEKW 127
            ++ ++ +N+ A ++ +  D ++ NPP+           + E  H +L       + ++ 
Sbjct: 100 QVICDDLKNMPAYIQGSKVDMILCNPPY---FKVDPHSNLNESEHYLLARHEITTNLQEI 156

Query: 128 IRTACAIMRSSGQLSLIARPQSLIQIVNACARR-IGSLEITPLHPREGECASRILVTG-R 185
            R+A +I++S+G+L+++ RP  L+ I++   R  +    +  ++P+  + A+ +L+   +
Sbjct: 157 CRSAQSILKSNGRLAMVHRPDRLLDILDTLQRHNLAPKRLQFVYPKREKEANMLLIEAIK 216

Query: 186 KGMRGQLRFRYPIVLHKPNG 205
            G     +   P+++H  +G
Sbjct: 217 DGSTSGFKVLPPLIVHNDDG 236


>gi|295693148|ref|YP_003601758.1| o-methyltransferase [Lactobacillus crispatus ST1]
 gi|295031254|emb|CBL50733.1| O-methyltransferase [Lactobacillus crispatus ST1]
          Length = 343

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/199 (25%), Positives = 96/199 (48%), Gaps = 19/199 (9%)

Query: 15  LADLGAGAGAAGLAVA--SRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEV 72
           + DL AG  AA + +A  +R H   I +         Y++   ++  N ++  RIS+ + 
Sbjct: 50  VVDLCAGNCAATIYMAYFNRAHYDAIEIQNEV-----YSQAVRSVKLN-EMENRISVFQD 103

Query: 73  DVTLVGENRNLAGLKNNFYDHVIMNPPFNE--RIGTMTPDKIKEEAHVMLEDSFEKWIRT 130
           +V   G       L+ + YD V +NPP+ +  +   + PD+ K  A   L  + E+ I  
Sbjct: 104 NVLNAGH-----FLRKDSYDVVTVNPPYFKAPKGHEVNPDRKKAIARHELLINLEQIIEV 158

Query: 131 ACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE-ITPLHPREGECASRILVTGRK--G 187
           A  +++  G++ ++ RP+ L +I   C +   S++ + P  P  GE A+ ++V   K  G
Sbjct: 159 ASGLLKMKGKMFMVHRPERLGEIAYYCIKHDLSIKMVQPFVPHRGEDANLVIVEAVKHTG 218

Query: 188 MRGQLRFRYPIVLHKPNGQ 206
             G +  +  + +H+ NG 
Sbjct: 219 TDGTV-LKDAVEVHEANGD 236


>gi|160936945|ref|ZP_02084309.1| hypothetical protein CLOBOL_01834 [Clostridium bolteae ATCC
           BAA-613]
 gi|158440135|gb|EDP17882.1| hypothetical protein CLOBOL_01834 [Clostridium bolteae ATCC
           BAA-613]
          Length = 260

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/192 (22%), Positives = 85/192 (44%), Gaps = 10/192 (5%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DLG G G   + + ++   +     E     A  AR+++A      +  ++ ++  D+  
Sbjct: 66  DLGTGTGIIPILLTAKTEGSHFTGLEIQEESADMARRSVAY---NHLEGKVDIVTGDIV- 121

Query: 77  VGENRNLAGLKNNFYDHVIMNPPF-NERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIM 135
             E   L  L +  +D V  NPP+ NE  G   P   K  A   ++ + E  +R    ++
Sbjct: 122 --EASRLFALAS--FDVVTTNPPYMNESHGLKNPGDAKAIARHEVKCTLEDVVREGTRVL 177

Query: 136 RSSGQLSLIARPQSLIQIVNACARR-IGSLEITPLHPREGECASRILVTGRKGMRGQLRF 194
           +  G+  ++ RP+ LI+I+    R  +    +  +HP     A+ +L+   +G    L+ 
Sbjct: 178 KPGGRFFMVHRPRRLIEIITVMKRHGLEPKRMKMVHPYADREANMVLIEAVRGGGPLLKM 237

Query: 195 RYPIVLHKPNGQ 206
             P+++   NG+
Sbjct: 238 EAPVIVFDQNGE 249


>gi|116514313|ref|YP_813219.1| O-methyltransferase [Lactobacillus delbrueckii subsp. bulgaricus
           ATCC BAA-365]
 gi|116093628|gb|ABJ58781.1| Predicted O-methyltransferase [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC BAA-365]
          Length = 324

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 96/195 (49%), Gaps = 13/195 (6%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + +L +G  AA L +A+  ++A     E    +   AR+++ L     +  RI++ + +V
Sbjct: 38  VVELCSGNAAASLYMAA-FNKAHYDDVELQEDIVSKARRSVELN---DMQDRITVHQGNV 93

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIG--TMTPDKIKEEAHVMLEDSFEKWIRTAC 132
              G     + L+ + YD V++NPP+ +      + PD+ K  A   LE + E+ I  + 
Sbjct: 94  KDAG-----SFLRKDSYDVVVVNPPYFKAPAGHKLNPDRSKAIARHELEINLEEIIAVSA 148

Query: 133 AIMRSSGQLSLIARPQSLIQIVNACARR-IGSLEITPLHPREGECASRILVTG-RKGMRG 190
            +++  G++ ++ RP+ L +I+N   +  +    + P   R G+ A+ ++V   R G   
Sbjct: 149 GLLKMKGKMFMVHRPERLGEIINYGFKHDLAVKTVQPFVSRRGQDANLVIVEAVRSGKGD 208

Query: 191 QLRFRYPIVLHKPNG 205
            L  R  I +H+ +G
Sbjct: 209 GLVLRDAIEVHEADG 223


>gi|121534357|ref|ZP_01666181.1| methyltransferase small [Thermosinus carboxydivorans Nor1]
 gi|121307127|gb|EAX48045.1| methyltransferase small [Thermosinus carboxydivorans Nor1]
          Length = 252

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/211 (23%), Positives = 98/211 (46%), Gaps = 17/211 (8%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA            DLG G G  GL + +R    +++  E   + A  A++++ L   
Sbjct: 36  IVLAHFATVRTGATAVDLGTGTGVIGLLLVAR-GAGRVVGVEIDAVAAERAQRSVQLNG- 93

Query: 61  AQISKRISLIEVDVTLVGENRNLAG-LKNNFYDHVIMNPPFNE-RIGTMTPDKIKEEAHV 118
             ++K+++++  D+      R L G L    +D V+ NPP+     G ++P      A  
Sbjct: 94  --LTKQMAVVAADL------RRLKGVLPAGAWDLVVANPPYRPVGDGRISPRTTVAAARH 145

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE---ITPLHPREGE 175
            L  S    +  A  +++  G+ +++  P+ L +I+NA +     LE   +  +HP   +
Sbjct: 146 ELTASLADVVAAARYLVKYRGRFAMVHLPERLTEIINALSG--AGLEPKRVRFVHPSVDK 203

Query: 176 CASRILVTGRKGMRGQLRFRYPIVLHKPNGQ 206
             + +LV   +G R  L    P++++ P+G+
Sbjct: 204 SPALVLVEAVRGARPGLEVMPPLIVYGPDGR 234


>gi|315223192|ref|ZP_07865053.1| methyltransferase small domain protein [Streptococcus anginosus
           F0211]
 gi|315187624|gb|EFU21378.1| methyltransferase small domain protein [Streptococcus anginosus
           F0211]
          Length = 248

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/198 (22%), Positives = 95/198 (47%), Gaps = 19/198 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL AG GA GL  ++R  +AQI+  E    +A  A +++ L     ++ ++ +I+ D+
Sbjct: 50  IVDLCAGNGAVGLFASTRT-KAQIIAVEIQERLADMAERSIELNG---LTHQMQVIQDDL 105

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLE-----DSFEKWIR 129
             +     + G K    D ++ NPP+           +    H +L       + E+  R
Sbjct: 106 KYL--THYIDGSK---VDMILCNPPY---FKVDEHSNLNASRHYLLARHEIATNLEEICR 157

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNA-CARRIGSLEITPLHPREGECASRILVTG-RKG 187
            +  +++S+G+L+++ RP+  + I++   A  +    I  ++P+    A+ +L+   + G
Sbjct: 158 ISQRVLKSNGRLAMVHRPERFLDIIDTMIAHNLAPKRIQFVYPKANREANMLLIEAIKDG 217

Query: 188 MRGQLRFRYPIVLHKPNG 205
            R  L+   P+ +H  +G
Sbjct: 218 SRDGLKILPPLFIHNEDG 235


>gi|291166621|gb|EFE28667.1| SAM-dependent methyltransferase [Filifactor alocis ATCC 35896]
          Length = 253

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/205 (21%), Positives = 94/205 (45%), Gaps = 9/205 (4%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++L++ +    +F  ADLG G G   + +  + +  +I   E    +A  A++++ L   
Sbjct: 38  VLLSNFIKVRPNFVGADLGTGTGIIPILILGKSNLKKIYAFEIQEEVADMAQRSVLLNG- 96

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
             +  R ++I  D+ L   +     L     D V+ NPP+ +  G    ++ K+ +   +
Sbjct: 97  --LEDRATVICSDLKLANRHIEKCSL-----DFVVSNPPYMKTDGLQNLNEKKKISRHEV 149

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASR 179
           + S E    TA  +++ SG   ++ RP  L  I   C + R+   E+  ++P  G+  + 
Sbjct: 150 KCSLEDIFVTAENLLKVSGVFYMVHRPNRLCDIFELCRKYRLEPKEMRMVYPYVGKAPNL 209

Query: 180 ILVTGRKGMRGQLRFRYPIVLHKPN 204
           +L+   K  +  L+   P+ ++  N
Sbjct: 210 VLLKIVKHGKPDLKLLEPLYVYDEN 234


>gi|313682871|ref|YP_004060609.1| methyltransferase small [Sulfuricurvum kujiense DSM 16994]
 gi|313155731|gb|ADR34409.1| methyltransferase small [Sulfuricurvum kujiense DSM 16994]
          Length = 233

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/194 (22%), Positives = 90/194 (46%), Gaps = 16/194 (8%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + D+GAG+G  GL VA    E  +  +E+  L A +AR+      NAQI+       +  
Sbjct: 32  MLDVGAGSGIVGLLVARDFKEVVLEGSEKQSLYAEFARR------NAQING------IGY 79

Query: 75  TL-VGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACA 133
           TL  G+   L G  +  YD ++ NPPF       + + I  +A   +    E ++     
Sbjct: 80  TLHEGDFLELGG--HGSYDWIVSNPPFYHEGSARSENPILHQARYNIHLPIEAFVTKISK 137

Query: 134 IMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTGRKGMRGQL 192
           +++SSG+ ++    +   ++ +A  +R +  +E+  +H +    +  +++  +K  +  L
Sbjct: 138 LLKSSGEAAICYDARQFAELCSAFESRGLRVVEVQFVHSKADRPSILVMIHVKKNSKSAL 197

Query: 193 RFRYPIVLHKPNGQ 206
               P++  +  G+
Sbjct: 198 TVLPPLITFEEEGR 211


>gi|308066857|ref|YP_003868462.1| hypothetical protein PPE_00022 [Paenibacillus polymyxa E681]
 gi|305856136|gb|ADM67924.1| Conserved hypothetical protein [Paenibacillus polymyxa E681]
          Length = 251

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 55/210 (26%), Positives = 103/210 (49%), Gaps = 26/210 (12%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL  G G   L + +R  +A I   E  P +A  AR++++L     +   I + E   
Sbjct: 49  ILDLCTGNGVVPLLLTTRT-KASIEGIEIQPRLADMARRSVSLNG---LESAIQIRE--- 101

Query: 75  TLVGENRNLAGLKNN-FYDHVIMNPPFNERIGTMTPDKIKEEAHVMLED-----SFEKWI 128
              G+ R L  +  +  YD + +NPP+    G+     IK   H  +       + E+ I
Sbjct: 102 ---GDLRELVHITGHGVYDAITVNPPYMPLNGS----DIKLNPHQAIARHEVNCTLEEVI 154

Query: 129 RTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE---ITPLHPREGECASRILVTGR 185
           + +  ++R+ G++S++ RPQ L +I+     R  SLE   I  +HPR    A+ +LV   
Sbjct: 155 QASTRLVRNGGKVSMVHRPQRLGEIITLM--RNHSLEPKRIRFVHPRVHMEANMVLVEAL 212

Query: 186 KGMRGQLRFRYPIVLHKPNGQPYSRFVTDL 215
           +  + ++R   P+++++ NG  Y++ + D+
Sbjct: 213 RDGKPEVRLLPPLIVYQENGN-YTQEIRDI 241


>gi|253576898|ref|ZP_04854223.1| methyltransferase [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251843765|gb|EES71788.1| methyltransferase [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 251

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 53/224 (23%), Positives = 105/224 (46%), Gaps = 14/224 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA          + DL  G G   L +++R  EA+I   E  P +A  AR+++ +   
Sbjct: 36  VLLARFAPVPKYGKILDLCTGNGVIPLLLSTRT-EAKIEGIEIQPRLADMARRSVEMNG- 93

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNN-FYDHVIMNPPFNERI-GTMTPDKIKEEAHV 118
             ++ RI + E      G+ R L  +  +  YD + +NPP+     G    +  +  A  
Sbjct: 94  --LTHRIEIRE------GDLRELVRVTGHGVYDAITVNPPYMPVTSGEAKLNTYQAIARH 145

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECA 177
            +  S E+    +  ++R  G++S++ RPQ L +I+    + R+    I  +HPR G  A
Sbjct: 146 EIHCSLEEVAAASMRLVRPGGKVSMVHRPQRLGEIMTLLRQYRLEPKVIRFVHPRAGAEA 205

Query: 178 SRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRS 221
           + +L+   +  +  +R   P++++  NG+ Y   + ++  G + 
Sbjct: 206 NMVLIEALRDGKPDVRVLPPLIVYNENGE-YCEEIMNIYYGPKE 248


>gi|104774225|ref|YP_619205.1| hypothetical protein Ldb1346 [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC 11842]
 gi|103423306|emb|CAI98147.1| Conserved hypothetical protein [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC 11842]
          Length = 336

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 96/195 (49%), Gaps = 13/195 (6%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + +L +G  AA L +A+  ++A     E    +   AR+++ L     +  RI++ + +V
Sbjct: 50  VVELCSGNAAASLYMAA-FNKAHYDDVELQEDIVSKARRSVELN---DMQDRITVHQGNV 105

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIG--TMTPDKIKEEAHVMLEDSFEKWIRTAC 132
              G     + L+ + YD V++NPP+ +      + PD+ K  A   LE + E+ I  + 
Sbjct: 106 KDAG-----SFLRKDSYDVVVVNPPYFKAPAGHKLNPDRSKAIARHELEINLEEIIAVSA 160

Query: 133 AIMRSSGQLSLIARPQSLIQIVNACARR-IGSLEITPLHPREGECASRILVTG-RKGMRG 190
            +++  G++ ++ RP+ L +I+N   +  +    + P   R G+ A+ ++V   R G   
Sbjct: 161 GLLKMKGKMFMVHRPERLGEIINYGFKHDLAVKTVQPFVSRRGQDANLVIVEAVRSGKGD 220

Query: 191 QLRFRYPIVLHKPNG 205
            L  R  I +H+ +G
Sbjct: 221 GLVLRDAIEVHEADG 235


>gi|307708382|ref|ZP_07644848.1| methyltransferase [Streptococcus mitis NCTC 12261]
 gi|307615481|gb|EFN94688.1| methyltransferase [Streptococcus mitis NCTC 12261]
          Length = 216

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/200 (22%), Positives = 100/200 (50%), Gaps = 23/200 (11%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + D  AG GA GL  ++R  +AQIL  E    +A  A +++          R++ +E  +
Sbjct: 18  IVDFCAGNGAVGLFASTRT-QAQILAVEIQERLADMAERSV----------RLNGLEEQM 66

Query: 75  TLVGEN-RNL-AGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-----EDSFEKW 127
            ++ ++ +N+ A ++ +  D ++ NPP+           + E  H +L       + ++ 
Sbjct: 67  EVICDDLKNMPAYIQGSKVDMILCNPPY---FKVDPHSNLNESEHYLLARHEITTNLQEI 123

Query: 128 IRTACAIMRSSGQLSLIARPQSLIQIVNACARR-IGSLEITPLHPREGECASRILVTG-R 185
            R+A +I++S+G+L+++ RP  L+ I++   R  +    +  ++P+  + A+ +L+   +
Sbjct: 124 CRSAQSILKSNGRLAMVHRPDRLLDILDTLQRHNLAPKRLQFVYPKREKEANMLLIEAIK 183

Query: 186 KGMRGQLRFRYPIVLHKPNG 205
            G     +   P+++H  +G
Sbjct: 184 DGSTSGFKVLPPLIVHNDDG 203


>gi|182416667|ref|ZP_02948072.1| SAM-dependent methyltransferase [Clostridium butyricum 5521]
 gi|237666253|ref|ZP_04526240.1| methyltransferase small [Clostridium butyricum E4 str. BoNT E
           BL5262]
 gi|182379482|gb|EDT76973.1| SAM-dependent methyltransferase [Clostridium butyricum 5521]
 gi|237658343|gb|EEP55896.1| methyltransferase small [Clostridium butyricum E4 str. BoNT E
           BL5262]
          Length = 250

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 46/224 (20%), Positives = 105/224 (46%), Gaps = 16/224 (7%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++L+   N        DL  G G     +  +    +++  E    M   A +++ L + 
Sbjct: 39  VLLSDFANVKTRHRAIDLCTGTGIVPFLLYGKYSPQEVVGVEIQSDMVEMAERSVKLNS- 97

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKN-NFYDHVIMNPPFN-ERIGTMTP-DKIKEEAH 117
             +  ++S I +D+      +++ GLK    +D + +NPP+     G + P DK+    H
Sbjct: 98  --LESKVSFINLDL------KDIDGLKELGRFDVLTVNPPYKLNNSGIINPLDKLAIARH 149

Query: 118 VMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGEC 176
            ++  + E  I  A  +++ +G++ ++ RP+ L  I     + +I    +  +HP+  + 
Sbjct: 150 EIMC-NLEDVIYAARVLLKDNGRMFIVHRPERLADIFTLMRKYKIEPKRVKMIHPKVNKA 208

Query: 177 ASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKR 220
            + +LV G++     L++  P+ ++  +G+ Y+  + D I G++
Sbjct: 209 PNIVLVEGQRDGGSYLKWDEPLYVYNEDGK-YTEDI-DQIYGRK 250


>gi|322412124|gb|EFY03032.1| Methyltransferase [Streptococcus dysgalactiae subsp. dysgalactiae
           ATCC 27957]
          Length = 284

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 47/214 (21%), Positives = 106/214 (49%), Gaps = 20/214 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G GA GL  ++R  +A I+  E    +A   R+++ L    Q+  ++++I  D+
Sbjct: 76  IVDLCSGNGAVGLFASTRT-KATIVEVELQERLADMGRRSIQL---NQLEDQVTMICDDL 131

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-----EDSFEKWIR 129
             +     L  + ++  D ++ NPP+     +    K     H +L       + E+  +
Sbjct: 132 KYL-----LNHVPHSRVDLILCNPPY---FKSHESSKKNVSEHYLLARHEITTNLEEICQ 183

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTG-RKG 187
            A   ++S+G+L+++ RP   ++I+++  A  +    +  ++P+ G+ A+ +L+   + G
Sbjct: 184 VARHALKSNGRLAMVHRPDRFLEIIDSLRANGLAPKRVQFVYPKLGKAANMLLIEAIKDG 243

Query: 188 MRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRS 221
               +    P+++HK NG+ Y+  + ++  G  S
Sbjct: 244 SIEGMTILPPLIVHKENGE-YTDHIFEIYFGAAS 276


>gi|168187956|ref|ZP_02622591.1| SAM-dependent methyltransferase [Clostridium botulinum C str.
           Eklund]
 gi|169294218|gb|EDS76351.1| SAM-dependent methyltransferase [Clostridium botulinum C str.
           Eklund]
          Length = 247

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 49/213 (23%), Positives = 98/213 (46%), Gaps = 22/213 (10%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+  N   +F++ DL +G G     +A +   + I   E    M   A +++     
Sbjct: 36  VLLANFANVKKNFNVIDLCSGTGIVPFIIAGKTEASNIKGIEIQEEMVEMADRSVKF--- 92

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKN-NFYDHVIMNPPFN-ERIGTMTP-DKI---KE 114
            ++ +++S       L G+ +N+  LK     D V +NPP+     G + P DK+   + 
Sbjct: 93  NKLEEKVSF------LCGDLKNIDVLKKLPKADVVTVNPPYKLANSGIVNPSDKMAIARH 146

Query: 115 EAHVMLEDSFEKWIRTAC-AIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPR 172
           E    LED     +  AC  +++ + ++ ++ RP  L  I+    + +I    I  +HP 
Sbjct: 147 EVCCNLED-----VIIACRTLLKDNKRMYMVHRPDRLADIITLMRKHKIEPKRIQMVHPN 201

Query: 173 EGECASRILVTGRKGMRGQLRFRYPIVLHKPNG 205
             +  + +L+ G++     L++  PI ++  NG
Sbjct: 202 TKKAPNIVLIEGQRDGGAFLKWEPPIYVYNDNG 234


>gi|300812574|ref|ZP_07092991.1| GIY-YIG catalytic domain protein [Lactobacillus delbrueckii subsp.
           bulgaricus PB2003/044-T3-4]
 gi|300496447|gb|EFK31552.1| GIY-YIG catalytic domain protein [Lactobacillus delbrueckii subsp.
           bulgaricus PB2003/044-T3-4]
          Length = 336

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 95/195 (48%), Gaps = 13/195 (6%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + +L +G  AA L +A+  ++A     E    +   AR+++ L     +  RI++ + +V
Sbjct: 50  VVELCSGNAAASLYMAA-FNKAHYDDVELQEDIVSKARRSVELN---DMQDRITVHQGNV 105

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIG--TMTPDKIKEEAHVMLEDSFEKWIRTAC 132
              G     + L+ + YD V++NPP+ +      + PD+ K  A   LE + E+ I  + 
Sbjct: 106 KDAG-----SFLRKDSYDVVVVNPPYFKAPAGHKLNPDRSKAIARHELEINLEEIIAVSA 160

Query: 133 AIMRSSGQLSLIARPQSLIQIVNACARR-IGSLEITPLHPREGECASRILVTG-RKGMRG 190
            +++  G++ ++ RP+ L +I+N   +  +    + P   R G+ A+ ++V   R G   
Sbjct: 161 GLLKMKGKMFMVHRPERLGEIINYGFKHDLAVKTVQPFVSRRGQDANLVIVEAVRSGKGD 220

Query: 191 QLRFRYPIVLHKPNG 205
            L  R  I +H  +G
Sbjct: 221 GLVLRDAIEVHDADG 235


>gi|226309668|ref|YP_002769562.1| hypothetical protein BBR47_00810 [Brevibacillus brevis NBRC 100599]
 gi|226092616|dbj|BAH41058.1| conserved hypothetical protein [Brevibacillus brevis NBRC 100599]
          Length = 255

 Score = 52.8 bits (125), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 58/231 (25%), Positives = 107/231 (46%), Gaps = 27/231 (11%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA   +      + D+  G GA  L + +R  EA     E    +   A + + L   
Sbjct: 39  VLLARFASVPKRGKVLDMCTGNGAIPLIMTTRTPEASFDGIEIQERLFSMASRNVTLNG- 97

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEE----- 115
             +++RI++   DV    +  +L G  N  +D +  NPP+     T     I E      
Sbjct: 98  --LNERITMHHGDVK---DAVSLFGHGN--FDLITCNPPYMP--ATSGEKNISEHFAIAR 148

Query: 116 AHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITP-----LH 170
             +ML  S E  IR    ++++ G+L+L+ R   LI IV +  R+ G   I P     ++
Sbjct: 149 HEIML--SLEDVIRVGSQLLKNGGKLALVHRSTRLIDIV-SLMRQYG---IEPKRMRLVY 202

Query: 171 PREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRS 221
           PR     + +L+ G +G + +LR + P+++++ NG+ Y   + ++  G+R 
Sbjct: 203 PRREAEPNMVLIEGIRGGKPELRIQPPLIVYE-NGEQYCEELQEIYYGRRD 252


>gi|150019695|ref|YP_001311949.1| methyltransferase small [Clostridium beijerinckii NCIMB 8052]
 gi|149906160|gb|ABR36993.1| methyltransferase small [Clostridium beijerinckii NCIMB 8052]
          Length = 249

 Score = 52.8 bits (125), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 46/211 (21%), Positives = 97/211 (45%), Gaps = 16/211 (7%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++L+          + DL  G G     +  +    ++   E    M   A++++ L   
Sbjct: 38  VLLSDFAYIKNKHKVMDLCTGTGIIPFLIYGKYKPERVYGLEIQEDMVDMAKRSVKL--- 94

Query: 61  AQISKRISLIEVDVTLVGEN-RNLAGLKN-NFYDHVIMNPPFN-ERIGTMTP-DKIKEEA 116
                  + +E +V  + E+ +N+  LK  + +D V +NPP+     G + P DK+    
Sbjct: 95  -------NELEGNVCFINEDLKNIDYLKTLDKFDAVTVNPPYKLNNSGIINPNDKLAIAR 147

Query: 117 HVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGE 175
           H +L  + E  I  A  +++ +G+L +I RP+ L  I     + +I    +  +HP+ G+
Sbjct: 148 HEILC-NLEDVISAARILLKDNGRLFMIHRPERLADIFVLMRKYKIEPKRVKMIHPKVGK 206

Query: 176 CASRILVTGRKGMRGQLRFRYPIVLHKPNGQ 206
             + +LV G++     L++  P+ ++  +G+
Sbjct: 207 APNIVLVEGQRDGGAYLKWEAPLYVYDEDGK 237


>gi|297582376|ref|YP_003698156.1| methyltransferase small [Bacillus selenitireducens MLS10]
 gi|297140833|gb|ADH97590.1| methyltransferase small [Bacillus selenitireducens MLS10]
          Length = 241

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 54/221 (24%), Positives = 99/221 (44%), Gaps = 32/221 (14%)

Query: 3   LASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQ 62
            A++   TG   + DL +G GA  L ++ R + A I   E    +   +RKT+A+     
Sbjct: 34  FATITKKTG--RIIDLCSGTGAVPLVMSERTN-AAIDAIEIQEALVTMSRKTMAING--- 87

Query: 63  ISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLED 122
           +S+R+++   DV+  G     A +  N +D V  NPP+          K+ E+A +   D
Sbjct: 88  VSERVTIHHGDVSDAG-----AVVPWNRFDLVTCNPPYF---------KVTEDADLDGHD 133

Query: 123 SF-----------EKWIRTACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLH 170
            F           E  I TA  +++S G+L+++ RP+    I  A  A+R  +  +  +H
Sbjct: 134 PFVVARHEVHLSLEVMIETAKKLLKSKGRLAMVHRPERTGDIFAALEAQRFQAKRMQFVH 193

Query: 171 PREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRF 211
           P +   A+ +L+   +  +  L    P++++         F
Sbjct: 194 PDQSREANMVLIEAVRDGQPGLSVLPPLIVYDETKDFTKEF 234


>gi|315613500|ref|ZP_07888407.1| methyltransferase [Streptococcus sanguinis ATCC 49296]
 gi|315314191|gb|EFU62236.1| methyltransferase [Streptococcus sanguinis ATCC 49296]
          Length = 249

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 45/199 (22%), Positives = 99/199 (49%), Gaps = 21/199 (10%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + D  AG GA GL  +SR  +A+I+  E    +A  A +++ L     + +++ +I  D+
Sbjct: 51  IVDFCAGNGAVGLFASSRT-QARIISVEIQERLADMAERSVQLNG---LEEQMQVICDDL 106

Query: 75  TLVGENRNL-AGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-----EDSFEKWI 128
                 +N+ A ++ +  D ++ NPP+           + E  H +L       + E+  
Sbjct: 107 ------KNMPAHIQGSKVDMILCNPPY---FKVDPHSNLNESEHYLLARHEITTNLEEIC 157

Query: 129 RTACAIMRSSGQLSLIARPQSLIQIVNACARR-IGSLEITPLHPREGECASRILVTG-RK 186
           R+A +I++S+G+L+++ RP  L+ I++   R  +    +  ++P+  + A+ +L+   + 
Sbjct: 158 RSAQSILKSNGRLAMVHRPDRLLDILDMLKRHNLAPKRLQFVYPKREKEANMLLIEAIKD 217

Query: 187 GMRGQLRFRYPIVLHKPNG 205
           G     +   P+++H  +G
Sbjct: 218 GSTSGFKVLPPLIVHNDDG 236


>gi|168493437|ref|ZP_02717580.1| methyltransferase [Streptococcus pneumoniae CDC3059-06]
 gi|225861367|ref|YP_002742876.1| methyltransferase [Streptococcus pneumoniae Taiwan19F-14]
 gi|298230731|ref|ZP_06964412.1| methyltransferase [Streptococcus pneumoniae str. Canada MDR_19F]
 gi|298254948|ref|ZP_06978534.1| methyltransferase [Streptococcus pneumoniae str. Canada MDR_19A]
 gi|298503272|ref|YP_003725212.1| methyltransferase [Streptococcus pneumoniae TCH8431/19A]
 gi|183576396|gb|EDT96924.1| methyltransferase [Streptococcus pneumoniae CDC3059-06]
 gi|225728224|gb|ACO24075.1| methyltransferase [Streptococcus pneumoniae Taiwan19F-14]
 gi|298238867|gb|ADI69998.1| methyltransferase [Streptococcus pneumoniae TCH8431/19A]
 gi|327389722|gb|EGE88067.1| methyltransferase small domain protein [Streptococcus pneumoniae
           GA04375]
 gi|332200098|gb|EGJ14171.1| methyltransferase small domain protein [Streptococcus pneumoniae
           GA47368]
          Length = 249

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 44/200 (22%), Positives = 99/200 (49%), Gaps = 23/200 (11%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + D  AG GA GL  ++R  +AQIL  E    +A  A +++          R++ +E  +
Sbjct: 51  IVDFCAGNGAVGLFASTRT-QAQILSVEIQERLADMAERSV----------RLNGLEEQM 99

Query: 75  TLVGEN-RNL-AGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-----EDSFEKW 127
            ++ ++ +N+ A ++ +  D ++ NPP+           + E  H +L       + E+ 
Sbjct: 100 QVICDDLKNMPAHIQGSKVDMILCNPPY---FKVDPHSNLNESEHYLLARHEITTNLEEI 156

Query: 128 IRTACAIMRSSGQLSLIARPQSLIQIVNACARR-IGSLEITPLHPREGECASRILVTG-R 185
             +A +I++S+G+L+++ RP  L+ I++   R  +    +  ++P+  + A+ +L+   +
Sbjct: 157 CHSAQSILKSNGRLAMVHRPDRLLDILDTLKRHNLAPKRLQFVYPKREKEANMLLIEAIK 216

Query: 186 KGMRGQLRFRYPIVLHKPNG 205
            G     +   P+++H  +G
Sbjct: 217 DGSTSGFKVLPPLIVHNDDG 236


>gi|118445131|ref|YP_879219.1| SAM-dependent methyltransferase [Clostridium novyi NT]
 gi|118135587|gb|ABK62631.1| SAM-dependent methyltransferase [Clostridium novyi NT]
          Length = 247

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 50/213 (23%), Positives = 96/213 (45%), Gaps = 22/213 (10%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+  N    F++ DL +G G     VA +   + I   E    M   A +++     
Sbjct: 36  VLLANFANVKKGFNVIDLCSGTGIVPFIVAGKTEASNITGIEIQEEMVEMADRSVKF--- 92

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKN-NFYDHVIMNPPFN-ERIGTMTP-DKI---KE 114
            ++ +R+  I  D+      +N+  LK     D V +NPP+     G + P DK+   + 
Sbjct: 93  NKLEERVRFICEDL------KNIEALKKLPKADVVTVNPPYKLANSGIVNPSDKMAIARH 146

Query: 115 EAHVMLEDSFEKWIRTAC-AIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPR 172
           E    LED     +  AC  +++ + ++ ++ RP  L  I+    + +I    I  +HP 
Sbjct: 147 EVCCNLED-----VIIACRTLLKDNKRMYMVHRPDRLADIITLMRKHKIEPKRIQMVHPN 201

Query: 173 EGECASRILVTGRKGMRGQLRFRYPIVLHKPNG 205
             +  + +L+ G++     L++  PI ++  NG
Sbjct: 202 TKKAPNIVLIEGQRDGGAFLKWEPPIYVYDDNG 234


>gi|307705997|ref|ZP_07642820.1| methyltransferase small domain protein [Streptococcus mitis SK564]
 gi|307620416|gb|EFN99529.1| methyltransferase small domain protein [Streptococcus mitis SK564]
          Length = 249

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 44/199 (22%), Positives = 98/199 (49%), Gaps = 21/199 (10%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + D  AG GA GL  ++R  +AQIL  E    +A  A +++ L     + +++ +I  D+
Sbjct: 51  IVDFCAGNGAVGLFASTRT-QAQILAVEIQERLADMAERSVRLNG---LEEQMEVICDDL 106

Query: 75  TLVGENRNLAG-LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-----EDSFEKWI 128
                 +N+   ++ +  D ++ NPP+           + E  H +L       + ++  
Sbjct: 107 ------KNMPSRIQGSKVDMILCNPPY---FKVDPHSNLNESEHYLLARHEITTNLQEIC 157

Query: 129 RTACAIMRSSGQLSLIARPQSLIQIVNACARR-IGSLEITPLHPREGECASRILVTG-RK 186
           R+A +I++S+G+L+++ RP  L+ I++   R  +    +  ++P+  + A+ +L+   + 
Sbjct: 158 RSAQSILKSNGRLAMVHRPDRLLDILDTLQRHNLAPKRLQFVYPKREKEANMLLIEAIKD 217

Query: 187 GMRGQLRFRYPIVLHKPNG 205
           G     +   P+++H  +G
Sbjct: 218 GSTSGFKVLPPLIVHNDDG 236


>gi|332686355|ref|YP_004456129.1| putative O-methyltransferase [Melissococcus plutonius ATCC 35311]
 gi|332370364|dbj|BAK21320.1| predicted O-methyltransferase [Melissococcus plutonius ATCC 35311]
          Length = 243

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 39/191 (20%), Positives = 96/191 (50%), Gaps = 13/191 (6%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL AG GA GL ++ +  +A I+  E    +A   ++++ L     + +++++  +D+
Sbjct: 46  IVDLCAGNGAVGLFISKKT-KAPIIQIELQSRLADMGKRSIQL---NHLEQQLTMHTLDL 101

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPF--NERIGTMTPDKIKEEAHVMLEDSFEKWIRTAC 132
                    + +K +  D V+ NPP+   + +    P+     A   +  + E+ I  + 
Sbjct: 102 -----KNATSVIKKDSVDLVVCNPPYFKEQTMSQKNPNIHLAIARHEIYTTLEEVIHVSS 156

Query: 133 AIMRSSGQLSLIARPQSLIQIVNACARR-IGSLEITPLHPREGECASRILVTG-RKGMRG 190
            +++++G+L+++ RP   + ++N   +  I    +  ++P++   A+ +L+ G ++G + 
Sbjct: 157 QLLKTNGRLAMVHRPNRFLDLLNIFEKENIIPKRVQFIYPKQDSEANTLLIEGIKQGKKA 216

Query: 191 QLRFRYPIVLH 201
             R   P++LH
Sbjct: 217 GFRILPPLILH 227


>gi|289168351|ref|YP_003446620.1| hypothetical protein smi_1518 [Streptococcus mitis B6]
 gi|288907918|emb|CBJ22758.1| conserved hypothetical protein [Streptococcus mitis B6]
          Length = 249

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 43/200 (21%), Positives = 99/200 (49%), Gaps = 23/200 (11%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + D  AG GA GL  ++R  +AQIL  E    +A  A +++          R++ +E  +
Sbjct: 51  IVDFCAGNGAVGLFASTRT-QAQILAVEIQERLADMAERSV----------RLNDLEEQM 99

Query: 75  TLVGEN-RNLAG-LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-----EDSFEKW 127
            ++ ++ +N+   ++ +  D ++ NPP+           + E  H +L       + ++ 
Sbjct: 100 EVICDDLKNMPSRIQGSKVDMILCNPPY---FKVDPHSNLNESEHYLLARHEITTNLQEI 156

Query: 128 IRTACAIMRSSGQLSLIARPQSLIQIVNACARR-IGSLEITPLHPREGECASRILVTG-R 185
            R+A +I++S+G+L+++ RP  L+ I++   R  +    +  ++P+  + A+ +L+   +
Sbjct: 157 CRSAQSILKSNGRLAMVHRPDRLLDILDMLQRHNLAPKRLQFVYPKREKEANMLLIEAIK 216

Query: 186 KGMRGQLRFRYPIVLHKPNG 205
            G     +   P+++H  +G
Sbjct: 217 DGSTSGFKVLPPLIVHNDDG 236


>gi|15903434|ref|NP_358984.1| hypothetical protein spr1391 [Streptococcus pneumoniae R6]
 gi|116516448|ref|YP_816825.1| hypothetical protein SPD_1365 [Streptococcus pneumoniae D39]
 gi|148984884|ref|ZP_01818137.1| putative manganese-dependent inorganic pyrophosphatase
           [Streptococcus pneumoniae SP3-BS71]
 gi|148992574|ref|ZP_01822242.1| hypothetical protein CGSSp9BS68_04200 [Streptococcus pneumoniae
           SP9-BS68]
 gi|149021810|ref|ZP_01835817.1| putative manganese-dependent inorganic pyrophosphatase
           [Streptococcus pneumoniae SP23-BS72]
 gi|168484975|ref|ZP_02709920.1| methyltransferase [Streptococcus pneumoniae CDC1873-00]
 gi|168488802|ref|ZP_02713001.1| methyltransferase [Streptococcus pneumoniae SP195]
 gi|168491572|ref|ZP_02715715.1| methyltransferase [Streptococcus pneumoniae CDC0288-04]
 gi|194398665|ref|YP_002038168.1| hypothetical protein SPG_1462 [Streptococcus pneumoniae G54]
 gi|237650218|ref|ZP_04524470.1| hypothetical protein SpneC1_05762 [Streptococcus pneumoniae CCRI
           1974]
 gi|237820899|ref|ZP_04596744.1| hypothetical protein SpneC19_00967 [Streptococcus pneumoniae CCRI
           1974M2]
 gi|15459041|gb|AAL00195.1| Conserved hypothetical protein [Streptococcus pneumoniae R6]
 gi|116077024|gb|ABJ54744.1| conserved hypothetical protein [Streptococcus pneumoniae D39]
 gi|147922906|gb|EDK74022.1| putative manganese-dependent inorganic pyrophosphatase
           [Streptococcus pneumoniae SP3-BS71]
 gi|147928591|gb|EDK79605.1| hypothetical protein CGSSp9BS68_04200 [Streptococcus pneumoniae
           SP9-BS68]
 gi|147930046|gb|EDK81033.1| putative manganese-dependent inorganic pyrophosphatase
           [Streptococcus pneumoniae SP23-BS72]
 gi|172041892|gb|EDT49938.1| methyltransferase [Streptococcus pneumoniae CDC1873-00]
 gi|183572627|gb|EDT93155.1| methyltransferase [Streptococcus pneumoniae SP195]
 gi|183574191|gb|EDT94719.1| methyltransferase [Streptococcus pneumoniae CDC0288-04]
 gi|194358332|gb|ACF56780.1| conserved hypothetical protein [Streptococcus pneumoniae G54]
 gi|301794545|emb|CBW36989.1| conserved hypothetical protein [Streptococcus pneumoniae INV104]
 gi|301800369|emb|CBW33000.1| conserved hypothetical protein [Streptococcus pneumoniae OXC141]
 gi|332072329|gb|EGI82812.1| methyltransferase small domain protein [Streptococcus pneumoniae
           GA17570]
          Length = 249

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 44/200 (22%), Positives = 99/200 (49%), Gaps = 23/200 (11%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + D  AG GA GL  ++R  +AQIL  E    +A  A +++          R++ +E  +
Sbjct: 51  IVDFCAGNGAVGLFASTRT-QAQILSVEIQERLADMAERSV----------RLNGLEEQM 99

Query: 75  TLVGEN-RNL-AGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-----EDSFEKW 127
            ++ ++ +N+ A ++ +  D ++ NPP+           + E  H +L       + E+ 
Sbjct: 100 QVICDDLKNMPAHIQGSKVDMILCNPPY---FKVDPYSNLNESEHYLLARHEITTNLEEI 156

Query: 128 IRTACAIMRSSGQLSLIARPQSLIQIVNACARR-IGSLEITPLHPREGECASRILVTG-R 185
             +A +I++S+G+L+++ RP  L+ I++   R  +    +  ++P+  + A+ +L+   +
Sbjct: 157 CHSAQSILKSNGRLAMVHRPDRLLDILDTLKRHNLAPKRLQFVYPKREKEANMLLIEAIK 216

Query: 186 KGMRGQLRFRYPIVLHKPNG 205
            G     +   P+++H  +G
Sbjct: 217 DGSTSGFKVLPPLIVHNDDG 236


>gi|313891792|ref|ZP_07825397.1| methyltransferase small domain protein [Dialister microaerophilus
           UPII 345-E]
 gi|313119786|gb|EFR42973.1| methyltransferase small domain protein [Dialister microaerophilus
           UPII 345-E]
          Length = 246

 Score = 52.4 bits (124), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 46/207 (22%), Positives = 94/207 (45%), Gaps = 11/207 (5%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA  V+      +ADLG G G   L + S L    I   E +P+MA  A++ ++    
Sbjct: 36  VLLAHYVSIKNKDKIADLGTGTGIIPL-LLSALGAKDIAAFEINPVMADIAKRNVSGNKK 94

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNE-RIGTMTPDKIKEEAHVM 119
             I   I ++E D   + E        +     V+ NPP+ + + G ++  +    A   
Sbjct: 95  NDI---IKVLECDYKKIKEYYPTGSFTS-----VVANPPYRDIKTGKISNKEAVATACYE 146

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECAS 178
           +  + E   +TA  +++  G+L+++ R   L  ++    + ++ +  +  ++ R+   A 
Sbjct: 147 INATIEDVFKTAQYLLKYGGRLTMVHRADRLCDLITYGRKYKMEAKRMRFIYARKKHNAV 206

Query: 179 RILVTGRKGMRGQLRFRYPIVLHKPNG 205
           R+LV  + G   ++    P+ LH  +G
Sbjct: 207 RVLVEWKYGGNVEVTVEPPLFLHYDDG 233


>gi|77919821|ref|YP_357636.1| SAM-dependent methyltransferase [Pelobacter carbinolicus DSM 2380]
 gi|77545904|gb|ABA89466.1| SAM-dependent methyltransferase [Pelobacter carbinolicus DSM 2380]
          Length = 249

 Score = 52.4 bits (124), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 51/216 (23%), Positives = 91/216 (42%), Gaps = 14/216 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++L +     G   + DLG G+G   L ++      +I+  E     A  AR+++ L   
Sbjct: 37  VLLCAFAGFQGVERICDLGCGSGVIPLILSRTSDARRIVGVEIQEESADRARRSVLLNG- 95

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNE-RIGTMTPDKIKEEAHVM 119
             +  R+ ++  DV  V E      L       V+ NPP+     G + P   +  A   
Sbjct: 96  --VQDRVEIVRRDVRSVREV-----LAAESCQVVMTNPPYRRPGTGRLAPGDERARARHE 148

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE---ITPLHPREGEC 176
           L    + ++  A  ++ + G+  ++   + L  ++     R   LE   +  +H R GE 
Sbjct: 149 LHGGLDDFLACASYLLGTGGRFFMVHLAERLTDVLAGM--RQAGLEPKRLRCVHSRYGES 206

Query: 177 ASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFV 212
           A  ILV GR+G    L    P+ ++  +G+ YS  V
Sbjct: 207 ARMILVEGRRGGAPGLALEAPLFVYDKSGKGYSEEV 242


>gi|154684553|ref|YP_001419714.1| YabB [Bacillus amyloliquefaciens FZB42]
 gi|154350404|gb|ABS72483.1| YabB [Bacillus amyloliquefaciens FZB42]
          Length = 247

 Score = 52.4 bits (124), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 52/215 (24%), Positives = 101/215 (46%), Gaps = 23/215 (10%)

Query: 14  HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVD 73
           ++ DL  G G   L +++R  +A I   E    +   A +++       +  +ISLI  D
Sbjct: 48  NIVDLCTGNGIVPLLLSTR-SKADITGVEIQERLYDMALRSVEYNG---LGGQISLIHDD 103

Query: 74  VTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLED-------SFEK 126
           +  + E      L +N YD V  NPP+ +     TP + ++  +  L         + E 
Sbjct: 104 LKNMPER-----LGHNKYDVVTCNPPYFK-----TPKEAEQNLNEHLRIARHEILCTLED 153

Query: 127 WIRTACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTGR 185
            I  +  +++  G+ +L+ RP  L++I     A RI    +  ++P++G+ A+ ILV G 
Sbjct: 154 VISVSSKLLKQGGKAALVHRPGRLLEIFELMKAYRIEPKRVQFIYPKQGKEANTILVEGI 213

Query: 186 KGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKR 220
           KG R  L+   P+ ++    + Y++ +  ++ G +
Sbjct: 214 KGGRPDLKILPPLFVYNEQNE-YTKEIRTILYGDK 247


>gi|291562843|emb|CBL41659.1| Predicted O-methyltransferase [butyrate-producing bacterium SS3/4]
          Length = 245

 Score = 52.4 bits (124), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 40/191 (20%), Positives = 89/191 (46%), Gaps = 10/191 (5%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DLG G G   L ++++         E    +A  A +++ L     + ++I ++  D+  
Sbjct: 51  DLGTGTGIIPLLLSAKTEGEHFSALEIQDEIARMAERSIKL---NHLEEKIEIVHGDIK- 106

Query: 77  VGENRNLAGLKNNFYDHVIMNPPF-NERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIM 135
             E   + G  +  +D V  NPP+ N+  G   P ++K  +   +  + E  +R    ++
Sbjct: 107 --EASRIFGAAS--FDVVTTNPPYMNDAHGLKNPTEVKAISRHEVLCTLEDVVREGAKVL 162

Query: 136 RSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRKGMRGQLRF 194
           +  G++ ++ RP  LI+I+    + ++    +  +HP   + A+ IL+   +G    ++ 
Sbjct: 163 KPGGRMYMVHRPHRLIEILGTMKQYKLEPKRMKMVHPFRDKDANMILIEAVRGGGAWMKV 222

Query: 195 RYPIVLHKPNG 205
             P++++K  G
Sbjct: 223 EAPVIVYKEPG 233


>gi|227499799|ref|ZP_03929894.1| possible methyltransferase [Anaerococcus tetradius ATCC 35098]
 gi|227218103|gb|EEI83371.1| possible methyltransferase [Anaerococcus tetradius ATCC 35098]
          Length = 233

 Score = 52.4 bits (124), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 46/208 (22%), Positives = 86/208 (41%), Gaps = 28/208 (13%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           D+GAG+G     + SR    ++   E     A    + + L     I            L
Sbjct: 44  DIGAGSGVLSFLINSRYKLEKVFAVEIQKEKAKLLEENIKLNGIKNIE-----------L 92

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRT------ 130
           + E+ N   +K N  D++I NPP+ +       D I+ +    L    EK+++       
Sbjct: 93  INEDLNKIIIKENSIDYIITNPPYYK-----ITDNIENKDEEFLISRQEKFLKLSDIFSF 147

Query: 131 ACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRG 190
           A   ++  G+L +I +P+ ++ I N     + +  +  +H +  +    IL+   K  R 
Sbjct: 148 ANKALKDKGKLFMIHKPERMVDIFNQSG-NLKAKTVRFVHSQALKKPQFILIEFVKNARD 206

Query: 191 QLRFRYPIVLHKPNGQPYS---RFVTDL 215
            LR   P++++   G  YS   + + DL
Sbjct: 207 GLRIEDPLIIYDKEG--YSEEMKIINDL 232


>gi|171778645|ref|ZP_02919741.1| hypothetical protein STRINF_00593 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
 gi|171282602|gb|EDT48026.1| hypothetical protein STRINF_00593 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
          Length = 253

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 46/211 (21%), Positives = 103/211 (48%), Gaps = 18/211 (8%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G GA GL  ++R  +A I+  E    +A+ A +++ L    Q+  ++ +I  D+
Sbjct: 50  IVDLCSGNGAIGLFASTRT-KAPIIEVELQERLANMAERSIQL---NQLENQVQMINDDL 105

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAI 134
             +  +   +G+     D ++ NPP+ +   + T  K   E +++        +   C +
Sbjct: 106 KNLLNHVPRSGV-----DLILCNPPYFKV--SETSKKNLSEHYLLARHEIATNLEEICEV 158

Query: 135 ----MRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTG-RKGM 188
               ++S+G+L+++ RP   + I++      +    I  ++P+ G+  + +L+   + G 
Sbjct: 159 ARHALKSNGRLAMVHRPDRFLDIIDTMRHYNLAPKRIQFVYPKMGKDTNMLLIEAIKDGS 218

Query: 189 RGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
              L+   P+ +HK NG+ Y+  + ++  GK
Sbjct: 219 TDGLKILPPLFVHKENGE-YTDDIFEIYYGK 248


>gi|322804332|emb|CBZ01882.1| predicted O-methyltransferase [Clostridium botulinum H04402 065]
          Length = 246

 Score = 52.0 bits (123), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 48/213 (22%), Positives = 97/213 (45%), Gaps = 20/213 (9%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+         + DL +G G     +A + + + I+  E    +A  A++++     
Sbjct: 35  VLLANFPTIKNGAKVVDLCSGTGIISFILAGKTNASNIIGIEIQKEIADMAKRSIKY--- 91

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKN-NFYDHVIMNPPFNER----IGTMTPDKI-KE 114
             + +++  IE      G+ +NL  LK+    D V +NPP+  +    I     + I + 
Sbjct: 92  NNLQEKVRFIE------GDLKNLKLLKDIEKVDVVTVNPPYKTQGTGIININDKNAISRH 145

Query: 115 EAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPRE 173
           E    L+D     ++ A  +++  G+L +I RP  ++ I+N   +  I    I  +HP  
Sbjct: 146 EICCTLDDV----VKAAKVLLKDKGKLYMIHRPDRIVDIMNVMRKYYIEPKLIRTIHPAV 201

Query: 174 GECASRILVTGRKGMRGQLRFRYPIVLHKPNGQ 206
            +  S IL+ G+K     L++  P+ ++  N +
Sbjct: 202 DKPPSMILIEGQKNGGKFLKWDRPLYIYDENNK 234


>gi|320546387|ref|ZP_08040702.1| methyltransferase [Streptococcus equinus ATCC 9812]
 gi|320448772|gb|EFW89500.1| methyltransferase [Streptococcus equinus ATCC 9812]
          Length = 253

 Score = 52.0 bits (123), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 49/211 (23%), Positives = 103/211 (48%), Gaps = 18/211 (8%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G GA GL  ++R  +A I+  E    +A  A +++ L     + +++ +I  D+
Sbjct: 50  IVDLCSGNGAVGLFASTRT-KAPIIEIEIQERLADMAERSIQL---NDLGEQVQMINDDL 105

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAI 134
             + ++    G+     D ++ NPP+ +   + T  K   E +++        +   C I
Sbjct: 106 KNLLKHVPRTGV-----DLILCNPPYFKV--SETSKKNLSEHYLLARHEITTNLEEICDI 158

Query: 135 ----MRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTG-RKGM 188
               ++S+G+L+L+ RP   + I++   +  +    I  ++P+ G+ A+ +LV   + G 
Sbjct: 159 ARHALKSNGRLALVHRPDRFLDIIDILRQYNLAPKRIQFIYPKVGKDANLLLVEAIKDGS 218

Query: 189 RGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
              L+   P+ +HK NG  Y+  + ++  GK
Sbjct: 219 TDGLKILPPLFVHKENGD-YTDEIFEIYYGK 248


>gi|15606087|ref|NP_213464.1| hypothetical protein aq_674 [Aquifex aeolicus VF5]
 gi|2983274|gb|AAC06868.1| hypothetical protein aq_674 [Aquifex aeolicus VF5]
          Length = 239

 Score = 52.0 bits (123), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 48/223 (21%), Positives = 103/223 (46%), Gaps = 27/223 (12%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           + L+ +     ++ + DLGAG G   + +A + +  +++  E    M    RK + L   
Sbjct: 33  LFLSKIKPPKRNYRIIDLGAGFGFLSITLAKK-YGVKVVAFEYDERMVKLLRKNVKLNG- 90

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
             +   + ++E D+  + ++     L    ++ V+ NPPF     +  P+    E +  L
Sbjct: 91  --VEHLVEVVEGDIKEIEKH-----LSRGSFNLVVSNPPFYPINYSPNPEPYHFEVYATL 143

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQI------VNACARRIGSLEITPLHPREG 174
           +D    ++R +  +++  G+L L++    L ++       N   R++  +  TPL     
Sbjct: 144 KD----FVRASSYLLKDGGELYLLSPCFRLYELTEYLSNFNLPLRKLSLIYPTPLK---- 195

Query: 175 ECASRILVT-GRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLI 216
              +R+ +T   K ++GQL    P++++K NG+ Y+  V  L+
Sbjct: 196 --RARLAITVSVKNVKGQLECDKPLIINKENGE-YTEEVKQLL 235


>gi|118579841|ref|YP_901091.1| methyltransferase small [Pelobacter propionicus DSM 2379]
 gi|118502551|gb|ABK99033.1| methyltransferase small [Pelobacter propionicus DSM 2379]
          Length = 268

 Score = 52.0 bits (123), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 48/210 (22%), Positives = 92/210 (43%), Gaps = 16/210 (7%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA  V       LADLG G G   L +  R   A  +  E +  MA  A +      N
Sbjct: 56  LLLADFVACADDARLADLGTGCGVIPLLLCRRFGSATAVGFESNGSMARLAAE------N 109

Query: 61  AQ---ISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF-NERIGTMTPDKIKEEA 116
           A+   + +R + +E D+  +  +  ++      +D V  NPPF   + G ++P   ++ A
Sbjct: 110 ARRNGLEQRAAFVERDILELRRHYPVSS-----FDGVTANPPFRTPQSGRISPRAGRDTA 164

Query: 117 HVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVN-ACARRIGSLEITPLHPREGE 175
                     ++ TA  +++  G++  +  P+ L + ++ A    +  L +  +HP +G 
Sbjct: 165 RHESSAGLSDFLATAKYLVKPGGRIWFVHLPERLAEFIHVAAGLNLSLLRLRMVHPDQGS 224

Query: 176 CASRILVTGRKGMRGQLRFRYPIVLHKPNG 205
            A   L    KG +G      P+++ + +G
Sbjct: 225 PARIFLAELAKGRKGTTMVLPPLLVRRQDG 254


>gi|306829840|ref|ZP_07463027.1| methyltransferase [Streptococcus mitis ATCC 6249]
 gi|304427851|gb|EFM30944.1| methyltransferase [Streptococcus mitis ATCC 6249]
          Length = 249

 Score = 52.0 bits (123), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 45/200 (22%), Positives = 100/200 (50%), Gaps = 23/200 (11%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + D  AG GA GL  +SR  +A+IL  E    +A  A +++          R++ +E  +
Sbjct: 51  IVDFCAGNGAVGLFASSRT-KAKILSVEIQERLADMAERSV----------RLNGLEEQM 99

Query: 75  TLVGEN-RNL-AGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-----EDSFEKW 127
            ++ ++ +N+ A ++ +  D ++ NPP+           + E  H +L       + E+ 
Sbjct: 100 QVICDDLKNMPARVQGSKVDMILCNPPY---FKVDPHSNLNESEHYLLARHEITTNLEEI 156

Query: 128 IRTACAIMRSSGQLSLIARPQSLIQIVNACARR-IGSLEITPLHPREGECASRILVTG-R 185
            R+A +I++S+G+L+++ RP  L+ I++   R  +    +  ++P+  + A+ +L+   +
Sbjct: 157 CRSAQSILKSNGRLAMVHRPDRLLDILDMLQRHNLAPKRLQFVYPKREKEANMLLIEAIK 216

Query: 186 KGMRGQLRFRYPIVLHKPNG 205
            G     +   P+++H  +G
Sbjct: 217 DGSISGFKVLPPLIVHNDDG 236


>gi|304315614|ref|YP_003850759.1| methyltransferase small [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302777116|gb|ADL67675.1| methyltransferase small [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 248

 Score = 52.0 bits (123), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 46/211 (21%), Positives = 93/211 (44%), Gaps = 16/211 (7%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++L++ V       + DLG G G   + +A +     +   E    +A  A++ + L   
Sbjct: 32  ILLSNFVYTKRGDKIIDLGCGTGIIPILIAGKSSNTHVTGVEIQRDVADIAKRNVVL--- 88

Query: 61  AQISKRISLIEVDVTLVGENRNLAG-LKNNFYDHVIMNPPFN-ERIGTMTPDKIKEEAHV 118
             ++ RI +I  D+      RN+   L    YD V  NPP+   + G    ++ +  +  
Sbjct: 89  NNLTDRIEIINDDI------RNIVDKLGVEKYDIVTTNPPYMPHKTGFDKSNESENISRY 142

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE---ITPLHPREGE 175
            +    + +++ A  +++  G+  ++ R   L+ IV     RI +LE   I  +HP   E
Sbjct: 143 EINGGLQDFVKVASKLLKFGGKFFMVHRVDRLVDIVYNL--RICNLEPKKIRFVHPYVEE 200

Query: 176 CASRILVTGRKGMRGQLRFRYPIVLHKPNGQ 206
             + +LV  +KG +  +    P+ ++   G+
Sbjct: 201 KPNLVLVEAKKGAKSGVVIMKPLYIYNREGK 231


>gi|154148405|ref|YP_001406871.1| methyltransferase small [Campylobacter hominis ATCC BAA-381]
 gi|153804414|gb|ABS51421.1| methyltransferase small [Campylobacter hominis ATCC BAA-381]
          Length = 235

 Score = 52.0 bits (123), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 45/196 (22%), Positives = 88/196 (44%), Gaps = 18/196 (9%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQI-SKRISLIEVDVT 75
           D+GAG G  GL +A      +I L E                 N QI  K ++  E+D  
Sbjct: 38  DVGAGCGILGLLLARDFKNFKISLLEIQS-------------ENFQILRKNVTENELDCE 84

Query: 76  LVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIM 135
           ++  + N   L +  +D ++ NPPF     T T ++ K  +   L  S + +I+++   +
Sbjct: 85  ILINDFN-EFLTSQKFDFIVSNPPFYNAKNTKTTNEHKLISKFDLNLSLKDFIKSSSLNL 143

Query: 136 RSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRF 194
           + +G+L      + L +I     A +   L +  +H + G+ ++  L+  +K  +  L+ 
Sbjct: 144 KQNGELIFCYEAKVLSEIFETLKASKFSVLSLKFIHSKVGKESALALIHAKKNSKSGLKI 203

Query: 195 RYPIVLHKPNGQPYSR 210
             P  ++  +G+ YS+
Sbjct: 204 LSPDFMY--DGENYSK 217


>gi|303326131|ref|ZP_07356574.1| N-6 Adenine-specific DNA methylase [Desulfovibrio sp. 3_1_syn3]
 gi|302864047|gb|EFL86978.1| N-6 Adenine-specific DNA methylase [Desulfovibrio sp. 3_1_syn3]
          Length = 316

 Score = 52.0 bits (123), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 58/123 (47%), Gaps = 3/123 (2%)

Query: 92  DHVIMNPPFN-ERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSL 150
           D V+ NPP+     G M+P  ++E A +   D+   + R A  ++   G    I   +SL
Sbjct: 177 DLVLANPPYGLPGRGRMSPSAMRERA-LRDADALRVFCRAAARLLPYRGHFFCIFEARSL 235

Query: 151 IQIVNACAR-RIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYS 209
            ++  A    R+G   I P+ P     A+R+LV  RK    +LR   P+ LH+   +  +
Sbjct: 236 SRLCAALGEARLGPRRIVPVRPHSHSPATRLLVEARKDAAAELRLEAPLTLHRKQSRQAA 295

Query: 210 RFV 212
           R V
Sbjct: 296 RAV 298


>gi|270292436|ref|ZP_06198647.1| methyltransferase [Streptococcus sp. M143]
 gi|270278415|gb|EFA24261.1| methyltransferase [Streptococcus sp. M143]
          Length = 248

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 45/199 (22%), Positives = 99/199 (49%), Gaps = 21/199 (10%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + D  AG GA GL  +SR  +A+I+  E    +A  A +++ L     + +++ +I  D+
Sbjct: 50  IVDFCAGNGAVGLFASSRT-QARIISVEIQERLADMAERSVQLNG---LEEQMRVICDDL 105

Query: 75  TLVGENRNL-AGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLE-----DSFEKWI 128
                 +N+ A ++ +  D ++ NPP+           + E  H +L       + E+  
Sbjct: 106 ------KNMPAHIQGSKVDMILCNPPY---FKVDPHSNLNESEHYLLARHEIATNIEEIC 156

Query: 129 RTACAIMRSSGQLSLIARPQSLIQIVNACARR-IGSLEITPLHPREGECASRILVTG-RK 186
           R+A +I++S+G+L+++ RP  L+ I++   R  +    +  ++P+  + A+ +L+   + 
Sbjct: 157 RSAQSILKSNGRLAMVHRPDRLLDILDMLQRHNLAPKRLQFVYPKREKEANMLLIEAIKD 216

Query: 187 GMRGQLRFRYPIVLHKPNG 205
           G     +   P+++H  +G
Sbjct: 217 GSTSGFKVLPPLIVHNDDG 235


>gi|306824878|ref|ZP_07458222.1| methyltransferase [Streptococcus sp. oral taxon 071 str. 73H25AP]
 gi|304433089|gb|EFM36061.1| methyltransferase [Streptococcus sp. oral taxon 071 str. 73H25AP]
          Length = 249

 Score = 51.6 bits (122), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 46/213 (21%), Positives = 106/213 (49%), Gaps = 24/213 (11%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + D  AG GA GL  +SR  +A+IL  E    +A  A +++          R++ +E  +
Sbjct: 51  IVDFCAGNGAVGLFASSRT-KAKILSVEIQERLADMAERSV----------RLNGLEEQM 99

Query: 75  TLVGEN-RNL-AGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-----EDSFEKW 127
            ++ ++ +N+ A ++ +  D ++ NPP+           + E  H +L       + ++ 
Sbjct: 100 QVICDDLKNMPARIQGSRVDMILCNPPY---FKVDPHSNLNESEHYLLARHEITTNLKEI 156

Query: 128 IRTACAIMRSSGQLSLIARPQSLIQIVNACARR-IGSLEITPLHPREGECASRILVTG-R 185
            R+A +I++S+G+L+++ RP  L+ I++   R  +    +  ++P+  + A+ +L+   +
Sbjct: 157 CRSAQSILKSNGRLAMVHRPDRLLDILDMLQRHNLAPKRLQFVYPKREKEANMLLIEAIK 216

Query: 186 KGMRGQLRFRYPIVLHKPNGQPYSRFVTDLING 218
            G     +   P+++H  +G  Y+  + ++  G
Sbjct: 217 DGSTSGFKVLPPLIVHNDDGS-YTSEIQEIYYG 248


>gi|227892612|ref|ZP_04010417.1| O-methyltransferase [Lactobacillus ultunensis DSM 16047]
 gi|227865597|gb|EEJ73018.1| O-methyltransferase [Lactobacillus ultunensis DSM 16047]
          Length = 343

 Score = 51.6 bits (122), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 53/199 (26%), Positives = 96/199 (48%), Gaps = 19/199 (9%)

Query: 15  LADLGAGAGAAGLAVA--SRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEV 72
           +ADL AG  AA + +A  +R H   I + +       Y++   ++  N ++  RIS+ + 
Sbjct: 50  VADLCAGNCAATIYMAYFNRAHYDAIEIQDEV-----YSQAKRSVELN-KMENRISVYKD 103

Query: 73  DVTLVGENRNLAGLKNNFYDHVIMNPPFNE--RIGTMTPDKIKEEAHVMLEDSFEKWIRT 130
           +V         + L+ + YD V +NPP+ +      + PD+ K  A   L  + E+ I  
Sbjct: 104 NVLNAP-----SFLRKDSYDVVTVNPPYFKAPEGHEVNPDRKKAIARHELLINLEQIIEV 158

Query: 131 ACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE-ITPLHPREGECASRILVTGRK--G 187
           A  +++  G++ ++ RP+ L +I   C +   S++ I P     G+ A+ I++   K  G
Sbjct: 159 ASGLLKMKGRMYMVHRPERLGEICYYCIKHDLSVKMIQPFVSHRGDNANLIIIEAVKHTG 218

Query: 188 MRGQLRFRYPIVLHKPNGQ 206
             G    R  I +H PNG+
Sbjct: 219 TDGA-ELRDAIEVHDPNGE 236


>gi|319938777|ref|ZP_08013141.1| DNA methyltransferase signature protein [Streptococcus anginosus
           1_2_62CV]
 gi|319811827|gb|EFW08093.1| DNA methyltransferase signature protein [Streptococcus anginosus
           1_2_62CV]
          Length = 248

 Score = 51.6 bits (122), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 44/198 (22%), Positives = 94/198 (47%), Gaps = 19/198 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL AG GA GL  ++R  +AQI+  E    +A  A +++ L     ++ ++ +I+ D+
Sbjct: 50  IVDLCAGNGAVGLFASTRT-KAQIIAVEIQERLADMAERSIELNG---LTHQMQVIQDDL 105

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLE-----DSFEKWIR 129
             +     + G K    D ++ NPP+           +    H +L       + E+  +
Sbjct: 106 KYL--THYIDGSK---VDMILCNPPY---FKVDEHSNLNASRHYLLARHEIATNLEEICQ 157

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNA-CARRIGSLEITPLHPREGECASRILVTG-RKG 187
            +  +++S+G L+++ RP+  + I++   A  +    I  ++P+    A+ +L+   + G
Sbjct: 158 ISQRVLKSNGHLAIVHRPERFLDIIDTMIAHNLAPKRIQFVYPKANREANMLLIEAIKDG 217

Query: 188 MRGQLRFRYPIVLHKPNG 205
            R  L+   P+ +H  +G
Sbjct: 218 SRDGLKILPPLFIHNEDG 235


>gi|323127662|gb|ADX24959.1| Methyltransferase [Streptococcus dysgalactiae subsp. equisimilis
           ATCC 12394]
          Length = 284

 Score = 51.6 bits (122), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 47/214 (21%), Positives = 106/214 (49%), Gaps = 20/214 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G GA GL  ++R  +A I+  E    +A   R+++ L    Q+  ++++I  D+
Sbjct: 76  IVDLCSGNGAVGLFASTRT-KAAIVEVELQERLADMGRRSIQL---NQLEDQVTMICDDL 131

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-----EDSFEKWIR 129
             +  +   +G+     D ++ NPP+     +    K     H +L       + E+  +
Sbjct: 132 KHLLNHVPRSGV-----DLMLCNPPY---FKSHESSKKNVSEHYLLARHEITTNLEEICQ 183

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTG-RKG 187
            A   ++S+G+L+++ RP   ++I+++  A  +    +  ++P+ G+ A+ +L+   + G
Sbjct: 184 VARHALKSNGRLAMVHRPDRFLEIIDSLRANGLAPKRVQFVYPKFGKAANMLLIEAIKDG 243

Query: 188 MRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRS 221
               +    P+++HK NG+ Y+  + ++  G  S
Sbjct: 244 SIEGMTILPPLIVHKENGE-YTDHIFEIYFGAAS 276


>gi|302669461|ref|YP_003829421.1| SAM-dependent methyltransferase [Butyrivibrio proteoclasticus B316]
 gi|302393934|gb|ADL32839.1| SAM-dependent methyltransferase [Butyrivibrio proteoclasticus B316]
          Length = 214

 Score = 51.6 bits (122), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 46/217 (21%), Positives = 99/217 (45%), Gaps = 11/217 (5%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++L+   NA       DLG G G   + +A++ +  +++  E     A  A +++ L   
Sbjct: 4   VLLSGFANAPEGGRCLDLGTGTGIIPILMAAKTNARELIGLEIQEASAEMANRSVLL--- 60

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFN-ERIGTMTPDKIKEEAHVM 119
             +  R+ +++ D+    +    A      +D V  NPP+     G   PD  K  A   
Sbjct: 61  NDLEARVKIVQGDIKEADQLFEAAS-----FDVVTSNPPYMIGGHGLQNPDGPKAIARHE 115

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQI-VNACARRIGSLEITPLHPREGECAS 178
           ++   E  I+ A   ++S G+  ++ RP  L +I V     ++    +  ++P   +  S
Sbjct: 116 IKCDLEDVIKAAARCLKSGGKFYMVHRPFRLTEIMVLMHEYKVEPKRMRLVYPFVDKEPS 175

Query: 179 RILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDL 215
            +L+ G +G + ++    P+++++  G+ Y+R + D+
Sbjct: 176 MVLIEGARGGKPRITVEEPLIIYEEQGK-YTREIYDI 211


>gi|310825775|ref|YP_003958132.1| Predicted O-methyltransferase [Eubacterium limosum KIST612]
 gi|308737509|gb|ADO35169.1| Predicted O-methyltransferase [Eubacterium limosum KIST612]
          Length = 263

 Score = 51.6 bits (122), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 52/201 (25%), Positives = 91/201 (45%), Gaps = 11/201 (5%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DLG G G   L +  R    +I   E    M   A +++A      + ++I +I  D+  
Sbjct: 53  DLGTGTGIIPLLLYGRTGAQKIQALEIQENMVEMAGRSIACNG---LEEKIEIIHGDIRN 109

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNE-RIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIM 135
            GE      ++   YD V+ NPP+ +   G   P + K  A   +    E     A  ++
Sbjct: 110 PGEQ-----VRPTSYDVVVSNPPYMKVGHGLKNPMETKAIARHEILCGIEDIAIFAKRML 164

Query: 136 RSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRF 194
           +  G+L LI R   L  I++A    R+    +  +HP   + A+ +LV G K  +  L  
Sbjct: 165 KDRGKLFLIHRADRLADIMSAMRDHRVEPKRLQFIHPYADKPANLVLVEGMKAGKPYLIT 224

Query: 195 RYPIVLHKPNGQPYSRFVTDL 215
             PIV+++ +G+ Y++ + D+
Sbjct: 225 EAPIVVYEKDGR-YTQMINDI 244


>gi|328951766|ref|YP_004369100.1| Methyltransferase type 11 [Desulfobacca acetoxidans DSM 11109]
 gi|328452090|gb|AEB07919.1| Methyltransferase type 11 [Desulfobacca acetoxidans DSM 11109]
          Length = 262

 Score = 51.6 bits (122), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 50/208 (24%), Positives = 92/208 (44%), Gaps = 10/208 (4%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++L+ L +      + DLGAG G   L +A R   +  +  E  P +A  A + + L   
Sbjct: 38  VLLSGLTDLREPEKVVDLGAGCGILALLLACRFPNSSFVGVELQPSLAALAVRNVRLNG- 96

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERI-GTMTPDKIKEEAHVM 119
                RI +++ D+  +     L     + ++ V+ NPP+     G + P   +  A   
Sbjct: 97  --FEGRIEIVQSDMQSL-----LQLYPPSSFEVVVSNPPYRPLASGRLNPAAERAIARHE 149

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECAS 178
           L+ S E   R +  ++   G+L LI   + L+ +       R+   ++  +H   GE AS
Sbjct: 150 LQGSLELTARISQHLLGYGGRLYLIYPARRLVHLCRGLRLHRLEPKKMRLIHSLPGEEAS 209

Query: 179 RILVTGRKGMRGQLRFRYPIVLHKPNGQ 206
            + +  RKG R  L+   P+V+++  G 
Sbjct: 210 LVWIEARKGGREDLKVLPPLVIYRGPGH 237


>gi|168181163|ref|ZP_02615827.1| conserved hypothetical protein [Clostridium botulinum NCTC 2916]
 gi|226947286|ref|YP_002802377.1| hypothetical protein CLM_0103 [Clostridium botulinum A2 str. Kyoto]
 gi|182667993|gb|EDT79972.1| conserved hypothetical protein [Clostridium botulinum NCTC 2916]
 gi|226844213|gb|ACO86879.1| conserved hypothetical protein [Clostridium botulinum A2 str.
           Kyoto]
          Length = 246

 Score = 51.6 bits (122), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 48/213 (22%), Positives = 96/213 (45%), Gaps = 20/213 (9%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+         + DL +G G     +A + + + I+  E    +A  A +++     
Sbjct: 35  VLLANFPTIKNGAKVVDLCSGTGIIPFILAGKTNASNIIGIEIQKEIADMANRSIKY--- 91

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKN-NFYDHVIMNPPFNER----IGTMTPDKI-KE 114
             + +++  IE      G+ +NL  LK+    D V +NPP+  +    I     + I + 
Sbjct: 92  NNLQEKVKFIE------GDLKNLKLLKDIEKVDVVTVNPPYKTQGTGIININDKNAISRH 145

Query: 115 EAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPRE 173
           E    L+D     ++ A  +++  G+L +I RP  ++ I+N   +  I    I  +HP  
Sbjct: 146 EICCTLDDV----VKAAKVLLKDKGKLYMIHRPDRIVDIMNVMRKYYIEPKLIRTIHPAV 201

Query: 174 GECASRILVTGRKGMRGQLRFRYPIVLHKPNGQ 206
            +  S IL+ G+K     L++  P+ ++  N +
Sbjct: 202 DKAPSMILIEGQKNGGKFLKWDRPLYIYDENNK 234


>gi|288554640|ref|YP_003426575.1| hypothetical protein BpOF4_08125 [Bacillus pseudofirmus OF4]
 gi|288545800|gb|ADC49683.1| hypothetical protein BpOF4_08125 [Bacillus pseudofirmus OF4]
          Length = 246

 Score = 51.6 bits (122), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 88/205 (42%), Gaps = 20/205 (9%)

Query: 14  HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVD 73
           ++ DL +G G   L +++R  +A I   E    +   AR+   L    Q        ++ 
Sbjct: 48  NILDLCSGNGVIPLVLSTRT-KATITGVEIQERLWDMARRNEELNKLNQ--------QLH 98

Query: 74  VTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDK------IKEEAHVMLEDSFEKW 127
             L   N     +K   +D V  NPP+ E +     +K       + E H  LED     
Sbjct: 99  FELADLNHLPPSIKKGSFDVVTCNPPYFETVSEEEKNKNLHLAIARHEIHCSLEDV---- 154

Query: 128 IRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRK 186
           IR     ++  G+++L+ RP+ L  I+      RI    +  +HP++G+ A+ +L+ G K
Sbjct: 155 IRVCSQYVKQKGKVTLVHRPERLGDIIYLMKNYRIEPKRMQLVHPKKGKDANIVLIEGIK 214

Query: 187 GMRGQLRFRYPIVLHKPNGQPYSRF 211
                L+   PI ++  +G+    F
Sbjct: 215 DGSSGLKCLPPITVYGLDGEYTKEF 239


>gi|148378068|ref|YP_001252609.1| hypothetical protein CBO0060 [Clostridium botulinum A str. ATCC
           3502]
 gi|153931253|ref|YP_001382467.1| hypothetical protein CLB_0096 [Clostridium botulinum A str. ATCC
           19397]
 gi|153935508|ref|YP_001386019.1| hypothetical protein CLC_0108 [Clostridium botulinum A str. Hall]
 gi|148287552|emb|CAL81616.1| conserved hypothetical protein [Clostridium botulinum A str. ATCC
           3502]
 gi|152927297|gb|ABS32797.1| conserved hypothetical protein [Clostridium botulinum A str. ATCC
           19397]
 gi|152931422|gb|ABS36921.1| conserved hypothetical protein [Clostridium botulinum A str. Hall]
          Length = 246

 Score = 51.6 bits (122), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 48/213 (22%), Positives = 96/213 (45%), Gaps = 20/213 (9%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+         + DL +G G     +A + + + I+  E    +A  A +++     
Sbjct: 35  VLLANFPTIKNGAKVVDLCSGTGIIPFILAGKTNASNIIGIEIQKEIADMANRSIKY--- 91

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKN-NFYDHVIMNPPFNER----IGTMTPDKI-KE 114
             + +++  IE      G+ +NL  LK+    D V +NPP+  +    I     + I + 
Sbjct: 92  NNLQEKVKFIE------GDLKNLKLLKDIEKVDVVTVNPPYKTQGTGIININDKNAISRH 145

Query: 115 EAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPRE 173
           E    L+D     ++ A  +++  G+L +I RP  ++ I+N   +  I    I  +HP  
Sbjct: 146 EICCTLDDV----VKAAKVLLKDKGKLYMIHRPDRIVDIMNVMRKYYIEPKLIRTIHPAV 201

Query: 174 GECASRILVTGRKGMRGQLRFRYPIVLHKPNGQ 206
            +  S IL+ G+K     L++  P+ ++  N +
Sbjct: 202 DKAPSMILIEGQKNGGKFLKWDRPLYIYDENNK 234


>gi|309390256|gb|ADO78136.1| methyltransferase small [Halanaerobium praevalens DSM 2228]
          Length = 239

 Score = 51.6 bits (122), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 46/215 (21%), Positives = 96/215 (44%), Gaps = 18/215 (8%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+ V       + DLG G+G   L +A +  E ++   E     A  A+K +     
Sbjct: 28  VLLANFVKLRRGDQVIDLGTGSGVIPLLLAYKNPEIKVTGVEIQAEAAALAQKNVEFN-- 85

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVM- 119
             +S++I ++  D+  +      +  K   +D V+ NPP+      +   K+KE  +V  
Sbjct: 86  -NLSEQIEIVNQDLCTLD-----SKYKTGSFDVVVSNPPY----LPVASGKLKENDYVAI 135

Query: 120 ----LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARR-IGSLEITPLHPREG 174
               L+   E  +  A  +++  G   L+ R + L +++   AR    + E+  +  R+ 
Sbjct: 136 ARHELKADLEAVVAEAARLLKYGGHFFLVHRAERLTEVIETLARHNCQAKELRLVQARQD 195

Query: 175 ECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYS 209
           + A   L+  +KG    LR +  +++++ +   Y+
Sbjct: 196 KEADIFLLKAKKGANPGLRVKPVLIIYQADSSEYT 230


>gi|168185098|ref|ZP_02619762.1| conserved hypothetical protein [Clostridium botulinum Bf]
 gi|237793374|ref|YP_002860926.1| hypothetical protein CLJ_B0094 [Clostridium botulinum Ba4 str. 657]
 gi|182671844|gb|EDT83805.1| conserved hypothetical protein [Clostridium botulinum Bf]
 gi|229263312|gb|ACQ54345.1| conserved hypothetical protein [Clostridium botulinum Ba4 str. 657]
          Length = 246

 Score = 51.2 bits (121), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 49/213 (23%), Positives = 95/213 (44%), Gaps = 20/213 (9%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++L +         + DL +G G     +A + + + I+  E    +A  A +++     
Sbjct: 35  VLLGNFPTIKNGAKVVDLCSGTGIIPFILAGKTNASNIIGIEIQKEIADMANRSIKY--- 91

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKN-NFYDHVIMNPPFNER----IGTMTPDKI-KE 114
             + K++  IE      G+ +NL  LK+    D V +NPP+  +    I     + I + 
Sbjct: 92  NNLQKKVRFIE------GDLKNLKLLKDIEKVDVVTVNPPYKTQGTGIININDKNAISRH 145

Query: 115 EAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPRE 173
           E    L+D     ++ A  ++R  G+L +I RP  ++ I+N   +  I    I  +HP  
Sbjct: 146 EICCTLDDV----VKAAKVLLRDKGKLYMIHRPDRIVDIMNVMRKYYIEPKLIRTIHPAV 201

Query: 174 GECASRILVTGRKGMRGQLRFRYPIVLHKPNGQ 206
            +  S IL+ G+K     L++  P+ ++  N +
Sbjct: 202 DKPPSMILIEGQKNGGKFLKWDRPLYIYDENNK 234


>gi|330718871|ref|ZP_08313471.1| O-methyltransferase [Leuconostoc fallax KCTC 3537]
          Length = 254

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 49/206 (23%), Positives = 99/206 (48%), Gaps = 14/206 (6%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DLG+G GA GL  A ++    + L E  P +A  +++++       + +R+S++  D+  
Sbjct: 54  DLGSGTGAVGLLYAPKI-TGIVKLVEIQPELAEMSQRSI---VTNHLQERVSVVNRDMNT 109

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNERIGTMTP--DKIKEEAHVMLEDSFEKWIRTACAI 134
           + ++     +K    + V+ NPP+     T     D+  E A   L     K  + A  +
Sbjct: 110 IFDD-----IKPGSVETVLSNPPYFPLNATTKTNIDRHYELARHELTIDLPKLAQIANKL 164

Query: 135 MRSSGQLSLIARPQSLIQIVNACA-RRIGSLEITPLHPREGECASRILVTGRK-GMRGQL 192
           ++++G+  ++ RP+ L  I  A A R++    +  ++ + G  A+ +LV   K G  G +
Sbjct: 165 LKNNGKFYMVHRPERLTDIFAAFAERKLMIKRVQFVYGKAGREANMVLVEAIKAGKPGGV 224

Query: 193 RFRYPIVLHKPNGQPYSRFVTDLING 218
           R   PI+ +  +   Y+  V +++ G
Sbjct: 225 RILPPIIAYTEDNA-YTSQVHEILYG 249


>gi|168334101|ref|ZP_02692314.1| Methyltransferase type 11 [Epulopiscium sp. 'N.t. morphotype B']
          Length = 248

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/207 (21%), Positives = 93/207 (44%), Gaps = 11/207 (5%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + D+G G G   L + +   + + +  +    M   A +T+ L    Q+S  I +  +D+
Sbjct: 49  ILDIGTGTGIIPLILYAIHKKGKFVGIDIQEAMVEMASRTMML---NQVSNEIEIKCLDI 105

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNE-RIGTMTPDKIKEEAHVMLEDSFEKWIRTACA 133
              G++      K   +D ++ NPP+ +   G       K  A   +    E  I+ +  
Sbjct: 106 KNFGQD-----FKRGSFDIIVSNPPYMKAETGLKNSSATKTIARHEVACDLEDIIKASNF 160

Query: 134 IMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRKGMRGQL 192
           I++  GQL LI R   L+ I+N   + +I   ++  ++P+  +  + +L+   KG    L
Sbjct: 161 ILKERGQLFLIHRANRLVDILNLLRQNKIEPKQLRMIYPKIXKPPTMVLIHAVKGGGLDL 220

Query: 193 RFRYPIVLHKPNGQPYSRFVTDLINGK 219
           R   P++++  +   Y++ + D+   K
Sbjct: 221 RIEKPLIVYNEDN-TYTQEIYDIYEKK 246


>gi|168215155|ref|ZP_02640780.1| conserved hypothetical protein [Clostridium perfringens CPE str.
           F4969]
 gi|170713428|gb|EDT25610.1| conserved hypothetical protein [Clostridium perfringens CPE str.
           F4969]
          Length = 256

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/226 (22%), Positives = 102/226 (45%), Gaps = 18/226 (7%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+  N      + DL  G G     +  + +  +++  E     A  A ++  +   
Sbjct: 43  VLLANFANVNRKHSVLDLCTGTGIIPFIIYGKKNPKEVVGIEIQEEFAEMANRSAKI--- 99

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFN-ERIGTMTP-DKIKEEAHV 118
             I  ++S +  D+     N+++       +D V +NPP+     G + P DK+    H 
Sbjct: 100 NNIEDKVSFVCGDLKDKELNKSMPK-----FDVVTVNPPYKLNNAGIVNPEDKLAIARHE 154

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE---ITPLHPREGE 175
           ++  + E  I  +   ++ +G+L ++ RP+ L  I   C  R   +E   +  +HP   +
Sbjct: 155 IM-CNLEDVIAASRRFLKDNGRLYMVHRPERLADIF--CLMRKYKIEPKRVRMVHPNTKK 211

Query: 176 CASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRS 221
            A+ +LV G++     L++  P+ ++K  G  YS  + D I G+ S
Sbjct: 212 AANIVLVEGQRDGGAFLKWEAPLYVYKDEGG-YSEEI-DKIYGRES 255


>gi|126728320|ref|ZP_01744136.1| N-6 Adenine-specific DNA methylase [Sagittula stellata E-37]
 gi|126711285|gb|EBA10335.1| N-6 Adenine-specific DNA methylase [Sagittula stellata E-37]
          Length = 245

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 60/201 (29%), Positives = 87/201 (43%), Gaps = 10/201 (4%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           +ILA+ V A     + +LG G GAA   +  R+    +   E  P  A  AR+ LA   N
Sbjct: 22  VILAASVQACAGETVLELGCGGGAALCCLGWRVPGLTLTGLEIQPGYADLARRNLA--GN 79

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
               +   + E DV         A LK   +DHVI NPP+ E    +             
Sbjct: 80  GLAGE---IHEGDVAA-----PPAALKARSFDHVIANPPYFETGKGLLALDGGRGRGRTG 131

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI 180
           +     W+ TA   ++  G  + I R + L +++ A    +G LE+ PL PR G     +
Sbjct: 132 DVPLSVWVETAARRLKPRGHATFIQRVERLPELMAAMQAVLGGLELLPLLPRPGRPPRLV 191

Query: 181 LVTGRKGMRGQLRFRYPIVLH 201
           L+ GRK  R   RF  P V+H
Sbjct: 192 LLRGRKEARTPFRFYPPKVIH 212


>gi|326801027|ref|YP_004318846.1| methyltransferase small [Sphingobacterium sp. 21]
 gi|326551791|gb|ADZ80176.1| methyltransferase small [Sphingobacterium sp. 21]
          Length = 241

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 52/199 (26%), Positives = 80/199 (40%), Gaps = 26/199 (13%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++L +L +      + D+G+G G   + +A R   A I   E+  L A  + K      N
Sbjct: 30  VLLGALADHPSPNRILDIGSGTGVIAMMMAQRFPHAIIDAVEKDELAAQLSDK------N 83

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
            + S   + I    TL  E    A      YD ++ NPPF        PDK K  A    
Sbjct: 84  FKNSIFFNRIRAHCTLFQEFAPPA-----LYDLIVSNPPFFLN-ALQNPDKRKSIARHTD 137

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPR-------- 172
              + + I+ A + +   GQL L+  P     +++   R     ++T  HP         
Sbjct: 138 ASFYRELIQKAWSWLNDGGQLQLVLPP-----VISTSVREYAD-KLTDFHPAKAIHIKSF 191

Query: 173 EGECASRILVTGRKGMRGQ 191
           E E A R ++  RKG R Q
Sbjct: 192 ESEDAFRQIICLRKGERMQ 210


>gi|308171925|ref|YP_003918630.1| methyltransferase [Bacillus amyloliquefaciens DSM 7]
 gi|307604789|emb|CBI41160.1| putative methyltransferase [Bacillus amyloliquefaciens DSM 7]
 gi|328909995|gb|AEB61591.1| putative methyltransferase [Bacillus amyloliquefaciens LL3]
          Length = 247

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 52/214 (24%), Positives = 101/214 (47%), Gaps = 25/214 (11%)

Query: 14  HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVD 73
           ++ DL  G G   L +++R  +A I   E    +   A +++       +  +ISLI  D
Sbjct: 48  NIVDLCTGNGIVPLLLSTR-SKADITGVEIQERLYDMALRSVEYNG---LGGQISLIHDD 103

Query: 74  VTLVGENRNLAG-LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLED-------SFE 125
           +      +N+   L +N YD V  NPP+ +     TP + ++  +  L         + E
Sbjct: 104 L------KNMPDRLGHNKYDVVTCNPPYFK-----TPKEAEQNLNEHLRIARHEILCTLE 152

Query: 126 KWIRTACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTG 184
             I  +  +++  G+ +L+ RP  L++I     A RI    +  ++P++G+ A+ ILV G
Sbjct: 153 DVISVSSKLLKQGGKAALVHRPGRLLEIFELMKAYRIEPKRVQFIYPKQGKEANTILVEG 212

Query: 185 RKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLING 218
            KG R  L+   P+ ++    + Y++ +  ++ G
Sbjct: 213 IKGGRPDLKILPPLFVYNEQNE-YTKEIRTILYG 245


>gi|293365817|ref|ZP_06612522.1| conserved hypothetical protein [Streptococcus oralis ATCC 35037]
 gi|307703313|ref|ZP_07640258.1| methyltransferase small domain protein [Streptococcus oralis ATCC
           35037]
 gi|322375582|ref|ZP_08050094.1| methyltransferase [Streptococcus sp. C300]
 gi|291315641|gb|EFE56089.1| conserved hypothetical protein [Streptococcus oralis ATCC 35037]
 gi|307623179|gb|EFO02171.1| methyltransferase small domain protein [Streptococcus oralis ATCC
           35037]
 gi|321279290|gb|EFX56331.1| methyltransferase [Streptococcus sp. C300]
          Length = 249

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/199 (22%), Positives = 99/199 (49%), Gaps = 21/199 (10%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + D  AG GA GL  +SR  +A+I+  E    +A  A +++ L     + +++ +I  D+
Sbjct: 51  IVDFCAGNGAVGLFASSRT-QARIISVEIQERLADMAERSVQLNG---LEEQMQVICDDL 106

Query: 75  TLVGENRNL-AGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-----EDSFEKWI 128
                 +N+ A ++ +  D ++ NPP+           + E  H +L       + ++  
Sbjct: 107 ------KNMPAHIQGSKVDMILCNPPY---FKVDPHSNLNESEHYLLARHEITTNLKEIC 157

Query: 129 RTACAIMRSSGQLSLIARPQSLIQIVNACARR-IGSLEITPLHPREGECASRILVTG-RK 186
           R+A +I++S+G+L+++ RP  L+ I++   R  +    +  ++P+  + A+ +L+   + 
Sbjct: 158 RSAQSILKSNGRLAMVHRPDRLLDILDMLQRHNLAPKRLQFVYPKREKEANMLLIEAIKD 217

Query: 187 GMRGQLRFRYPIVLHKPNG 205
           G     +   P+++H  +G
Sbjct: 218 GSTSGFKVLPPLIVHNDDG 236


>gi|110800155|ref|YP_694735.1| hypothetical protein CPF_0275 [Clostridium perfringens ATCC 13124]
 gi|110674802|gb|ABG83789.1| conserved hypothetical protein [Clostridium perfringens ATCC 13124]
          Length = 249

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 53/226 (23%), Positives = 103/226 (45%), Gaps = 18/226 (7%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+  N      + DL  G G     +  + +  +++  E     A  A ++  +   
Sbjct: 36  VLLANFANVNRKHSVLDLCTGTGIIPFIIYGKKNPKEVVGIEIQEEFAEMANRSAKI--- 92

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFN-ERIGTMTP-DKIKEEAHV 118
             I  ++S +  D+    +++ L  L   F D V +NPP+     G + P DK+    H 
Sbjct: 93  NNIEDKVSFVCGDL----KDKELNKLMPKF-DVVTVNPPYKLNNAGIVNPEDKLAIARHE 147

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE---ITPLHPREGE 175
           ++  + E  I  +   ++ +G+L ++ RP+ L  I   C  R   +E   +  +HP   +
Sbjct: 148 IMC-NLEDVIAVSRRFLKDNGRLYMVHRPERLADIF--CLMRKYKIEPKRVRMVHPNTKK 204

Query: 176 CASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRS 221
            A+ +LV G++     L++  P+ ++K  G  YS  + D I G+ S
Sbjct: 205 AANIVLVEGQRDGGAFLKWEAPLYVYKDEGG-YSEEI-DKIYGRES 248


>gi|170759978|ref|YP_001785391.1| hypothetical protein CLK_3237 [Clostridium botulinum A3 str. Loch
           Maree]
 gi|169406967|gb|ACA55378.1| conserved hypothetical protein [Clostridium botulinum A3 str. Loch
           Maree]
          Length = 246

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/209 (21%), Positives = 95/209 (45%), Gaps = 12/209 (5%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+         + DL +G G     +A + + + I+  E    +A  A +++     
Sbjct: 35  VLLANFPTIKNGAKVVDLCSGTGIIPFILAGKTNASNIIGIEIQKEIADMANRSIKY--- 91

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKN-NFYDHVIMNPPFNER-IGTMTPDKIKEEAHV 118
             + +++  IE      G+ +NL  LK+    D V +NPP+  +  G +  +     +  
Sbjct: 92  NNLQEKVKFIE------GDLKNLKLLKDIEKVDVVTVNPPYKTQGTGIININDKNAISRH 145

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECA 177
            +  + +  ++ A  +++  G+L +I RP  ++ I+N   +  I    I  +HP   +  
Sbjct: 146 EICCNLDDVVKAAKVLLKDKGKLYMIHRPDRIVDIMNVMRKYYIEPKLIRTIHPAVDKAP 205

Query: 178 SRILVTGRKGMRGQLRFRYPIVLHKPNGQ 206
           S IL+ G+K     L++  P+ ++  N +
Sbjct: 206 SMILIEGQKNGGKFLKWDRPLYIYDENNK 234


>gi|307720668|ref|YP_003891808.1| methyltransferase small [Sulfurimonas autotrophica DSM 16294]
 gi|306978761|gb|ADN08796.1| methyltransferase small [Sulfurimonas autotrophica DSM 16294]
          Length = 231

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 49/210 (23%), Positives = 88/210 (41%), Gaps = 40/210 (19%)

Query: 6   LVNATGSFH----LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANA 61
           L +   SFH    + D+GAG G  GL VA    + ++   E+     H+ +       NA
Sbjct: 19  LYDFINSFHPKGKVLDVGAGCGIVGLLVARDNKKVELEAVEKQEAFIHFCK------TNA 72

Query: 62  QISK-RISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
           +++     L E D   + E         N YD++I NPPF        P  +++  + ML
Sbjct: 73  RVNNISYKLYECDFLELTE--------KNKYDYIISNPPF-------YPAGVQKSQNEML 117

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQS-LIQIVNA------CAR----RIGSLEITPL 169
              F         + +   ++S + RPQS  I   +A      CA     ++  +++  +
Sbjct: 118 ---FNARYNVNLPLDKFFQKVSRLLRPQSHFIFCYDATQFGLVCAELDKVKMKIVDVQFV 174

Query: 170 HPREGECASRILVTGRKGMRGQLRFRYPIV 199
           HP+    AS +++  R G +  ++   P +
Sbjct: 175 HPKIDRSASLVMIHARNGSKSMIKVWPPFI 204


>gi|168218269|ref|ZP_02643894.1| conserved hypothetical protein [Clostridium perfringens NCTC 8239]
 gi|182379728|gb|EDT77207.1| conserved hypothetical protein [Clostridium perfringens NCTC 8239]
          Length = 256

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/226 (22%), Positives = 102/226 (45%), Gaps = 18/226 (7%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+  N      + DL  G G     +  + +  +++  E     A  A ++  +   
Sbjct: 43  VLLANFANVNRKHSVLDLCTGTGIIPFIIYGKKNPKEVVGIEIQEEFAEMANRSAKI--- 99

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFN-ERIGTMTP-DKIKEEAHV 118
             I  ++S +  D+     N+++       +D V +NPP+     G + P DK+    H 
Sbjct: 100 NNIQDKVSFVCGDLKDKELNKSMPK-----FDVVTVNPPYKLNNAGIVNPEDKLAIARHE 154

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE---ITPLHPREGE 175
           ++  + E  I  +   ++ +G+L ++ RP+ L  I   C  R   +E   +  +HP   +
Sbjct: 155 IMC-NLEDVIAASRRFLKDNGRLYMVHRPERLADIF--CLMRKYKIEPKRVRMVHPNTKK 211

Query: 176 CASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRS 221
            A+ +LV G++     L++  P+ ++K  G  YS  + D I G+ S
Sbjct: 212 AANIVLVEGQRDGGAFLKWEAPLYVYKDEGG-YSEEI-DKIYGRES 255


>gi|153938423|ref|YP_001389425.1| hypothetical protein CLI_0117 [Clostridium botulinum F str.
           Langeland]
 gi|152934319|gb|ABS39817.1| conserved hypothetical protein [Clostridium botulinum F str.
           Langeland]
 gi|295317535|gb|ADF97912.1| conserved hypothetical protein [Clostridium botulinum F str.
           230613]
          Length = 246

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 48/213 (22%), Positives = 96/213 (45%), Gaps = 20/213 (9%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+         + DL +G G     +A + + + I+  E    +A  A++++     
Sbjct: 35  VLLANFPTIKNGAKVVDLCSGTGIISFILAGKTNASNIIGIEIQKEIADMAKRSIKY--- 91

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKN-NFYDHVIMNPPFNER----IGTMTPDKI-KE 114
             + +++  IE      G+ +NL  LK     D V +NPP+  +    I     + I + 
Sbjct: 92  NNLQEKVRFIE------GDLKNLKLLKGIEKVDVVTVNPPYKTQGTGIININDKNAISRH 145

Query: 115 EAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPRE 173
           E    L+D     ++ A  +++  G+L +I RP  ++ I+N   +  I    I  +HP  
Sbjct: 146 EICCTLDDV----VKAAKVLLKDKGKLYMIHRPDRIVDIMNVMRKYYIEPKLIRTIHPAV 201

Query: 174 GECASRILVTGRKGMRGQLRFRYPIVLHKPNGQ 206
            +  S IL+ G+K     L++  P+ ++  N +
Sbjct: 202 DKPPSMILIEGQKNGGKFLKWDRPLYIYDENNK 234


>gi|300853355|ref|YP_003778339.1| putative methyltransferase [Clostridium ljungdahlii DSM 13528]
 gi|300433470|gb|ADK13237.1| predicted methyltransferase [Clostridium ljungdahlii DSM 13528]
          Length = 250

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/211 (21%), Positives = 90/211 (42%), Gaps = 18/211 (8%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+        ++ DL +G G     +A +     I   E    M   A +++     
Sbjct: 36  VLLANFAKIKPKMNIIDLCSGTGIVPFIIAGKTKAQHITGMEIQKDMVDMATRSVIFNG- 94

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKI-----KEE 115
             + K++  I  D+      + L        D V +NPP+  +   +T D+      + E
Sbjct: 95  --MEKKVEFIHRDLVDFEFLKKLPKA-----DVVTVNPPYKLKNSGITNDQYENAISRHE 147

Query: 116 AHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREG 174
               LED     I+ A  +++ +G+L +I RP  L+ I+    +  I    +T + P   
Sbjct: 148 ICCTLEDV----IKAAKILLKDNGKLYMIHRPDRLVDIMYTMRKYNIEPKLMTMVQPCVN 203

Query: 175 ECASRILVTGRKGMRGQLRFRYPIVLHKPNG 205
           +  + +L+ G+   +  L++  PI +HK +G
Sbjct: 204 KAPNMVLIEGQNNGKPFLKWEVPICVHKLDG 234


>gi|168211815|ref|ZP_02637440.1| conserved hypothetical protein [Clostridium perfringens B str. ATCC
           3626]
 gi|170710232|gb|EDT22414.1| conserved hypothetical protein [Clostridium perfringens B str. ATCC
           3626]
          Length = 256

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 53/226 (23%), Positives = 103/226 (45%), Gaps = 18/226 (7%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+  N      + DL  G G     +  + +  +++  E     A  A ++  +   
Sbjct: 43  VLLANFANVNRKHSVLDLCTGTGIIPFIIYGKKNPKEVVGIEIQEEFAEMANRSAKI--- 99

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFN-ERIGTMTP-DKIKEEAHV 118
             I  ++S +  D+    +++ L  L   F D V +NPP+     G + P DK+    H 
Sbjct: 100 NNIEDKVSFVCGDL----KDKELNKLMPKF-DVVTVNPPYKLNNAGIVNPEDKLAIARHE 154

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE---ITPLHPREGE 175
           ++  + E  I  +   ++ +G+L ++ RP+ L  I   C  R   +E   +  +HP   +
Sbjct: 155 IM-CNLEDVIAASRRFLKDNGRLYMVHRPERLADIF--CLMRKYKIEPKRVRMVHPNTKK 211

Query: 176 CASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRS 221
            A+ +LV G++     L++  P+ ++K  G  YS  + D I G+ S
Sbjct: 212 AANIVLVEGQRDGGAFLKWEAPLYVYKDEGG-YSEEI-DKIYGRES 255


>gi|331266025|ref|YP_004325655.1| S-adenosylmethionine-dependent methyltransferase [Streptococcus
           oralis Uo5]
 gi|326682697|emb|CBZ00314.1| S-adenosylmethionine-dependent methyltransferase [Streptococcus
           oralis Uo5]
          Length = 249

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/199 (22%), Positives = 99/199 (49%), Gaps = 21/199 (10%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + D  AG GA GL  +SR  +A+I+  E    +A  A +++ L     + +++ +I  D+
Sbjct: 51  IVDFCAGNGAVGLFASSRT-QARIISVEIQERLADMAERSVQLNG---LEEQMQVICDDL 106

Query: 75  TLVGENRNL-AGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-----EDSFEKWI 128
                 +N+ A ++ +  D ++ NPP+           + E  H +L       + ++  
Sbjct: 107 ------KNMPAYIQGSKVDMILCNPPY---FKVDPHSNLNESEHYLLARHEITTNLKEIC 157

Query: 129 RTACAIMRSSGQLSLIARPQSLIQIVNACARR-IGSLEITPLHPREGECASRILVTG-RK 186
           R+A +I++S+G+L+++ RP  L+ I++   R  +    +  ++P+  + A+ +L+   + 
Sbjct: 158 RSAQSILKSNGRLAMVHRPDRLLDILDMLQRHNLAPKRLQFVYPKREKEANMLLIEAIKD 217

Query: 187 GMRGQLRFRYPIVLHKPNG 205
           G     +   P+++H  +G
Sbjct: 218 GSTSGFKVLPPLIVHNDDG 236


>gi|288818388|ref|YP_003432736.1| methyltransferase [Hydrogenobacter thermophilus TK-6]
 gi|288787788|dbj|BAI69535.1| methyltransferase [Hydrogenobacter thermophilus TK-6]
 gi|308751981|gb|ADO45464.1| methyltransferase small [Hydrogenobacter thermophilus TK-6]
          Length = 238

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/207 (18%), Positives = 90/207 (43%), Gaps = 14/207 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           + L++L     +  + DLGAG G   + + S  +  ++   ER   M       + +   
Sbjct: 32  LFLSNLKGVKKNSKVVDLGAGFGTLSI-LTSLKYGCEVWAVERDETMLELLNYNVRI--- 87

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
            Q+  ++ +IE D+  +        +K +F+D+V++NPPF  R      +    E    L
Sbjct: 88  NQLDGKVHVIEGDIRFIER-----FMKRDFFDNVLLNPPFYPRTYRNKNNYFHFETDTDL 142

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQ-IVNACARRIGSLEITPLHPREGECASR 179
            D    +I+    +++  G+++L+      ++  +      I    +   +P+  +    
Sbjct: 143 AD----FIKATKYVLKDGGRVNLLYTAFRCMEAFLILKNNNINPYAVRIFYPKAEKNGKF 198

Query: 180 ILVTGRKGMRGQLRFRYPIVLHKPNGQ 206
           I + G K  +G +    P+++++ +G+
Sbjct: 199 IHIYGIKNGKGYMTIEKPLIINRNDGE 225


>gi|326693027|ref|ZP_08230032.1| RNA methyltransferase [Leuconostoc argentinum KCTC 3773]
          Length = 254

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 53/218 (24%), Positives = 102/218 (46%), Gaps = 16/218 (7%)

Query: 7   VNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKR 66
           V   GS    DLGAG GA GL  A ++    I L E  P +A  A++++ L     +  R
Sbjct: 44  VKGKGSGLTVDLGAGTGAVGLFYAPKV-TGPITLVEIQPELAEMAQRSVVLNG---LQDR 99

Query: 67  ISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF---NERIGTMTPDKIKEEAHVMLEDS 123
           +S+++ D+  + +      ++    + V+ NPP+   N+   T   D+  E A   +   
Sbjct: 100 VSVVQADMKAIFDV-----IQPGSAETVLSNPPYFPLNDTTKTNN-DQHYEIARHEVTID 153

Query: 124 FEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE-ITPLHPREGECASRILV 182
                + A  +++++G+  ++ RP  L  I  A A+R   ++ +  ++ +    A+ ++V
Sbjct: 154 LPGLAQVANKLLKNNGKFYMVHRPDRLADIFAAFAQRKLMIKRVQFVYGKADREANMVIV 213

Query: 183 TGRK-GMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
              K G  G +R   PIV +  +   Y+  V  ++ G+
Sbjct: 214 EAIKAGKPGGVRIMPPIVAYTADND-YTETVKTILYGQ 250


>gi|94988827|ref|YP_596928.1| methyltransferase [Streptococcus pyogenes MGAS9429]
 gi|94992714|ref|YP_600813.1| methyltransferase [Streptococcus pyogenes MGAS2096]
 gi|94542335|gb|ABF32384.1| methyltransferase [Streptococcus pyogenes MGAS9429]
 gi|94546222|gb|ABF36269.1| Methyltransferase [Streptococcus pyogenes MGAS2096]
          Length = 284

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/214 (21%), Positives = 106/214 (49%), Gaps = 20/214 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G GA GL  ++R  +A I+  E    +A   ++++ L    Q+  ++++I  D+
Sbjct: 76  IVDLCSGNGAVGLFASTRT-KAAIIEVELQERLADMGQRSIQL---NQLEDQVTMICDDL 131

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-----EDSFEKWIR 129
             +  +   +G+     D ++ NPP+     +    K     H +L       + E+  +
Sbjct: 132 KNLLNHVPRSGV-----DLMLCNPPY---FKSHESSKKNVSEHYLLARHEVTTNLEEICQ 183

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTG-RKG 187
            A   ++S+G+L+++ RP   ++I+++  A  +    +  ++P+ G+ A+ +L+   + G
Sbjct: 184 VARHALKSNGRLAMVHRPDRFLEIIDSLRANGLAPKRVQFVYPKLGKSANMLLIEAIKDG 243

Query: 188 MRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRS 221
               +    P+V+HK NG+ Y+  + ++  G  S
Sbjct: 244 SIEGMTILPPLVVHKENGE-YTDHIFEIYFGAAS 276


>gi|139473562|ref|YP_001128278.1| hypothetical protein SpyM50709 [Streptococcus pyogenes str.
           Manfredo]
 gi|134271809|emb|CAM30042.1| conserved hypothetical protein [Streptococcus pyogenes str.
           Manfredo]
          Length = 258

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/214 (21%), Positives = 106/214 (49%), Gaps = 20/214 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G GA GL  ++R  +A I+  E    +A   ++++ L    Q+  ++++I  D+
Sbjct: 50  IVDLCSGNGAVGLFASTRT-KAAIVEVELQERLADMGQRSIQL---NQLEDQVTMICDDL 105

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-----EDSFEKWIR 129
             +  +   +G+     D ++ NPP+     +    K     H +L       + E+  +
Sbjct: 106 KNLLNHVPRSGV-----DLMLCNPPY---FKSHESSKKNVSEHYLLARHEVTTNLEEICQ 157

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTG-RKG 187
            A   ++S+G+L+++ RP   ++I+++  A  +    +  ++P+ G+ A+ +L+   + G
Sbjct: 158 VARHALKSNGRLAMVHRPDRFLEIIDSLRANGLAPKRVQFVYPKLGKSANMLLIEAIKDG 217

Query: 188 MRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRS 221
               +    P+V+HK NG+ Y+  + ++  G  S
Sbjct: 218 SIEGMTILPPLVVHKENGE-YTDHIFEIYFGTAS 250


>gi|56807452|ref|ZP_00365406.1| COG4123: Predicted O-methyltransferase [Streptococcus pyogenes M49
           591]
 gi|209559641|ref|YP_002286113.1| hypothetical protein Spy49_1128 [Streptococcus pyogenes NZ131]
 gi|209540842|gb|ACI61418.1| Conserved hypothetical protein [Streptococcus pyogenes NZ131]
          Length = 284

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/214 (21%), Positives = 106/214 (49%), Gaps = 20/214 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G GA GL  ++R  +A I+  E    +A   ++++ L    Q+  ++++I  D+
Sbjct: 76  IVDLCSGNGAVGLFASTRT-KAAIVEVELQERLADMGQRSIQL---NQLEDQVTMICDDL 131

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-----EDSFEKWIR 129
             +  +   +G+     D ++ NPP+     +    K     H +L       + E+  +
Sbjct: 132 KNLLNHVPRSGV-----DLMLCNPPY---FKSHESSKKNVSEHYLLARHEVTTTLEEICQ 183

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTG-RKG 187
            A   ++S+G+L+++ RP   ++I+++  A  +    +  ++P+ G+ A+ +L+   + G
Sbjct: 184 VARHALKSNGRLAMVHRPDRFLEIIDSLRANGLAPKRVQFVYPKLGKSANMLLIEAIKDG 243

Query: 188 MRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRS 221
               +    P+V+HK NG+ Y+  + ++  G  S
Sbjct: 244 SIEGMTILPPLVVHKENGE-YTDHIFEIYFGAAS 276


>gi|222153375|ref|YP_002562552.1| hypothetical protein SUB1247 [Streptococcus uberis 0140J]
 gi|222114188|emb|CAR42722.1| conserved hypothetical protein [Streptococcus uberis 0140J]
          Length = 289

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/214 (23%), Positives = 109/214 (50%), Gaps = 20/214 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G GA GL  AS   +A+I+  E    +A  A++++ L    Q+  ++S+I  D+
Sbjct: 78  IVDLCSGNGAVGL-FASTKTKAKIIEIELQERLAEMAQRSIRL---NQLDDQVSMICDDL 133

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAI 134
             + ++   +G+     D ++ NPP+ +   T +  K   + +++        +   C I
Sbjct: 134 KNLLDHVPRSGV-----DLILCNPPYFK--ATESSKKNISQHYLLARHELTTNLDEICHI 186

Query: 135 ----MRSSGQLSLIARPQSLIQIVNACARRIGSL--EITPLHPREGECASRILVTG-RKG 187
               ++S+G+L+++ RP   ++I++   R+ G +   +  ++P+ G+ A+ +L+   + G
Sbjct: 187 SRHALKSNGRLAMVHRPSRFLEILDT-MRKHGLVPKRVQFVYPKIGKEANMLLIEAIKDG 245

Query: 188 MRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRS 221
                +   P+V+H+ NG  Y++ +  L  G  S
Sbjct: 246 SIDGFKLLPPLVVHEENGD-YTQHIRRLYFGDVS 278


>gi|306827078|ref|ZP_07460375.1| methyltransferase [Streptococcus pyogenes ATCC 10782]
 gi|304430712|gb|EFM33724.1| methyltransferase [Streptococcus pyogenes ATCC 10782]
          Length = 284

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/214 (21%), Positives = 106/214 (49%), Gaps = 20/214 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G GA GL  ++R  +A I+  E    +A   ++++ L    Q+  ++++I  D+
Sbjct: 76  IVDLCSGNGAVGLFASTRT-KAAIVEVELQERLADMGQRSIQL---NQLEDQVTMICDDL 131

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-----EDSFEKWIR 129
             +  +   +G+     D ++ NPP+     +    K     H +L       + E+  +
Sbjct: 132 KNLLNHVPRSGV-----DLMLCNPPY---FKSHESSKKNVSEHYLLARHEVTTNLEEICQ 183

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTG-RKG 187
            A   ++S+G+L+++ RP   ++I+++  A  +    +  ++P+ G+ A+ +L+   + G
Sbjct: 184 VARHALKSNGRLAMVHRPDRFLEIIDSLRANGLAPKRVQFVYPKLGKSANMLLIEAIKDG 243

Query: 188 MRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRS 221
               +    P+V+HK NG+ Y+  + ++  G  S
Sbjct: 244 SIEGMTILPPLVVHKENGE-YTDHIFEIYFGTAS 276


>gi|19746373|ref|NP_607509.1| hypothetical protein spyM18_1419 [Streptococcus pyogenes MGAS8232]
 gi|19748570|gb|AAL98008.1| conserved hypothetical protein [Streptococcus pyogenes MGAS8232]
          Length = 208

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/212 (22%), Positives = 105/212 (49%), Gaps = 20/212 (9%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DL +G GA GL  ++R  +A I+  E    +A   ++++ L    Q+  ++++I  D+  
Sbjct: 2   DLCSGNGAVGLFASTRT-KATIVEVELQERLADMGQRSIQL---NQLEDQVTMICDDLKN 57

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-----EDSFEKWIRTA 131
           +  +   +G+     D ++ NPP+     +    K     H +L       + E+  + A
Sbjct: 58  LLNHVPRSGV-----DLMLCNPPY---FKSHESSKKNVSEHYLLARHEVTTNLEEICQVA 109

Query: 132 CAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTG-RKGMR 189
              ++S+G+L+++ RP   ++I+++  A  +    +  ++P+ G+ A+ +L+   + G  
Sbjct: 110 RHALKSNGRLAMVHRPDRFLEIIDSLRANGLAPKRVQFVYPKLGKSANMLLIEAIKDGSI 169

Query: 190 GQLRFRYPIVLHKPNGQPYSRFVTDLINGKRS 221
             +    P+V+HK NG+ Y+  + ++  G  S
Sbjct: 170 EGMTILPPLVVHKENGE-YTDHIFEIYFGTAS 200


>gi|50914523|ref|YP_060495.1| methyltransferase [Streptococcus pyogenes MGAS10394]
 gi|50903597|gb|AAT87312.1| Methyltransferase [Streptococcus pyogenes MGAS10394]
          Length = 284

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/214 (21%), Positives = 106/214 (49%), Gaps = 20/214 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G GA GL  ++R  +A I+  E    +A   ++++ L    Q+  ++++I  D+
Sbjct: 76  IVDLCSGNGAVGLFASTRT-KAAIVEVELQKRLADMGQRSIQL---NQLEDQVTMICDDL 131

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-----EDSFEKWIR 129
             +  +   +G+     D ++ NPP+     +    K     H +L       + E+  +
Sbjct: 132 KNLLNHVPRSGV-----DLMLCNPPY---FKSHESSKKNVSEHYLLARHEVTTNLEEICQ 183

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTG-RKG 187
            A   ++S+G+L+++ RP   ++I+++  A  +    +  ++P+ G+ A+ +L+   + G
Sbjct: 184 VARHALKSNGRLAMVHRPDRFLEIIDSLRANGLAPKRVQFVYPKLGKSANMLLIEAIKDG 243

Query: 188 MRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRS 221
               +    P+V+HK NG+ Y+  + ++  G  S
Sbjct: 244 SIEGMTILPPLVVHKENGE-YTDHIFEIYFGTAS 276


>gi|302341669|ref|YP_003806198.1| methyltransferase small [Desulfarculus baarsii DSM 2075]
 gi|301638282|gb|ADK83604.1| methyltransferase small [Desulfarculus baarsii DSM 2075]
          Length = 248

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 54/219 (24%), Positives = 91/219 (41%), Gaps = 22/219 (10%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+    T    +ADL AG G  GL +A+R      L  E  PL AH           
Sbjct: 37  VLLAAFATPTAG-PVADLCAGCGVVGLLLAARGLAGPFLAVEIDPLAAHC---------- 85

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERI-GTMTPDKIKEEAHVM 119
            Q+++  + ++        +++   L+   Y  V+ NPPF++   G  +PD  + +A   
Sbjct: 86  CQLNQAHAGLDGQTIRADLSQDHPALQPGGYKLVVCNPPFSQAGRGRASPDPARAKARTE 145

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITP-----LHPREG 174
           L        R A  +++   +L+       L Q +      +G   +TP     +H R  
Sbjct: 146 LALQPHDLWRQAARLLKRGDRLAFCWPASRLPQALA----ELGQHRLTPKRLRLIHGRLD 201

Query: 175 ECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVT 213
             A   L+   K    QL    P+++H P GQ Y+  V+
Sbjct: 202 APAKTALIEAVKDGGQQLSVHPPLIVHGP-GQEYTPEVS 239


>gi|15675331|ref|NP_269505.1| hypothetical protein SPy_1411 [Streptococcus pyogenes M1 GAS]
 gi|71910963|ref|YP_282513.1| methyltransferase [Streptococcus pyogenes MGAS5005]
 gi|13622512|gb|AAK34226.1| conserved hypothetical protein [Streptococcus pyogenes M1 GAS]
 gi|71853745|gb|AAZ51768.1| methyltransferase [Streptococcus pyogenes MGAS5005]
          Length = 258

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/214 (21%), Positives = 106/214 (49%), Gaps = 20/214 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G GA GL  ++R  +A I+  E    +A   ++++ L    Q+  ++++I  D+
Sbjct: 50  IVDLCSGNGAVGLFASTRT-KAAIVEVELQERLADMGQRSIQL---NQLEDQVTMICDDL 105

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-----EDSFEKWIR 129
             +  +   +G+     D ++ NPP+     +    K     H +L       + E+  +
Sbjct: 106 KNLLNHVPRSGV-----DLMLCNPPY---FKSHESSKKNVSEHYLLARHEVTTNLEEICQ 157

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTG-RKG 187
            A   ++S+G+L+++ RP   ++I+++  A  +    +  ++P+ G+ A+ +L+   + G
Sbjct: 158 VARHALKSNGRLAMVHRPDRFLEIIDSLRANGLAPKRVQFVYPKLGKSANMLLIEAIKDG 217

Query: 188 MRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRS 221
               +    P+V+HK NG+ Y+  + ++  G  S
Sbjct: 218 SIEGMTILPPLVVHKENGE-YTDHIFEIYFGAAS 250


>gi|28895699|ref|NP_802049.1| hypothetical protein SPs0787 [Streptococcus pyogenes SSI-1]
 gi|28810948|dbj|BAC63882.1| conserved hypothetical protein [Streptococcus pyogenes SSI-1]
          Length = 258

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/214 (21%), Positives = 106/214 (49%), Gaps = 20/214 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G GA GL  ++R  +A I+  E    +A   ++++ L    Q+  ++++I  D+
Sbjct: 50  IVDLCSGNGAVGLFASTRT-KAAIVEVELQKRLADMGQRSIQL---NQLEDQVTMICDDL 105

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-----EDSFEKWIR 129
             +  +   +G+     D ++ NPP+     +    K     H +L       + E+  +
Sbjct: 106 KNLLNHVPRSGV-----DLMLCNPPY---FKSHESSKKNVSEHYLLARHEVTTNLEEICQ 157

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTG-RKG 187
            A   ++S+G+L+++ RP   ++I+++  A  +    +  ++P+ G+ A+ +L+   + G
Sbjct: 158 VARHALKSNGRLAMVHRPDRFLEIIDSLRANGLAPKRVQFVYPKLGKSANMLLIEAIKDG 217

Query: 188 MRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRS 221
               +    P+V+HK NG+ Y+  + ++  G  S
Sbjct: 218 SIEGMTILPPLVVHKENGE-YTDHIFEIYFGAAS 250


>gi|220932865|ref|YP_002509773.1| methyltransferase small [Halothermothrix orenii H 168]
 gi|219994175|gb|ACL70778.1| methyltransferase small [Halothermothrix orenii H 168]
          Length = 246

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/221 (23%), Positives = 99/221 (44%), Gaps = 24/221 (10%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+ V       + DLG+G+G   L +A +    +++  E  P +   ++K+  +   
Sbjct: 28  VLLANFVKVKDGESVVDLGSGSGVIPLLLAFKQKPGRVIGLEILPELVQLSKKSARMNGL 87

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIK-----EE 115
            +I   I  IE D+  + +   L  +     D V+ NPP+      M PDK K     E+
Sbjct: 88  EEI---IEFIEGDIKEIDDYIELESV-----DLVVCNPPY------MPPDKGKITKNREK 133

Query: 116 A---HVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHP 171
           A   H +L  + +  I+    ++R  G+++++ R   L +I+      ++    +  +  
Sbjct: 134 AIARHEIL-ITLKDVIKQGSRVLRLGGRMAMVHRTWRLPEIITLMRENKLEPKRLCFVQS 192

Query: 172 REGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFV 212
           RE      +L+  +KG    L     +V++K N Q Y+  V
Sbjct: 193 RENLNPKTVLIEAKKGGGLGLEVEPNLVVYKGNTQEYTDTV 233


>gi|170756863|ref|YP_001779688.1| hypothetical protein CLD_0725 [Clostridium botulinum B1 str. Okra]
 gi|169122075|gb|ACA45911.1| conserved hypothetical protein [Clostridium botulinum B1 str. Okra]
          Length = 246

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/213 (22%), Positives = 96/213 (45%), Gaps = 20/213 (9%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+         + DL +G G     +A + + + I+  E    +A  A++++     
Sbjct: 35  VLLANFPTIKNGAKVVDLCSGTGIIPFILAGKTNASNIIGIEIQKEIADMAKRSIKY--- 91

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKN-NFYDHVIMNPPFNER----IGTMTPDKI-KE 114
             + +++  IE      G+ +NL  LK     D V +NPP+  +    I     + I + 
Sbjct: 92  NNLQEKVRFIE------GDLKNLKLLKGIEKVDVVTVNPPYKTQGTGIININDKNAISRH 145

Query: 115 EAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPRE 173
           E    L+D     ++ A  +++  G+L +I RP  ++ I+N   +  I    I  +HP  
Sbjct: 146 EICCTLDDV----VKAAKVLLKDKGKLYMIHRPDRIVDIMNVMRKYYIEPKLIRTIHPAV 201

Query: 174 GECASRILVTGRKGMRGQLRFRYPIVLHKPNGQ 206
            +  S IL+ G+K     L++  P+ ++  N +
Sbjct: 202 DKPPSMILIEGQKNGGKFLKWDRPLYIYDENNK 234


>gi|296110374|ref|YP_003620755.1| methyltransferase (putative) [Leuconostoc kimchii IMSNU 11154]
 gi|295831905|gb|ADG39786.1| methyltransferase (putative) [Leuconostoc kimchii IMSNU 11154]
          Length = 253

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 55/220 (25%), Positives = 101/220 (45%), Gaps = 20/220 (9%)

Query: 7   VNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKR 66
           V   G+    DLGAG GA GL  + ++   +I L E  P +A  A++++ +     + KR
Sbjct: 44  VKGKGAGLTVDLGAGTGAVGLFYSPKVI-GKIKLVEIQPELAEMAQRSIEMNG---LQKR 99

Query: 67  ISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF---NERIGTMTPDKIKEEAHVMLEDS 123
           +S++  D+  +        ++    + V+ NPP+   NE   T   D   E A   L   
Sbjct: 100 VSVLLSDMKDI-----FNDIQPGSVETVLSNPPYFPLNEMTKT-NHDTHYELARHELTID 153

Query: 124 FEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGEC---ASRI 180
                + A  +++++G+  ++ RP  L  + +A  +R   L I  +    G+    A+ +
Sbjct: 154 LPGLAQVANKLLKNNGKFYMVHRPDRLTDVFSAFEQR--KLRIKRMQFVYGKSDREANMV 211

Query: 181 LVTGRKGMR-GQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
           LV   K  R G +R   PI+ + P    Y+  V +++ G+
Sbjct: 212 LVEAIKAGRPGGVRIMPPIIAYTPENN-YTSQVEEILYGQ 250


>gi|71903806|ref|YP_280610.1| methyltransferase [Streptococcus pyogenes MGAS6180]
 gi|94994653|ref|YP_602751.1| Methyltransferase [Streptococcus pyogenes MGAS10750]
 gi|71802901|gb|AAX72254.1| methyltransferase [Streptococcus pyogenes MGAS6180]
 gi|94548161|gb|ABF38207.1| Methyltransferase [Streptococcus pyogenes MGAS10750]
          Length = 284

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/214 (21%), Positives = 106/214 (49%), Gaps = 20/214 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G GA GL  ++R  +A I+  E    +A   ++++ L    Q+  ++++I  D+
Sbjct: 76  IVDLCSGNGAVGLFASTRT-KAAIVEVELQERLADMGQRSIQL---NQLEDQVTMICDDL 131

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-----EDSFEKWIR 129
             +  +   +G+     D ++ NPP+     +    K     H +L       + E+  +
Sbjct: 132 KNLLNHVPRSGV-----DLMLCNPPY---FKSHESSKKNVSEHYLLARHEVTTNLEEICQ 183

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTG-RKG 187
            A   ++S+G+L+++ RP   ++I+++  A  +    +  ++P+ G+ A+ +L+   + G
Sbjct: 184 VARHALKSNGRLAMVHRPDRFLEIIDSLRANGLAPKRVQFVYPKLGKSANMLLIEAIKDG 243

Query: 188 MRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRS 221
               +    P+V+HK NG+ Y+  + ++  G  S
Sbjct: 244 SIEGMTILPPLVVHKENGE-YTDHIFEIYFGAAS 276


>gi|158520560|ref|YP_001528430.1| methyltransferase small [Desulfococcus oleovorans Hxd3]
 gi|158509386|gb|ABW66353.1| methyltransferase small [Desulfococcus oleovorans Hxd3]
          Length = 241

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 56/213 (26%), Positives = 95/213 (44%), Gaps = 20/213 (9%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           +ILA  +       + DLG G G   L +A R     I   E  P +A  A +  A  AN
Sbjct: 31  VILAWHITPAPGARIVDLGTGCGIIPLILACRHPSVSITGIEIQPQLAQIATENAA--AN 88

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNE-RIGTMTPDKIKEEAHVM 119
            Q++ R+S++  D+     N +L   K    D V+ NPPF +   G + PD+ +  A   
Sbjct: 89  -QMTDRVSIVCADIR--NANDHLPAGK---ADIVVCNPPFRKVAAGRINPDEERAIARHE 142

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIA---RPQSLIQIVNACARRIGSLE---ITPLHPRE 173
           L  + +  +  A   +R++G+  +I    R   +I     CA R   +E   +  +H R+
Sbjct: 143 LAVTLKDILAAAKRALRTAGEFVVIYPAFRAPDMI-----CAMREAGIEPKLVRTIHSRQ 197

Query: 174 GECASRILVTGRKGMRGQLRFRYPIVLHKPNGQ 206
            E A  +L+ G +  R       P+V++  + +
Sbjct: 198 HEEARLVLIKGTRNGRPGAVIPSPLVIYDADDR 230


>gi|116492640|ref|YP_804375.1| O-methyltransferase [Pediococcus pentosaceus ATCC 25745]
 gi|116102790|gb|ABJ67933.1| Predicted O-methyltransferase [Pediococcus pentosaceus ATCC 25745]
          Length = 251

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/219 (22%), Positives = 99/219 (45%), Gaps = 15/219 (6%)

Query: 7   VNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKR 66
           V       + DL +G GA GL ++ +     + + E    +A  A +++ L     ++ R
Sbjct: 43  VKKASKTKIVDLCSGNGAVGLFLSKKT-AGHVTMVEIQSRLAEMAMRSIQL---NDLTDR 98

Query: 67  ISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERI--GTMTPDKIKEEAHVMLEDSF 124
                 DV  +     L  +  +  D+++ NPP+ E +      P++    A   L  S 
Sbjct: 99  -----YDVYNMPLKDALTKINADSIDNIVCNPPYFEDLPSSKKNPNEHLALARHELTTSL 153

Query: 125 EKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVT 183
           E+ ++ +  +++ +G+L L+ RP  L +I+    + R+    I   H   G+ A+ +L+ 
Sbjct: 154 EEVLQVSQKMLKMNGKLFLVHRPDRLPEILTKLVKNRLAPKRIQFAHSHAGDEANMVLIE 213

Query: 184 G-RKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRS 221
             + G     R   PIV+++  G  YS+ + +L+ G  +
Sbjct: 214 AIKDGKPNGTRILPPIVIYE--GLEYSKAIKELLYGNST 250


>gi|225848651|ref|YP_002728814.1| SAM-dependent methyltransferase [Sulfurihydrogenibium azorense
           Az-Fu1]
 gi|225644243|gb|ACN99293.1| SAM-dependent methyltransferase [Sulfurihydrogenibium azorense
           Az-Fu1]
          Length = 254

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/226 (21%), Positives = 103/226 (45%), Gaps = 29/226 (12%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++L+  VN   S  L DLG G+G   + ++ +    Q    E    +   A+K +     
Sbjct: 40  LLLSDFVNIKSSGKLIDLGTGSGIILILLSLKYKNIQFYGLEVQQDLYQLAQKNI----- 94

Query: 61  AQISKRISLIEVDVTLVGENRNLAGL-KNNFYDHVIMNPP-FNERIGTMTPDKI-KEEAH 117
                +++ ++ D+ L G+ + +    ++ ++D+V++NPP F       T +KI + E  
Sbjct: 95  -----KLNNVKADLKL-GDVKEVKKFYEHQYFDYVVINPPYFKSGDYKNTQEKIARSEVL 148

Query: 118 VMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITP-----LHPR 172
             LED    +I+ +  ++++ G+L +I   +   + V    + + +  + P     +HP 
Sbjct: 149 ATLED----FIKASWYLLKNKGKLFMIVPCERFSETV----KYLKNYNLQPKRYRFIHPS 200

Query: 173 EGECASRILVTGRKGMR--GQLRFRYPIVLHKPNGQPYSRFVTDLI 216
             E A+  +V   K  +  G++     IV   P  + Y+ +V  L+
Sbjct: 201 INEKATHFMVEAIKQAKEGGEIVESPLIVYENPKEKKYTDYVWSLL 246


>gi|21910612|ref|NP_664880.1| hypothetical protein SpyM3_1076 [Streptococcus pyogenes MGAS315]
 gi|21904813|gb|AAM79683.1| conserved hypothetical protein [Streptococcus pyogenes MGAS315]
          Length = 284

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/214 (21%), Positives = 106/214 (49%), Gaps = 20/214 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G GA GL  ++R  +A I+  E    +A   ++++ L    Q+  ++++I  D+
Sbjct: 76  IVDLCSGNGAVGLFASTRT-KAAIVEVELQKRLADMGQRSIQL---NQLEDQVTMICDDL 131

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-----EDSFEKWIR 129
             +  +   +G+     D ++ NPP+     +    K     H +L       + E+  +
Sbjct: 132 KNLLNHVPRSGV-----DLMLCNPPY---FKSHESSKKNVSEHYLLARHEVTTNLEEICQ 183

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTG-RKG 187
            A   ++S+G+L+++ RP   ++I+++  A  +    +  ++P+ G+ A+ +L+   + G
Sbjct: 184 VARHALKSNGRLAMVHRPDRFLEIIDSLRANGLAPKRVQFVYPKLGKSANMLLIEAIKDG 243

Query: 188 MRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRS 221
               +    P+V+HK NG+ Y+  + ++  G  S
Sbjct: 244 SIEGMTILPPLVVHKENGE-YTDHIFEIYFGAAS 276


>gi|309798587|ref|ZP_07692862.1| methyltransferase [Streptococcus infantis SK1302]
 gi|308117823|gb|EFO55224.1| methyltransferase [Streptococcus infantis SK1302]
          Length = 248

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/201 (21%), Positives = 104/201 (51%), Gaps = 25/201 (12%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + D  AG GA GL  +SR  +A+IL  E    +A  A +++          R++ +E  +
Sbjct: 50  IVDFCAGNGAVGLFASSRT-KAKILSVEIQERLADMADRSV----------RLNGLEEQM 98

Query: 75  TLVGEN-RNL-AGLKNNFYDHVIMNPPFNERIGTMTPD-KIKEEAHVML-----EDSFEK 126
            ++ ++ +N+ A ++ +  D ++ NPP+ +    + P+  + E  H +L       + ++
Sbjct: 99  QVICDDLKNMPAYIQGSKVDLILCNPPYFK----VDPNSNLNESEHYLLARHEITTNLKE 154

Query: 127 WIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTG- 184
             R+A +I++S+G+L+++ RP  L+ I++   +  +    +  ++P+  + A+ +L+   
Sbjct: 155 ICRSAQSILKSNGRLAMVHRPDRLLDILDTLQQHNLAPKRLQFVYPKREKEANMLLIEAI 214

Query: 185 RKGMRGQLRFRYPIVLHKPNG 205
           + G     +   P+++H  +G
Sbjct: 215 KDGSTSGFKVLPPLIVHNDDG 235


>gi|302390844|ref|YP_003826664.1| methyltransferase type 11 [Acetohalobium arabaticum DSM 5501]
 gi|302202921|gb|ADL11599.1| Methyltransferase type 11 [Acetohalobium arabaticum DSM 5501]
          Length = 256

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 55/231 (23%), Positives = 103/231 (44%), Gaps = 31/231 (13%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA  V       + DLG G G   L +  +    QI+  E    +A  A++++     
Sbjct: 36  VLLADFVEIKPKDRVIDLGTGTGVIPLLLTGKNDPDQIVGIEIQVKLAEMAQRSVLY--- 92

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNF----YDHVIMNPPFNER-IGTMTPDK---- 111
              +K   +IE+      +  ++  LK  F    +D V+ NPP+     G + PD     
Sbjct: 93  ---NKLEDVIEI------KKADIRQLKEVFAAESFDVVVSNPPYLPLGQGKVNPDSSIAL 143

Query: 112 IKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQ---SLIQIVNACARRIGSLEITP 168
            + E  V LED  E     +  ++R  G++S I R +    L++++N    +   + +  
Sbjct: 144 ARHELKVKLEDVVE----ISSYLVRYKGRVSYIYRVERLDELLEVMNYYNLQPKYMRL-- 197

Query: 169 LHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
           + P   +  + +LVTG KG    L    P+++++ NG+ Y+  V  +  G+
Sbjct: 198 IQPEGDKACNLVLVTGIKGANSGLEVDKPLIIYRDNGE-YTEEVLKIYYGE 247


>gi|329117024|ref|ZP_08245741.1| methyltransferase small domain protein [Streptococcus parauberis
           NCFD 2020]
 gi|326907429|gb|EGE54343.1| methyltransferase small domain protein [Streptococcus parauberis
           NCFD 2020]
          Length = 256

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 50/215 (23%), Positives = 103/215 (47%), Gaps = 26/215 (12%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G GA GL  ++R + A I+  E    +A  A++++ L          + +E  V
Sbjct: 50  IVDLCSGNGAVGLFASTRTN-APIIEVELQDRLAEMAQRSIIL----------NNLESQV 98

Query: 75  TLVGENRNLAGLKNNF----YDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRT 130
            +V  N +L  L N       D ++ NPP+ +     +  K   E +++        +  
Sbjct: 99  KMV--NDDLKNLLNYVPRSGVDLILCNPPYFK--AKESSKKNLSEHYLLARHEITTNLEE 154

Query: 131 ACAI----MRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTG- 184
            C I    ++S+G+L+++ RP   I+I++A  +  +    I  ++P+ G+ A+ +L+   
Sbjct: 155 ICQISRHALKSNGRLAMVHRPDRFIEIIDALRSNGLAPKRIQFVYPKVGKEANILLIEAI 214

Query: 185 RKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
           + G    ++   P+++H+ NG  Y+  +  +  GK
Sbjct: 215 KDGSIEGMKVLPPLIVHEDNGD-YTDHIHKIYFGK 248


>gi|188996160|ref|YP_001930411.1| methyltransferase small [Sulfurihydrogenibium sp. YO3AOP1]
 gi|188931227|gb|ACD65857.1| methyltransferase small [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 247

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 51/229 (22%), Positives = 104/229 (45%), Gaps = 30/229 (13%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++L   +N   S  + D+G G+G   + ++ +    ++   E    +   A++       
Sbjct: 37  LLLVDFLNIKSSGKIIDIGTGSGIIPILISLKYKNLKLYALEVQEDLFDIAKRNF----- 91

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNN-FYDHVIMNPP-FNERIGTMTPDKI-KEEAH 117
                +I+ + V + L G  +++  + N+ ++D+V++NPP F E       +KI + EA 
Sbjct: 92  -----QINNVHVQIAL-GNVKDVKKIYNHQYFDYVVINPPYFKEGNYKNIQEKIARSEAL 145

Query: 118 VMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITP-----LHPR 172
             LED    +I  +  ++++ G+L LI   +   + V+   +      I P     +HP 
Sbjct: 146 AKLED----FIYGSWYLLKNKGKLHLINITERFSETVSLLKK----YNIQPKRYRFVHPS 197

Query: 173 EGECASRILVTGRKGMR--GQLRFRYPIVLHKPNGQPYSRFVTDLI-NG 218
             E A+  LV   K  +  G++     I+   P  + Y+ +V +L+ NG
Sbjct: 198 INEKATHFLVEASKNSKEGGEIVEAPLIIYENPKEKKYTDYVWNLLENG 246


>gi|182626807|ref|ZP_02954545.1| SAM-dependent methyltransferase [Clostridium perfringens D str.
           JGS1721]
 gi|177907853|gb|EDT70451.1| SAM-dependent methyltransferase [Clostridium perfringens D str.
           JGS1721]
          Length = 256

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 52/226 (23%), Positives = 103/226 (45%), Gaps = 18/226 (7%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+  N      + DL  G G     +  + +  +++  E     A  A ++  +   
Sbjct: 43  VLLANFANVNRKHSVLDLCTGTGIIPFIIYGKKNPKEVVGIEIQEEFAEMANRSAKI--- 99

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFN-ERIGTMTP-DKIKEEAHV 118
             I  ++S +  D+    +++ L+     F D V +NPP+     G + P DK+    H 
Sbjct: 100 NNIEDKVSFVYGDL----KDKELSKSMPKF-DVVTVNPPYKLNNAGIVNPEDKLAIARHE 154

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE---ITPLHPREGE 175
           ++  + E  I  +   ++ +G+L ++ RP+ L  I   C  R   +E   +  +HP   +
Sbjct: 155 IM-CNLEDVIAASRRFLKDNGRLYMVHRPERLADIF--CLMRKYKIEPKRVRMVHPNTKK 211

Query: 176 CASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRS 221
            A+ +LV G++     L++  P+ ++K  G  YS  + D I G+ S
Sbjct: 212 AANIVLVEGQRDGGAFLKWEAPLYVYKDEGG-YSEEI-DKIYGRES 255


>gi|322391662|ref|ZP_08065130.1| methyltransferase [Streptococcus peroris ATCC 700780]
 gi|321145473|gb|EFX40866.1| methyltransferase [Streptococcus peroris ATCC 700780]
          Length = 249

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/200 (22%), Positives = 97/200 (48%), Gaps = 23/200 (11%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + D  AG GA GL  +SR  +A+IL  E    +A  A +++          R++ +E  +
Sbjct: 51  IVDFCAGNGAVGLFASSRT-KAKILSVEIQERLADMAERSV----------RLNSLEEQM 99

Query: 75  TLVGEN-RNLAG-LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-----EDSFEKW 127
            ++ ++ +N+   L+ +  D ++ NPP+           + E  H +L       + E+ 
Sbjct: 100 RVICDDLKNMPNHLQGSKVDMILCNPPY---FKVDPHSNLNESEHYLLARHEITTNLEEI 156

Query: 128 IRTACAIMRSSGQLSLIARPQSLIQIVNACARR-IGSLEITPLHPREGECASRILVTG-R 185
            R+A  I++S+G+L+++ RP  L+ I+    +  +    +  ++P+  + A+ +L+   +
Sbjct: 157 CRSAQKILKSNGRLAMVHRPDRLLDILATLQQHNLAPKRLQFVYPKREKEANMLLIEAIK 216

Query: 186 KGMRGQLRFRYPIVLHKPNG 205
            G     +   P+++H  +G
Sbjct: 217 DGSTSGFKVLPPLIVHNSDG 236


>gi|306821417|ref|ZP_07455022.1| SAM-dependent methyltransferase [Eubacterium yurii subsp.
           margaretiae ATCC 43715]
 gi|304550539|gb|EFM38525.1| SAM-dependent methyltransferase [Eubacterium yurii subsp.
           margaretiae ATCC 43715]
          Length = 248

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 56/234 (23%), Positives = 105/234 (44%), Gaps = 36/234 (15%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+ V    +  LADLG G G   + V ++ + A+I   E    +A  AR+++ L  N
Sbjct: 32  VLLANFVKFKKNDTLADLGTGTGIIPILVKAKSNIAKIYAIEIQKHIADMARRSVEL-NN 90

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNF-----YDHVIMNPPFNERIGTMTPDKIKEE 115
            Q    I  I +  TL            NF      D +  NPP+      M  +K+   
Sbjct: 91  FQDDIEILNINLKDTL------------NFIPKYSIDIITTNPPY------MPKEKLLSG 132

Query: 116 AHVMLEDSFEKW------IRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPL 169
              M+    E +      ++ +  +++ +G++ +I RP  L  I+     R  +LE+  +
Sbjct: 133 NESMMISRNEIFCDIGDIMKVSSELLKPNGKIYMIHRPSRLSDII--YEGRKNNLEVKEM 190

Query: 170 ---HPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKR 220
              +P  G+ A+ IL+   K  + ++R   P+++H+ +G+ Y+  V  +   K 
Sbjct: 191 QMIYPSVGKSANLILLKLVKNAKPEIRMLAPLIVHQADGR-YTEEVQKIYEKKE 243


>gi|251782858|ref|YP_002997161.1| methyltransferase [Streptococcus dysgalactiae subsp. equisimilis
           GGS_124]
 gi|242391488|dbj|BAH81947.1| methyltransferase [Streptococcus dysgalactiae subsp. equisimilis
           GGS_124]
          Length = 284

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/214 (21%), Positives = 106/214 (49%), Gaps = 20/214 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G GA GL  ++R  +A I+  E    +A   ++++ L    Q+  ++++I  D+
Sbjct: 76  IVDLCSGNGAVGLFASTRT-KAAIVEVELQERLADMGQRSIQL---NQLEDQVTMICDDL 131

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-----EDSFEKWIR 129
             +  +   +G+     D ++ NPP+     +    K     H +L       + E+  +
Sbjct: 132 KNLLNHVPRSGV-----DLMLCNPPY---FKSHESSKKNVSEHYLLARHEVTTNLEEICQ 183

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTG-RKG 187
            A   ++S+G+L+++ RP   ++I+++  A  +    +  ++P+ G+ A+ +L+   + G
Sbjct: 184 VARHALKSNGRLAMVHRPDRFLEIIDSLRANGLAPKRVQFVYPKFGKAANMLLIEAIKDG 243

Query: 188 MRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRS 221
               +    P+++HK NG+ Y+  + ++  G  S
Sbjct: 244 SIEGMTILPPLIVHKENGE-YTDHIFEIYFGAAS 276


>gi|18309261|ref|NP_561195.1| hypothetical protein CPE0279 [Clostridium perfringens str. 13]
 gi|168207833|ref|ZP_02633838.1| conserved hypothetical protein [Clostridium perfringens E str.
           JGS1987]
 gi|18143937|dbj|BAB79985.1| conserved hypothetical protein [Clostridium perfringens str. 13]
 gi|170660846|gb|EDT13529.1| conserved hypothetical protein [Clostridium perfringens E str.
           JGS1987]
          Length = 256

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 54/228 (23%), Positives = 101/228 (44%), Gaps = 22/228 (9%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+  N      + DL  G G     +  + +  +++  E     A  A +       
Sbjct: 43  VLLANFANVNRKHSVLDLCTGTGIIPFIIYGKKNPKEVVGIEIQEEFAEMANR------- 95

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNF--YDHVIMNPPFN-ERIGTMTP-DKIKEEA 116
              S +I+ IE  V+ V  +     L  +   +D V +NPP+     G + P DK+    
Sbjct: 96  ---SAKINNIEDKVSFVCGDLKDKELSKSMPKFDVVTVNPPYKLNNAGIVNPEDKLAIAR 152

Query: 117 HVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE---ITPLHPRE 173
           H ++  + E  I  +   ++ +G+L ++ RP+ L  I   C  R   +E   +  +HP  
Sbjct: 153 HEIM-CNLEDVIAASRRFLKDNGRLYMVHRPERLADIF--CLMRKYKIEPKRVRMIHPNT 209

Query: 174 GECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRS 221
            + A+ +LV G++     L++  P+ ++K  G  YS  + D I G+ S
Sbjct: 210 KKAANIVLVEGQRDGGAFLKWEAPLYVYKDEGG-YSEEI-DKIYGRES 255


>gi|315639732|ref|ZP_07894871.1| methyltransferase [Enterococcus italicus DSM 15952]
 gi|315484509|gb|EFU74966.1| methyltransferase [Enterococcus italicus DSM 15952]
          Length = 256

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/222 (20%), Positives = 107/222 (48%), Gaps = 14/222 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+         + DL AG GA GL + SR   A+I+  E    +A  A++++ L   
Sbjct: 44  VLLANFPRIPKKGRIVDLCAGNGAVGLFI-SRKTNAEIIQIELQERLADMAQRSIQL--- 99

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF--NERIGTMTPDKIKEEAHV 118
             ++ ++ +   D+       +LA +  +  D ++ NPP+  ++      P+     A  
Sbjct: 100 NDLANQMKIYTADLK-----DSLAFVAPDSVDLLVCNPPYFPHQPQSVKNPNPYLAIARH 154

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECA 177
            +  + E+ +  +  +++++G+L+L+ RP   + I++A  R R+    +  ++P+ G+ A
Sbjct: 155 EIHTNLEEIVAMSSKLLKTNGRLALVHRPDRFLTILDAMRRQRLVPKHVQFVYPKNGKDA 214

Query: 178 SRILVTG-RKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLING 218
           + +L+   + G     +   P+  +  + Q Y+  +  ++ G
Sbjct: 215 NILLIEAIKDGKEEGFKVNPPLFTYDED-QAYTPEIRQMLYG 255


>gi|328551735|gb|AEB22227.1| methyltransferase [Bacillus amyloliquefaciens TA208]
          Length = 247

 Score = 49.3 bits (116), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 51/214 (23%), Positives = 100/214 (46%), Gaps = 25/214 (11%)

Query: 14  HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVD 73
           ++ DL  G G   L +++R  +A I   E    +   A +++       +  +ISLI  D
Sbjct: 48  NIVDLCTGNGIVPLLLSTR-SKADITGVEIQERLYDMALRSVEYNG---LGGQISLIHDD 103

Query: 74  VTLVGENRNLAG-LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLED-------SFE 125
           +      +N+   L +N YD V  NPP+ +     TP + ++  +  L         + E
Sbjct: 104 L------KNMPDRLGHNKYDVVTCNPPYFK-----TPKEAEQNLNEHLRIARHEILCTLE 152

Query: 126 KWIRTACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTG 184
             I  +  +++  G+ +L+ RP  L++I       RI    +  ++P++G+ A+ ILV G
Sbjct: 153 DVISVSSKLLKQGGKAALVHRPGRLLEIFELMKTYRIEPKRVQFIYPKQGKEANTILVEG 212

Query: 185 RKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLING 218
            KG R  L+   P+ ++    + Y++ +  ++ G
Sbjct: 213 IKGGRPDLKILPPLFVYNEQNE-YTKEIRTILYG 245


>gi|229829476|ref|ZP_04455545.1| hypothetical protein GCWU000342_01566 [Shuttleworthia satelles DSM
           14600]
 gi|229791907|gb|EEP28021.1| hypothetical protein GCWU000342_01566 [Shuttleworthia satelles DSM
           14600]
          Length = 254

 Score = 49.3 bits (116), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 50/211 (23%), Positives = 87/211 (41%), Gaps = 18/211 (8%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+  N      + DLG G G   + + +R   A+    E        AR++  L   
Sbjct: 39  VLLAAFANNKEGDRVLDLGTGTGVIPILMEARYGGAEYKALEIQADSCDMARRSARLNG- 97

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF-NERIGTMTPDKIKEEAHVM 119
             +  RI ++E D+T   E    A      +D V  NPP+   + G   P      A   
Sbjct: 98  --LEDRIEIVEGDLTRAHEIFGPAS-----FDVVTCNPPYMTNKHGLTNPSGPMAIARHE 150

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITP-----LHPREG 174
           L  S E  +R    ++R  G    + RP  L++I+     R+    + P     ++P   
Sbjct: 151 LLCSLEDVVRETARLLRPGGHSYFVHRPFRLVEIMT----RMHDYGLEPKRMRLVYPYAD 206

Query: 175 ECASRILVTGRKGMRGQLRFRYPIVLHKPNG 205
              + +L+ G +G R  L+   P+V+++  G
Sbjct: 207 REPNMVLLEGVRGGRSWLKTEPPLVIYRGQG 237


>gi|116629457|ref|YP_814629.1| O-methyltransferase [Lactobacillus gasseri ATCC 33323]
 gi|311110895|ref|ZP_07712292.1| putative GIY-YIG catalytic domain protein [Lactobacillus gasseri
           MV-22]
 gi|116095039|gb|ABJ60191.1| Predicted O-methyltransferase [Lactobacillus gasseri ATCC 33323]
 gi|311066049|gb|EFQ46389.1| putative GIY-YIG catalytic domain protein [Lactobacillus gasseri
           MV-22]
          Length = 338

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 47/199 (23%), Positives = 93/199 (46%), Gaps = 13/199 (6%)

Query: 11  GSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLI 70
            ++ + DL +G  AA + + S  + A     E    MA  A +++ L    ++  RI   
Sbjct: 46  DNYKVVDLCSGNAAASIYM-SYFNRAHYDAVEIQADMADQASRSIKL---NKLENRI--- 98

Query: 71  EVDVTLVGENRNLAGLKNNFYDHVIMNPPFNE--RIGTMTPDKIKEEAHVMLEDSFEKWI 128
             +V  +        L  + YD V++NPP+ +  +   + PD+ K  A   L  + E+ I
Sbjct: 99  --EVHCLNALEAPKKLGKDKYDMVVVNPPYFKVPKGHVINPDEKKALARHELAINLEQII 156

Query: 129 RTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE-ITPLHPREGECASRILVTG-RK 186
           + +  +++  G++ ++ RP+ L +I++ C     S++ + P   +    A+ ++V   R 
Sbjct: 157 KVSSDMLKMKGKMFMVHRPERLGEIMHYCLENHLSVKWVQPFVSKRNADANLVVVEAIRN 216

Query: 187 GMRGQLRFRYPIVLHKPNG 205
                L  R  IV+H P+G
Sbjct: 217 TASDGLTLRDAIVVHNPDG 235


>gi|319947370|ref|ZP_08021603.1| methyltransferase [Streptococcus australis ATCC 700641]
 gi|319746612|gb|EFV98872.1| methyltransferase [Streptococcus australis ATCC 700641]
          Length = 248

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 47/202 (23%), Positives = 93/202 (46%), Gaps = 27/202 (13%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL AG GA GL  ++R  +A I+  E    +A  A +++ L     +S R+S+I  D 
Sbjct: 50  IVDLCAGNGAVGLFASTRT-KATIVGVEIQERLADMAERSIQLNG---LSDRMSMITDD- 104

Query: 75  TLVGENRNLAGLKNNF----YDHVIMNPPFNERIGTMTPDKIKEEAHVML-----EDSFE 125
                   L  L ++F     D ++ NPP+           + E  H +L       + +
Sbjct: 105 --------LKNLPHHFPGSKIDLILCNPPY---FKVDEHSNLNESPHYLLARHEITTNLD 153

Query: 126 KWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTG 184
           +  + A   ++S+G+L ++ RP   + I+    R  +    I  ++P+  + A+ +L+  
Sbjct: 154 QICQVAQRTLKSNGRLVMVHRPDRFLDIIETMIRYNLAPKRIQFVYPKVHKDANMLLIEA 213

Query: 185 -RKGMRGQLRFRYPIVLHKPNG 205
            + G +  L+   P+ +H+ +G
Sbjct: 214 IKDGSQDGLKILPPLFIHEEDG 235


>gi|237757209|ref|ZP_04585623.1| methyltransferase small [Sulfurihydrogenibium yellowstonense SS-5]
 gi|237690629|gb|EEP59823.1| methyltransferase small [Sulfurihydrogenibium yellowstonense SS-5]
          Length = 232

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 52/230 (22%), Positives = 105/230 (45%), Gaps = 32/230 (13%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++L   +N   S  + D+G G+G   + ++ +    ++   E    +   A++       
Sbjct: 22  LLLVDFLNIKSSGKIIDIGTGSGIIPILISLKYKNLKLYALEVQEDLFDIAKRNF----- 76

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNN-FYDHVIMNPP-FNERIGTMTPDKI-KEEAH 117
                +I+ + V + L G  +++  + N+ ++D+V++NPP F E       +KI + EA 
Sbjct: 77  -----QINNVHVQIAL-GNVKDVKKIYNHQYFDYVVINPPYFKEGNYKNIQEKIARSEAL 130

Query: 118 VMLEDSFEKWIRTACAIMRSSGQLSLI------ARPQSLIQIVNACARRIGSLEITPLHP 171
             LED    +I  +  ++++ G+L LI      +   SL++  N   +R        +HP
Sbjct: 131 AKLED----FIYGSWYLLKNKGKLYLINITERFSETVSLLKKYNLQPKR-----YRFIHP 181

Query: 172 REGECASRILVTGRKGMR--GQLRFRYPIVLHKPNGQPYSRFVTDLI-NG 218
              E A+  LV   K  +  G++     I+   P  + Y+ +V +L+ NG
Sbjct: 182 SINEKATHFLVEASKNAKEGGEIVEAPLIIYENPKEKKYTDYVWNLLENG 231


>gi|309804244|ref|ZP_07698321.1| methyltransferase small domain protein [Lactobacillus iners LactinV
           11V1-d]
 gi|308163647|gb|EFO65917.1| methyltransferase small domain protein [Lactobacillus iners LactinV
           11V1-d]
          Length = 284

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 49/198 (24%), Positives = 93/198 (46%), Gaps = 19/198 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL  G GAA L + S  + A     E  P +A  A+++++L    Q+  RI++  ++ 
Sbjct: 50  VVDLCCGNGAATLYM-SYFNLAHYDAVEIQPEIASQAKRSVSL---NQLENRITVHCINA 105

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPF-----NERIGTMTPDKIKEEAHVMLEDSFEKWIR 129
             +   +NL   K   +D V +NPP+       RI    P++ K  A   +  + E+ I 
Sbjct: 106 --LDAPKNLGKDK---FDVVTVNPPYFKVPDGHRIN---PNQQKAIARHEILINLEQVII 157

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTG-RKG 187
            A  +++  G+L ++ RP+ L +I++ C +  +G   I P  P++    + ++V      
Sbjct: 158 VASQLLKMKGKLFIVHRPERLAEIIHYCLSNHMGVKNIQPFAPQKDHKTNLVVVEAVNNA 217

Query: 188 MRGQLRFRYPIVLHKPNG 205
               L    PI++H  + 
Sbjct: 218 PTDGLVLNNPIIVHNSDS 235


>gi|110803474|ref|YP_697596.1| hypothetical protein CPR_0266 [Clostridium perfringens SM101]
 gi|110683975|gb|ABG87345.1| conserved hypothetical protein [Clostridium perfringens SM101]
          Length = 249

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 51/226 (22%), Positives = 102/226 (45%), Gaps = 18/226 (7%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+  N      + DL  G G     +  + +  +++  E     A  A ++  +   
Sbjct: 36  VLLANFANVNRKHSVLDLCTGTGIIPFIIYGKKNPKEVVGIEIQEEFAEMANRSAKI--- 92

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFN-ERIGTM-TPDKIKEEAHV 118
             +  ++S I  D+     NR++       +D V +NPP+     G + + DK+    H 
Sbjct: 93  NDVQDKVSFICGDLKDKELNRSMPK-----FDVVTVNPPYKLNNAGIINSEDKLAIARHE 147

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE---ITPLHPREGE 175
           ++  + E  I  +   ++ +G+L ++ RP+ L  I   C  R   +E   +  +HP   +
Sbjct: 148 IMC-NLEDVIAASRRFLKDNGRLYMVHRPERLADIF--CLMRKYKIEPKRVRMVHPNTKK 204

Query: 176 CASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRS 221
            A+ +LV G++     L++  P+ ++K  G  YS  + D I G+ S
Sbjct: 205 AANIVLVEGQRDGGAFLKWEAPLYVYKDEGG-YSEEI-DKIYGRES 248


>gi|238852607|ref|ZP_04643017.1| methyltransferase domain protein [Lactobacillus gasseri 202-4]
 gi|238834753|gb|EEQ26980.1| methyltransferase domain protein [Lactobacillus gasseri 202-4]
          Length = 338

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 49/199 (24%), Positives = 93/199 (46%), Gaps = 13/199 (6%)

Query: 11  GSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLI 70
            ++ + DL +G  AA + + S  + A     E    MA  A +++ L      +K  + I
Sbjct: 46  DNYKVVDLCSGNAAASIYM-SYFNRAHYDAVEIQADMADQASRSIKL------NKFENRI 98

Query: 71  EVDVTLVGENRNLAGLKNNFYDHVIMNPPFNE--RIGTMTPDKIKEEAHVMLEDSFEKWI 128
           EV      E     G   + YD V++NPP+ +  +   + PD+ K  A   L  + E+ I
Sbjct: 99  EVHCLNALEAPKKLG--KDKYDMVVVNPPYFKVPKGHVINPDEKKALARHELAINLEQII 156

Query: 129 RTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE-ITPLHPREGECASRILVTG-RK 186
           + +  +++  G++ ++ RP+ L +I++ C     S++ + P   +    A+ ++V   R 
Sbjct: 157 KVSSDMLKMKGKMFMVHRPERLGEIMHYCLENHLSVKWVQPFVSKRNADANLVVVEAIRN 216

Query: 187 GMRGQLRFRYPIVLHKPNG 205
                L  R  IV+H P+G
Sbjct: 217 TASDGLTLRDAIVVHNPDG 235


>gi|315644350|ref|ZP_07897490.1| methyltransferase small [Paenibacillus vortex V453]
 gi|315280227|gb|EFU43519.1| methyltransferase small [Paenibacillus vortex V453]
          Length = 255

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 49/214 (22%), Positives = 102/214 (47%), Gaps = 25/214 (11%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA   +      + D+  G G   + +++R   A I   E  P +A  AR+++ +   
Sbjct: 38  VLLARFASVPRRGRILDMCTGNGVVPILLSTRTG-APIEGIEIQPRLADMARRSVTMNG- 95

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKE------ 114
             + ++I++ E D+  + + +         YD + +NPP+    G+    K+ E      
Sbjct: 96  --LQEQITIHEGDLRELYKEKGYGA-----YDLITVNPPYMPMNGSDL--KLNEHQAIAR 146

Query: 115 -EAHVMLEDSFEKWIRTACA-IMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHP 171
            E H  L +  E     ACA ++R  G++S++ +P  L +I+   ++ RI    I  +HP
Sbjct: 147 HEIHCTLAEVIE-----ACAKLLRQGGKMSMVHKPLRLAEIITLMSKYRIEPKVIRFVHP 201

Query: 172 REGECASRILVTGRKGMRGQLRFRYPIVLHKPNG 205
           R    A+ +L+ G +  + ++R + P++++   G
Sbjct: 202 RVDMEANMVLIEGIREGKPEVRLKPPLIVYDEQG 235


>gi|309807205|ref|ZP_07701179.1| methyltransferase small domain protein [Lactobacillus iners LactinV
           03V1-b]
 gi|308166426|gb|EFO68631.1| methyltransferase small domain protein [Lactobacillus iners LactinV
           03V1-b]
          Length = 316

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 49/198 (24%), Positives = 93/198 (46%), Gaps = 19/198 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL  G GAA L + S  + A     E  P +A  A+++++L    Q+  RI++  ++ 
Sbjct: 50  VVDLCCGNGAATLYM-SYFNLAHYDAVEIQPEIASQAKRSVSL---NQLENRITVHCINA 105

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPF-----NERIGTMTPDKIKEEAHVMLEDSFEKWIR 129
             +   +NL   K   +D V +NPP+       RI    P++ K  A   +  + E+ I 
Sbjct: 106 --LDAPKNLGKDK---FDVVTVNPPYFKVPDGHRIN---PNQQKAIARHEILINLEQVII 157

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTG-RKG 187
            A  +++  G+L ++ RP+ L +I++ C +  +G   I P  P++    + ++V      
Sbjct: 158 VASQLLKMKGKLFIVHRPERLAEIIHYCLSNHMGVKNIQPFAPQKDHKTNLVVVEAVNNA 217

Query: 188 MRGQLRFRYPIVLHKPNG 205
               L    PI++H  + 
Sbjct: 218 PTDGLVLNNPIIVHNSDS 235


>gi|331092559|ref|ZP_08341380.1| hypothetical protein HMPREF9477_02023 [Lachnospiraceae bacterium
           2_1_46FAA]
 gi|330400671|gb|EGG80277.1| hypothetical protein HMPREF9477_02023 [Lachnospiraceae bacterium
           2_1_46FAA]
          Length = 246

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 46/205 (22%), Positives = 93/205 (45%), Gaps = 12/205 (5%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++L++         + D+G G G   + + ++         E     A  AR+++A    
Sbjct: 35  VLLSNFARVKKGEKVLDIGTGTGIIPILLEAKTEGEHFTGLEIQEESADMARRSVAY--- 91

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFN-ERIGTMTPDKIKEEA-HV 118
             +  +I ++  DV    E  NL G  + F+D V  NPP+     G    D  K  A H 
Sbjct: 92  NHLEDKIDIVTGDVK---EAVNLFG--SVFFDVVTTNPPYMIGAHGLQNKDSAKAIARHE 146

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNA-CARRIGSLEITPLHPREGECA 177
           +L D  +  +R +  ++R  G+  ++ RP  L +I++  CA +I    +  +HP   +  
Sbjct: 147 VLCD-LDDILRESAKVLRPGGRFYMVHRPFRLAEILSKMCAYKIEPKRMRLVHPYIDKEP 205

Query: 178 SRILVTGRKGMRGQLRFRYPIVLHK 202
           + +L+ G +G   ++    P+++++
Sbjct: 206 NMVLIEGSRGGNSRMTVEPPLIVYR 230


>gi|311028966|ref|ZP_07707056.1| methyltransferase [Bacillus sp. m3-13]
          Length = 252

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 49/215 (22%), Positives = 96/215 (44%), Gaps = 18/215 (8%)

Query: 14  HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVD 73
           ++ DL  G G   L ++ R     I   E    +A  A ++ +      +  R+ +I +D
Sbjct: 50  NIMDLCTGNGIIPLLLSKRTR-GNITGVEIQERLAGMAERSFSYNG---LEDRLKIINMD 105

Query: 74  VTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVM-----LEDSFEKWI 128
           +  +      A L+N  YD V  NPP+     T   +KI    H       +E + E  +
Sbjct: 106 LKELP-----AMLENKKYDVVTCNPPYFPL--TEQEEKINSNIHYAIARHEIECTLEDVV 158

Query: 129 RTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRKG 187
           R    I +  G+++ + RP  L+ I++   + RI    +  +H + G+ A+ +L+ G K 
Sbjct: 159 RVCSQITKQGGKVAFVHRPGRLLDIISLMRKYRIEPKRLQFVHSKLGKPANTLLIEGIKD 218

Query: 188 MRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSL 222
               L+   P++++   G+ Y+  V  ++ G+  +
Sbjct: 219 GNPDLKILPPLLVYDEKGE-YTPEVRKMLFGEEQV 252


>gi|50365489|ref|YP_053914.1| S-adenosylmethionine:2-demethylmenaquinone methyltransferase
           [Mesoplasma florum L1]
 gi|50364045|gb|AAT76030.1| S-adenosylmethionine:2-demethylmenaquinone methyltransferase
           [Mesoplasma florum L1]
          Length = 240

 Score = 48.9 bits (115), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 49/214 (22%), Positives = 97/214 (45%), Gaps = 25/214 (11%)

Query: 1   MILASLVNATGSFH-LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPA 59
           +++A  +N   S   + D G       L V S+   A+I+  E     A  A + + L  
Sbjct: 29  VLIARFINLKSSIKKIVDFGTNNAVIPLIV-SKYTNAKIVGVEIQTKAAELAIENIEL-- 85

Query: 60  NAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEA--- 116
             ++++++ ++  D+      +  A    N +D VI NPPF ++       KI EE    
Sbjct: 86  -NKLTEQVEIVNSDI------KTYAKEMANKFDAVICNPPFFKKHEESKVKKISEEVVNA 138

Query: 117 -HVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREG 174
            H  L  + E+ I+ A  I+++ G  +L+ RP+ + +I+N   + +     +  +H +  
Sbjct: 139 RHETL-ITLEEIIKNAGLILKNGGSFTLVHRPERIGEIINLMYKYKFAPKRMQFVHSKAN 197

Query: 175 ECASRILVT----GRKGMRGQLRFRYPIVLHKPN 204
           + A  +L+     G +GM    +   P++ HK +
Sbjct: 198 DEAKTVLIDAILEGNEGM----QILKPLISHKDD 227


>gi|261403896|ref|YP_003240137.1| methyltransferase small [Paenibacillus sp. Y412MC10]
 gi|261280359|gb|ACX62330.1| methyltransferase small [Paenibacillus sp. Y412MC10]
          Length = 255

 Score = 48.9 bits (115), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 48/214 (22%), Positives = 102/214 (47%), Gaps = 25/214 (11%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA   +      + D+  G G   + +++R   A I   E  P +A  AR+++ +   
Sbjct: 38  VLLARFASIPRRGRILDMCTGNGVIPILLSTRTG-APIEGIEIQPRLADMARRSVVM--- 93

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKE------ 114
             +  +I++ E D+  + + +         YD + +NPP+    G+    K+ E      
Sbjct: 94  NDLQDQITIHEGDLRELYKEKGYGA-----YDLITVNPPYMPMNGSDL--KLNEHQAIAR 146

Query: 115 -EAHVMLEDSFEKWIRTACA-IMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHP 171
            E H  LE+  E     +CA +++  G++S++ +P  L +I+   ++ RI    I  +HP
Sbjct: 147 HEIHCTLEEVIE-----SCARLLKQGGKMSMVHKPLRLAEIITLMSKYRIEPKVIRFVHP 201

Query: 172 REGECASRILVTGRKGMRGQLRFRYPIVLHKPNG 205
           R    A+ +L+ G +  + ++R + P++++   G
Sbjct: 202 RVKMEANMVLIEGIRDGKPEVRLKPPLIVYDEQG 235


>gi|56418563|ref|YP_145881.1| hypothetical protein GK0028 [Geobacillus kaustophilus HTA426]
 gi|56378405|dbj|BAD74313.1| hypothetical conserved protein [Geobacillus kaustophilus HTA426]
          Length = 248

 Score = 48.9 bits (115), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 61/122 (50%), Gaps = 9/122 (7%)

Query: 91  YDHVIMNPPFNERIGTMTPDKIKEEAHVMLED-----SFEKWIRTACAIMRSSGQLSLIA 145
           YD V  NPP+   +G    D++ +  H+ +       + E  IR +  +++  G+ + + 
Sbjct: 115 YDVVTCNPPYFPAVGK---DELSKNEHIAIARHEIYCTLEDVIRVSSQLLKQGGKAAFVH 171

Query: 146 RPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPN 204
           RP  L+ +V    + R+    +  ++P+EG+ A+ IL+ G K     L+   P+V++  N
Sbjct: 172 RPGRLLDLVTLMRQYRLEPKRLRFVYPKEGKEANMILIEGTKDASPDLKVLPPLVVYDEN 231

Query: 205 GQ 206
            +
Sbjct: 232 NE 233


>gi|329925542|ref|ZP_08280416.1| methyltransferase small domain protein [Paenibacillus sp. HGF5]
 gi|328939825|gb|EGG36165.1| methyltransferase small domain protein [Paenibacillus sp. HGF5]
          Length = 255

 Score = 48.9 bits (115), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 46/200 (23%), Positives = 97/200 (48%), Gaps = 25/200 (12%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + D+  G G   + +++R     I   E  P +A  AR+++A+     +  +I++ E D+
Sbjct: 52  ILDMCTGNGVIPILLSTRTG-TPIEGIEIQPRLADMARRSVAM---NDLQDQITIHEGDL 107

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKE-------EAHVMLEDSFEKW 127
             + + +         YD + +NPP+    G+    K+ E       E H  LE+  E  
Sbjct: 108 RELYKEKGYGA-----YDLITVNPPYMPMNGSDL--KLNEHQAIARHEIHCTLEEVIE-- 158

Query: 128 IRTACA-IMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGR 185
              +CA +++  G++S++ +P  L +I+   ++ RI    I  +HPR    A+ +L+ G 
Sbjct: 159 ---SCARLLKQGGKMSMVHKPLRLAEIITLMSKYRIEPKVIRFVHPRVKMEANMVLIEGI 215

Query: 186 KGMRGQLRFRYPIVLHKPNG 205
           +  + ++R + P++++   G
Sbjct: 216 RDGKPEVRLKPPLIVYDEQG 235


>gi|261417528|ref|YP_003251210.1| methyltransferase small [Geobacillus sp. Y412MC61]
 gi|297528403|ref|YP_003669678.1| methyltransferase small [Geobacillus sp. C56-T3]
 gi|319765185|ref|YP_004130686.1| methyltransferase small [Geobacillus sp. Y412MC52]
 gi|261373985|gb|ACX76728.1| methyltransferase small [Geobacillus sp. Y412MC61]
 gi|297251655|gb|ADI25101.1| methyltransferase small [Geobacillus sp. C56-T3]
 gi|317110051|gb|ADU92543.1| methyltransferase small [Geobacillus sp. Y412MC52]
          Length = 249

 Score = 48.9 bits (115), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 61/122 (50%), Gaps = 9/122 (7%)

Query: 91  YDHVIMNPPFNERIGTMTPDKIKEEAHVMLED-----SFEKWIRTACAIMRSSGQLSLIA 145
           YD V  NPP+   +G    D++ +  H+ +       + E  IR +  +++  G+ + + 
Sbjct: 116 YDVVTCNPPYFPAVGK---DELSKNEHIAIARHEIYCTLEDVIRVSSQLLKQGGKAAFVH 172

Query: 146 RPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPN 204
           RP  L+ +V    + R+    +  ++P+EG+ A+ IL+ G K     L+   P+V++  N
Sbjct: 173 RPGRLLDLVTLMRQYRLEPKRLRFVYPKEGKEANMILIEGTKDASPDLKVLPPLVVYDEN 232

Query: 205 GQ 206
            +
Sbjct: 233 NE 234


>gi|310639494|ref|YP_003944252.1| methyltransferase small [Paenibacillus polymyxa SC2]
 gi|309244444|gb|ADO54011.1| Methyltransferase small [Paenibacillus polymyxa SC2]
          Length = 252

 Score = 48.9 bits (115), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 51/200 (25%), Positives = 97/200 (48%), Gaps = 25/200 (12%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL  G G   + + +R  +A I   E  P +A  AR++++L     +   I + E   
Sbjct: 50  ILDLCTGNGVVPILLTTRT-KASIEGIEIQPRLADMARRSVSLNG---LEDAIEIRE--- 102

Query: 75  TLVGENRNLAGLKNN-FYDHVIMNPPFNERIGTMTPDKIKEEAHVMLED-----SFEKWI 128
              G+ R L  +  +  YD + +NPP+    G+     IK   H  +       + E+ I
Sbjct: 103 ---GDLRELVQITGHGAYDAITVNPPYMPLNGS----DIKLNPHQAIARHEVNCTLEEVI 155

Query: 129 RTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE---ITPLHPREGECASRILVTGR 185
           +    ++R+ G++S++ RPQ L +I++    R  SLE   I  +HPR    A+ +LV   
Sbjct: 156 QACTRLVRNGGKVSMVHRPQRLAEIISLM--RSYSLEPKRIRFVHPRIHMEANMVLVEAM 213

Query: 186 KGMRGQLRFRYPIVLHKPNG 205
           +  + ++R   P+++++ +G
Sbjct: 214 RDGKPEVRLLPPLIVYQEDG 233


>gi|15893598|ref|NP_346947.1| SAM-dependent methyltransferase [Clostridium acetobutylicum ATCC
           824]
 gi|15023149|gb|AAK78287.1|AE007545_4 SAM-dependent methyltransferase [Clostridium acetobutylicum ATCC
           824]
 gi|325507718|gb|ADZ19354.1| SAM-dependent methyltransferase [Clostridium acetobutylicum EA
           2018]
          Length = 244

 Score = 48.9 bits (115), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 50/215 (23%), Positives = 94/215 (43%), Gaps = 24/215 (11%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+      +  + DL +G G     +  +     I   E    M   A +T+     
Sbjct: 34  VLLANYAKVKSNQTVIDLCSGTGIIPFIIQGKKSPRHITGIEIQEDMVQMANRTVLY--- 90

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKN-NFYDHVIMNPPFNER----IGTMTPDKI-KE 114
            +  ++I  I  D+      +NLA LK     D V +NPP+  R    +     + I + 
Sbjct: 91  NKFQEKIKFINEDI------KNLAELKKLERVDVVTVNPPYKLRNSGIVNEFDKNAIARH 144

Query: 115 EAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE---ITPLHP 171
           E    LED     I+ A  +++ +G+L ++ RP+ L  I+  C  R   +E   I  ++P
Sbjct: 145 EICCTLEDV----IKAARTLLKDNGRLFMVHRPERLADIL--CLMREYKIEPKSIKMVYP 198

Query: 172 REGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQ 206
              +  + +L+ G++     L++   + +HK NG+
Sbjct: 199 SVNKAPNIVLIEGQRDGGAFLKWEKSLYIHKENGE 233


>gi|282850827|ref|ZP_06260201.1| GIY-YIG catalytic domain protein [Lactobacillus gasseri 224-1]
 gi|282557779|gb|EFB63367.1| GIY-YIG catalytic domain protein [Lactobacillus gasseri 224-1]
          Length = 338

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 47/199 (23%), Positives = 92/199 (46%), Gaps = 13/199 (6%)

Query: 11  GSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLI 70
            ++ + DL +G  AA + + S  + A     E    MA  A +++ L    ++  RI   
Sbjct: 46  DNYKVVDLCSGNAAASIYM-SYFNRAHYDAVEIQADMADQASRSIKL---NKLENRI--- 98

Query: 71  EVDVTLVGENRNLAGLKNNFYDHVIMNPPFNE--RIGTMTPDKIKEEAHVMLEDSFEKWI 128
             +V  +        L  + YD V++NPP+    +   + PD+ K  A   L  + E+ I
Sbjct: 99  --EVHCLNALEAPKKLGKDKYDMVVVNPPYFRVPKGHVINPDEKKALARHELAINLEQII 156

Query: 129 RTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE-ITPLHPREGECASRILVTG-RK 186
           + +  +++  G++ ++ RP+ L +I++ C     S++ + P   +    A+ ++V   R 
Sbjct: 157 KVSSDMLKMKGKMFMVHRPERLGEIMHYCLENHLSVKWVQPFVSKRNADANLVVVEAIRN 216

Query: 187 GMRGQLRFRYPIVLHKPNG 205
                L  R  IV+H P+G
Sbjct: 217 TASDGLTLRDAIVVHNPDG 235


>gi|187777347|ref|ZP_02993820.1| hypothetical protein CLOSPO_00899 [Clostridium sporogenes ATCC
           15579]
 gi|187774275|gb|EDU38077.1| hypothetical protein CLOSPO_00899 [Clostridium sporogenes ATCC
           15579]
          Length = 246

 Score = 48.5 bits (114), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 46/213 (21%), Positives = 96/213 (45%), Gaps = 20/213 (9%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+         + DL  G G     +A + + + I+  E    +A  A++++     
Sbjct: 35  VLLANFPRIKNGDEVVDLCTGTGIIPFILAGKTNASNIIGIEIQKEIADMAKRSIKY--- 91

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKN-NFYDHVIMNPPFNER----IGTMTPDKI-KE 114
             + +++  IE      G+ +++  LK+    D V +NPP+  +    I     + I + 
Sbjct: 92  NNLQEKVKFIE------GDLKDIKLLKDIEKADVVTVNPPYKTQGTGIININDKNAISRH 145

Query: 115 EAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARR-IGSLEITPLHPRE 173
           E    L+D     ++ A  +++  G+L +I RP  ++ I+N   +  I    I  +HP  
Sbjct: 146 EICCTLDDV----VKAAKILLKDKGKLYMIHRPDRIVDIMNVMRKYCIEPKLIRTIHPAV 201

Query: 174 GECASRILVTGRKGMRGQLRFRYPIVLHKPNGQ 206
            +  S IL+ G+K     L++  P+ ++  N +
Sbjct: 202 DKAPSMILIEGQKNGGKFLKWDSPLYIYDENNK 234


>gi|315652701|ref|ZP_07905675.1| O-methyltransferase [Eubacterium saburreum DSM 3986]
 gi|315484903|gb|EFU75311.1| O-methyltransferase [Eubacterium saburreum DSM 3986]
          Length = 249

 Score = 48.5 bits (114), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 46/205 (22%), Positives = 96/205 (46%), Gaps = 12/205 (5%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++L++ V      +  DL  G+G   + ++++    +I   E    +A  A ++++    
Sbjct: 39  VLLSNFVKVKKDGYAVDLCTGSGIVPILLSTKTKAKKITGIEIQSDIADMASRSVSY--- 95

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTM-TPD-KIKEEAHV 118
            ++ ++I +I  D++       L  +K++  D V +NPP+ + +  +  PD  +    H 
Sbjct: 96  NKLDEKIDIINDDIS-----NALKYIKHSCVDTVCVNPPYMKDMAAIKNPDLPLAIARHE 150

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECA 177
           +L D  E  I  A  +++ +G+  +I RP  L +I  +  + RI    I  +H      A
Sbjct: 151 LLTD-LESVINIANKLLKENGRFFMIHRPSRLSEIFASMKQNRIEPKRIRFIHSYIDSKA 209

Query: 178 SRILVTGRKGMRGQLRFRYPIVLHK 202
           + +L+ G KG    L    P+ ++K
Sbjct: 210 NLVLIEGLKGSGVWLDVEPPLAVYK 234


>gi|160882029|ref|YP_001560997.1| methyltransferase type 11 [Clostridium phytofermentans ISDg]
 gi|160430695|gb|ABX44258.1| Methyltransferase type 11 [Clostridium phytofermentans ISDg]
          Length = 256

 Score = 48.5 bits (114), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 41/188 (21%), Positives = 84/188 (44%), Gaps = 10/188 (5%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           D+G G G   + +A +         E     A  AR+++       +  RI +++ D+  
Sbjct: 62  DMGTGTGIIPILLAGKTKGKHFTGLEIQEESADMARRSVLY---NDLQDRIEIVKGDIK- 117

Query: 77  VGENRNLAGLKNNFYDHVIMNPPF-NERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIM 135
             E   + G     +D V  NPP+ N + G + P   K  A   +  S E  IR A  ++
Sbjct: 118 --ETSKIFG--GGSFDVVTCNPPYMNNQHGLVNPTMPKAIARHEILCSLEDVIREAAKVL 173

Query: 136 RSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRKGMRGQLRF 194
           + +G+  ++ RP  L++I +   + ++    +  +HP   +  + +L+ G +G    +  
Sbjct: 174 KPNGRFYMVHRPHRLVEIFSIMRQYKLEPKRMKLVHPYADKEPNMVLIEGLRGGNPMITI 233

Query: 195 RYPIVLHK 202
             P+V+++
Sbjct: 234 EAPLVVYR 241


>gi|300361913|ref|ZP_07058090.1| O-methyltransferase [Lactobacillus gasseri JV-V03]
 gi|300354532|gb|EFJ70403.1| O-methyltransferase [Lactobacillus gasseri JV-V03]
          Length = 342

 Score = 48.5 bits (114), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 47/199 (23%), Positives = 93/199 (46%), Gaps = 13/199 (6%)

Query: 11  GSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLI 70
            ++ + DL +G  AA + + S  + A     E    MA  AR+++ L    ++  RI   
Sbjct: 46  DNYKVVDLCSGNAAASIYM-SYFNRAHYDAVEIQADMADQARRSIEL---NKLENRI--- 98

Query: 71  EVDVTLVGENRNLAGLKNNFYDHVIMNPPFNE--RIGTMTPDKIKEEAHVMLEDSFEKWI 128
             +V  +        L  + YD V++NPP+ +  +   + PD+ K  A   L  + E+ I
Sbjct: 99  --EVHCLNALEAPKKLGKDKYDMVVVNPPYFKVPKGHVINPDEKKALARHELAINLEQII 156

Query: 129 RTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE-ITPLHPREGECASRILVTG-RK 186
           + +  +++  G++ ++ RP+ L +I++ C     S++ + P   +    A+ ++V   R 
Sbjct: 157 KVSSDMLKMKGKMFMVHRPERLGEIMHYCLENHLSVKWVQPFVSKRNADANLVVVEAIRN 216

Query: 187 GMRGQLRFRYPIVLHKPNG 205
                L  R  IV+H  +G
Sbjct: 217 TASDGLTLRDAIVVHNQDG 235


>gi|229542299|ref|ZP_04431359.1| methyltransferase small [Bacillus coagulans 36D1]
 gi|229326719|gb|EEN92394.1| methyltransferase small [Bacillus coagulans 36D1]
          Length = 248

 Score = 48.5 bits (114), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 46/211 (21%), Positives = 100/211 (47%), Gaps = 19/211 (9%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DL  G G   L +++R  +A+I   E    ++  A++++A      +  RI +I  D+  
Sbjct: 51  DLCTGNGVIPLLLSNRT-KAEITGVEIQERLSDMAKRSVAYNG---LEDRIRIIHGDLK- 105

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLED-----SFEKWIRTA 131
             E  ++ G     +D V  NPP+     + T +   E  H  +       + E  ++ +
Sbjct: 106 --EMPDVLGCSK--FDVVTCNPPY---FPSQTKNIQNENEHFAIARHEIFCTLEDVVKVS 158

Query: 132 CAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRKGMRG 190
             +++  G+ + + RP  L+ ++    + R+    +  ++P+ G+ A+ ILV G K  + 
Sbjct: 159 SRMLKQGGKAAFVHRPGRLVDLITLMKKHRLEPKRLRFVYPKAGKEANTILVEGIKDGKP 218

Query: 191 QLRFRYPIVLHKPNGQPYSRFVTDLINGKRS 221
            L+   P+ ++  +G+ Y+  V +L+ G ++
Sbjct: 219 DLKIFPPLFVYGQDGE-YTEEVKELLYGNKN 248


>gi|291520312|emb|CBK75533.1| Predicted O-methyltransferase [Butyrivibrio fibrisolvens 16/4]
          Length = 250

 Score = 48.5 bits (114), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 48/201 (23%), Positives = 89/201 (44%), Gaps = 11/201 (5%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DLG G G   + + ++   A     E  P  A  A +++ L     +  +I +IE D+  
Sbjct: 51  DLGTGTGILPILLEAKTGGAHFTGLEIQPESAEMANRSVLLNG---LEDKIDIIEGDIK- 106

Query: 77  VGENRNLAGLKNNFYDHVIMNPPF-NERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIM 135
             E   + G      + V  NPP+     G   P+  K  A   L  S E  IR   A++
Sbjct: 107 --EAAQIFG--KGSMNVVTSNPPYMTNHHGLKNPNDAKAIARHELLCSLEDVIRETSAVL 162

Query: 136 RSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRKGMRGQLRF 194
           +  G+   + RP  L++I+    + ++    +  ++P   +  + +L+ G KG   QL  
Sbjct: 163 KQMGRCYFVHRPFRLVEIIILMRKYKLEPKRMRLVYPFVDKEPNMVLIEGVKGGGPQLTV 222

Query: 195 RYPIVLHKPNGQPYSRFVTDL 215
             P++++   GQ Y++ + D+
Sbjct: 223 EPPLIVYDAPGQ-YTKEIYDI 242


>gi|259501574|ref|ZP_05744476.1| methyltransferase [Lactobacillus iners DSM 13335]
 gi|302191452|ref|ZP_07267706.1| hypothetical protein LineA_05554 [Lactobacillus iners AB-1]
 gi|312873338|ref|ZP_07733391.1| GIY-YIG catalytic domain protein [Lactobacillus iners LEAF 2052A-d]
 gi|312875785|ref|ZP_07735777.1| GIY-YIG catalytic domain protein [Lactobacillus iners LEAF 2053A-b]
 gi|325913457|ref|ZP_08175823.1| GIY-YIG catalytic domain protein [Lactobacillus iners UPII 60-B]
 gi|259167092|gb|EEW51587.1| methyltransferase [Lactobacillus iners DSM 13335]
 gi|311088689|gb|EFQ47141.1| GIY-YIG catalytic domain protein [Lactobacillus iners LEAF 2053A-b]
 gi|311091128|gb|EFQ49519.1| GIY-YIG catalytic domain protein [Lactobacillus iners LEAF 2052A-d]
 gi|325477226|gb|EGC80372.1| GIY-YIG catalytic domain protein [Lactobacillus iners UPII 60-B]
          Length = 342

 Score = 48.1 bits (113), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 48/198 (24%), Positives = 92/198 (46%), Gaps = 19/198 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL  G GAA L + S  + A     E  P +A  A+++++L    Q+  RI++  ++ 
Sbjct: 50  VVDLCCGNGAATLYM-SYFNLAHYDAVEIQPEIASQAKRSVSL---NQLENRITVHCINA 105

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPF-----NERIGTMTPDKIKEEAHVMLEDSFEKWIR 129
               +N     L  + +D V +NPP+       RI    P++ K  A   +  + E+ I 
Sbjct: 106 LDAPKN-----LGKDKFDVVTVNPPYFKVPDGHRIN---PNQQKAIARHEILINLEQVII 157

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTG-RKG 187
            A  +++  G+L ++ RP+ L +I++ C +  +G   I P  P++    + ++V      
Sbjct: 158 VASQLLKMKGKLFIVHRPERLAEIIHYCLSNHMGVKNIQPFAPQKDHKTNLVVVEAVNNA 217

Query: 188 MRGQLRFRYPIVLHKPNG 205
               L    PI++H  + 
Sbjct: 218 PTDGLVLNNPIIVHNSDS 235


>gi|239623106|ref|ZP_04666137.1| methyltransferase type 11 [Clostridiales bacterium 1_7_47_FAA]
 gi|239522473|gb|EEQ62339.1| methyltransferase type 11 [Clostridiales bacterium 1_7_47FAA]
          Length = 253

 Score = 48.1 bits (113), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 41/198 (20%), Positives = 87/198 (43%), Gaps = 11/198 (5%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DLG G G   + + ++         E     A  AR+++       + +++ ++  D+
Sbjct: 57  MLDLGTGTGIIPILLTAKTEGEHFTGLEIQEESADMARRSVRY---NHLEEKVDIVTGDI 113

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPF-NERIGTMTPDKIKEEAHVMLEDSFEKWIRTACA 133
               E   L  L +  +D V  NPP+ N+  G   P   K  A   ++ + E  +R    
Sbjct: 114 V---EASQLFALAS--FDVVTSNPPYMNDAHGLKNPGDAKAIARHEVKCTLEDVVREGTR 168

Query: 134 IMRSSGQLSLIARPQSLIQIVNACARR-IGSLEITPLHPREGECASRILVTGRKGMRGQL 192
           +++  G+  ++ RP+ LI+I+    +  +    +  +HP     A+ +L+   +G    L
Sbjct: 169 VLKPGGRFYMVHRPRRLIEIIQTMKKHGLEPKRMKMVHPYVDREANMVLIEAVRGGGALL 228

Query: 193 RFRYPIVLHKPNGQPYSR 210
           +   P+++    G+ Y+R
Sbjct: 229 KMEAPVIVFNEQGE-YTR 245


>gi|299820729|ref|ZP_07052618.1| O-methyltransferase [Listeria grayi DSM 20601]
 gi|299817750|gb|EFI84985.1| O-methyltransferase [Listeria grayi DSM 20601]
          Length = 254

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/214 (21%), Positives = 104/214 (48%), Gaps = 21/214 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G G   L +++R + A I+  E    +A  A++++      +++++I + E D+
Sbjct: 55  IIDLCSGNGIIPLLLSTRTN-ASIIGVELQQRLADMAKRSIRY---NKLTEQIEIYEHDL 110

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKE-EAHVMLED-----SFEKWI 128
             +      + L     D V  NPP+        P  +K    H+ +       + +  I
Sbjct: 111 RTIT-----SVLPKERADVVTCNPPY----FATPPTSLKNGNPHLAIARHEIMCTLDDVI 161

Query: 129 RTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRKG 187
           +T+  +++  G++ L+ RP+ LI +++   + R+    +  +HP+  + A+ +L+ G K 
Sbjct: 162 KTSSELVKQGGKVFLVHRPERLIDMIDIMRKYRLEPKRVQMVHPQIHKDANTVLIEGIKD 221

Query: 188 MRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRS 221
            +  +++  PI++H      Y+  V +++ G RS
Sbjct: 222 GKPGVKYLPPIIVHDAE-HAYTDEVREMLYGSRS 254


>gi|242310513|ref|ZP_04809668.1| methyltransferase small [Helicobacter pullorum MIT 98-5489]
 gi|239522911|gb|EEQ62777.1| methyltransferase small [Helicobacter pullorum MIT 98-5489]
          Length = 230

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/196 (22%), Positives = 89/196 (45%), Gaps = 22/196 (11%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + ++G+G+G  G+  A R  E  +++ E++P M    ++ L          R++ I+ ++
Sbjct: 33  ILEVGSGSGVLGMLCA-RDVEIDLMMIEKNPKMWELCQQNL----------RVNKIKAEL 81

Query: 75  TLVGE--NRNLAGLKNNFYDHVIMNPPF--NERIGTMTPDKIKEEAHVMLEDSFEKWIRT 130
            L G+    +   LK   +D ++ NPPF  N  I ++  D         L   FE  ++ 
Sbjct: 82  -LNGDFLQYDFLDLK---FDCILSNPPFYHNGVIKSVNNDICMARYEENL--PFEAMVQK 135

Query: 131 ACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRKGMR 189
              +++  G+       +   ++     + +I  + I  +HP+E + A+ +L   +K  +
Sbjct: 136 INILLKPQGEFIFCYDCRESFKVFGILFKYKIRPITICYVHPKEDKEATLLLCRAKKDSK 195

Query: 190 GQLRFRYPIVLHKPNG 205
            Q+R   PI  H  NG
Sbjct: 196 SQMRILPPIFTHNANG 211


>gi|293391527|ref|ZP_06635861.1| phosphatidylserine synthase [Aggregatibacter actinomycetemcomitans
           D7S-1]
 gi|290952061|gb|EFE02180.1| phosphatidylserine synthase [Aggregatibacter actinomycetemcomitans
           D7S-1]
          Length = 232

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 71/146 (48%), Gaps = 13/146 (8%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLH-EAQILLAERSPLMAHYARKTLALPA 59
           ++L +  N T +  + DLG G+G   L +A R   E++I   E  P  A  A++ +   +
Sbjct: 24  ILLGAWANVTQAKQILDLGCGSGLIALMLAQRSSAESRICAVEIDPAAAQQAQENV---S 80

Query: 60  NAQISKRISLIEVDV-TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHV 118
            +    +I + + D+ T   +++++       +D ++ NPP+ +  G    ++ +  A  
Sbjct: 81  ASPWKDKIQVYQQDIETFCAQSKHV-------FDLIVANPPYFQ-TGVDCRNEARNTARY 132

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLI 144
           +   S   W+ TA + + S G++S +
Sbjct: 133 LASQSHLHWLETAVSCLASKGKISFV 158


>gi|260655696|ref|ZP_05861169.1| putative methyltransferase [Jonquetella anthropi E3_33 E1]
 gi|260629613|gb|EEX47807.1| putative methyltransferase [Jonquetella anthropi E3_33 E1]
          Length = 246

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 62/221 (28%), Positives = 91/221 (41%), Gaps = 25/221 (11%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA  V         +LG   G   + +A R   A +   E        AR+      N
Sbjct: 29  ILLAGFVRLKRRERALELGCATGGVAMLMAWR-SSAHVTGLEIDQRFVELARQ------N 81

Query: 61  AQ---ISKRISLIEVDVT-LVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEE- 115
           A+   +S R+S +  D+T L G        +   YD V  NPP+ E IG   P    E+ 
Sbjct: 82  AESNGLSDRLSFVCGDLTQLWGRG------QGGEYDVVAANPPYEE-IGQGQPCASPEDR 134

Query: 116 -AHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPL---HP 171
            A      +     R A   +R  G+L ++ R + L   V AC R   SLE + L   HP
Sbjct: 135 TARQGSACTLSDVCRAASWSLRDKGRLYMVMRARRLADTV-ACLR-AASLEPSVLRFVHP 192

Query: 172 REGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFV 212
           +    AS  L+  R+     LR   P+V+H P+G     F+
Sbjct: 193 KADRPASVFLMEARRFGGVGLRVLRPLVMHAPDGSLTDEFL 233


>gi|224418458|ref|ZP_03656464.1| SAM dependent methyltransferase [Helicobacter canadensis MIT
           98-5491]
 gi|253827774|ref|ZP_04870659.1| putative O-methyltransferase [Helicobacter canadensis MIT 98-5491]
 gi|313141990|ref|ZP_07804183.1| methyltransferase small [Helicobacter canadensis MIT 98-5491]
 gi|253511180|gb|EES89839.1| putative O-methyltransferase [Helicobacter canadensis MIT 98-5491]
 gi|313131021|gb|EFR48638.1| methyltransferase small [Helicobacter canadensis MIT 98-5491]
          Length = 230

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/197 (20%), Positives = 86/197 (43%), Gaps = 24/197 (12%)

Query: 14  HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVD 73
            + ++G+G+G  GL  A  + E  + + E++P M    +  L +              V+
Sbjct: 32  QVLEVGSGSGVLGLLCAKEV-EMDLTMIEKNPKMLELCQHNLRING------------VE 78

Query: 74  VTLVGEN---RNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDS--FEKWI 128
             L+G +    N   LK   +D+++ NPPF      +   K K+      E++  F   +
Sbjct: 79  AKLMGGDFLEYNFLDLK---FDYILSNPPFYH--NGVIRSKNKDICLARYEENLPFSSMV 133

Query: 129 RTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRKG 187
           +   A+++  G+       +   ++       +I  + +  +HPRE E A+ +L   +K 
Sbjct: 134 KKINALLKPQGEFIFCYDSRESFKVFGILFEFKIRPIIVRYVHPRENEEATLLLCRAKKN 193

Query: 188 MRGQLRFRYPIVLHKPN 204
            + Q++   P++ H+ N
Sbjct: 194 SKSQMQILSPLLTHQDN 210


>gi|317126776|ref|YP_004093058.1| methyltransferase small [Bacillus cellulosilyticus DSM 2522]
 gi|315471724|gb|ADU28327.1| methyltransferase small [Bacillus cellulosilyticus DSM 2522]
          Length = 240

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/195 (21%), Positives = 95/195 (48%), Gaps = 26/195 (13%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DL +G GA  L ++ R  EA+I   E   ++   A ++++      + ++I++I      
Sbjct: 45  DLCSGNGAIPLMLSVRT-EAKIDAVEIQDILCSLAERSVSYNG---LEEQINVI------ 94

Query: 77  VGENRNLAGLKNNF----YDHVIMNPPFNERIGTMTPDKIKEEAHVM-----LEDSFEKW 127
              N+N+  L++      YD V  NPP+      +  D+I     V      +  + E  
Sbjct: 95  ---NKNILHLQDEVEWGTYDLVTCNPPY---FPVIALDRINNNEKVSYARHEIACNLEDV 148

Query: 128 IRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRK 186
           IR +  +++ +G+L+++ RP+ +++I+    + ++    I  +HP++   A+ +L+ G +
Sbjct: 149 IRISSRLVKQTGRLAMVHRPERVVEIITLMTKYQLEPKRIQYVHPKKDREANMVLIEGSR 208

Query: 187 GMRGQLRFRYPIVLH 201
             +  ++   P +++
Sbjct: 209 AGKPGIKTLPPFIVY 223


>gi|297243817|ref|ZP_06927747.1| methylase of polypeptide chain release factors [Gardnerella
           vaginalis AMD]
 gi|296888238|gb|EFH26980.1| methylase of polypeptide chain release factors [Gardnerella
           vaginalis AMD]
          Length = 332

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 46/96 (47%), Gaps = 14/96 (14%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPA----NAQISKRISLI 70
           + DL AG+GA GL++A+ + +AQ+   E+SP    Y RK     A    N QIS R   +
Sbjct: 123 VVDLCAGSGAIGLSIATEVADAQVWAVEKSPEAFQYLRKNFEETAKNYENMQISSRYHAV 182

Query: 71  EVDVT------LVGENRNLAGLKNNFYDHVIMNPPF 100
             D T      L  E   + G      D VI NPP+
Sbjct: 183 LADATKAHISDLTPELHAICGK----VDLVITNPPY 214


>gi|325478544|gb|EGC81656.1| methyltransferase small domain protein [Anaerococcus prevotii
           ACS-065-V-Col13]
          Length = 235

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/198 (21%), Positives = 85/198 (42%), Gaps = 21/198 (10%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           +IL +         L D+GAG+G       S     ++   E     A   ++ + L   
Sbjct: 28  IILGNFAKMKKDKVLLDIGAGSGVLSFLANSLYDLKKVYAVEIQKDKADLLKENIKL--- 84

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF---NERIGTMTPDKI--KEE 115
                +++ IEV    + ++ N   +K N  D++I NPP+   ++ IG    + +  ++E
Sbjct: 85  ----NKLTNIEV----INDDLNNINIKENSLDYIITNPPYYKISDNIGNKNEEFLISRQE 136

Query: 116 AHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGE 175
            ++ L+D F      A   ++  G+L +I +P+ +++I       I    +  +  R GE
Sbjct: 137 KYLSLDDIFS----FANKSLKDRGRLFMIHKPERMVEIFQKSG-NIKVKRVRFVQSRSGE 191

Query: 176 CASRILVTGRKGMRGQLR 193
               IL+   K  +  L+
Sbjct: 192 KPQFILIEFVKNAKDGLK 209


>gi|225850601|ref|YP_002730835.1| methyltransferase small [Persephonella marina EX-H1]
 gi|225646244|gb|ACO04430.1| methyltransferase small [Persephonella marina EX-H1]
          Length = 246

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/216 (20%), Positives = 96/216 (44%), Gaps = 18/216 (8%)

Query: 1   MILASLVNATGSF-HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPA 59
           +IL+S    T     + DLG G+G   + ++ +  + +    E    +   A++   L  
Sbjct: 33  VILSSFPEITKKKGKIIDLGTGSGIILILLSLKYPDLEFHAIEIQEDLFDMAKRNFELN- 91

Query: 60  NAQISKRISLIEVDVTLV-GENRNLAGL-KNNFYDHVIMNPPFNERIGTMTPDKIKEEAH 117
                       V+V L+ G+ +++  L +  ++D+VI NPP+ ++  T    + ++ A 
Sbjct: 92  -----------RVNVNLIKGDIKDIKKLYQPQYFDYVITNPPYFKKEFTQKASQEEKIAR 140

Query: 118 VMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGEC 176
             +  + E +I+    +++  G+  +I   + L  I       R+       +HP + E 
Sbjct: 141 YEITATVEDFIKAGSYLLKDKGRFYMIYPSERLSYITRVMVENRVQPKRYRFVHPSKDER 200

Query: 177 ASRILVTG-RKGMRGQLRFRYPIVLHK-PNGQPYSR 210
           ++  L+ G R G  G      P++++  PN + YS+
Sbjct: 201 STHFLIEGMRSGKEGGEIIEKPMIIYDNPNIKKYSQ 236


>gi|115378992|ref|ZP_01466123.1| methyltransferase [Stigmatella aurantiaca DW4/3-1]
 gi|115363996|gb|EAU63100.1| methyltransferase [Stigmatella aurantiaca DW4/3-1]
          Length = 228

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 93/211 (44%), Gaps = 22/211 (10%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           L DLG G+G   L +A RL   ++   E  P +   A + + L    +  ++++L++ D+
Sbjct: 32  LIDLGTGSGIIPLVLAKRLGLREVTGLELQPRLYSLAERNVYL---NRCEQQVTLVQGDL 88

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNE----RIGTMTPDKI-KEEAHVMLEDSFEKWIR 129
             V  +R  A      + HV+ NPP+      R   M    I + E    L D      R
Sbjct: 89  RQV--SRLFAA---GSFCHVLCNPPYRACATGRSSVMMERAIARHEVACSLPD----VAR 139

Query: 130 TACAIMRSSGQLSLI---ARPQSLIQIVNACARRIGSLEITPLHPREGECASRILVTGRK 186
            A  ++   G LSL+   AR   L+ ++     R+    +  +HPR    A  +L+   K
Sbjct: 140 AARHLLTPRGGLSLVYPAARFAELVAVLRE--HRLEPKTVRMVHPRAERPAKLVLLHAVK 197

Query: 187 GMRGQLRFRYPIVLHKPNGQPYSRFVTDLIN 217
           G R  LR   P+VLH  +   ++  V+ ++ 
Sbjct: 198 GGRADLRVLPPLVLHAEDEHAFTDEVSAMVG 228


>gi|169344693|ref|ZP_02865656.1| conserved hypothetical protein [Clostridium perfringens C str.
           JGS1495]
 gi|169297160|gb|EDS79274.1| conserved hypothetical protein [Clostridium perfringens C str.
           JGS1495]
          Length = 256

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 54/228 (23%), Positives = 100/228 (43%), Gaps = 22/228 (9%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+  N      + DL  G G     +  + +  + +  E     A  A +       
Sbjct: 43  VLLANFANVNRKHSVLDLCTGTGIIPFIIYGKKNPKEAVGIEIQEEFAEMANR------- 95

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNF--YDHVIMNPPFN-ERIGTMTP-DKIKEEA 116
              S +I+ IE  V+ V  +     L  +   +D V +NPP+     G + P DK+    
Sbjct: 96  ---SAKINNIEDKVSFVCGDLKDKELSKSMPKFDVVTVNPPYKLNNAGIVNPEDKLAIAR 152

Query: 117 HVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE---ITPLHPRE 173
           H ++  + E  I  +   ++ +G+L ++ RP+ L  I   C  R   +E   +  +HP  
Sbjct: 153 HEIM-CNLEDVIAASRRFLKDNGRLYMVHRPERLADIF--CLMRKYKIEPKRVRMVHPNT 209

Query: 174 GECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRS 221
            + A+ +LV G++     L++  P+ ++K  G  YS  + D I G+ S
Sbjct: 210 KKAANIVLVEGQRDGGAFLKWEAPLYVYKDEGG-YSEEI-DKIYGRES 255


>gi|332800046|ref|YP_004461545.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Tepidanaerobacter sp. Re1]
 gi|332697781|gb|AEE92238.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Tepidanaerobacter sp. Re1]
          Length = 285

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 56/108 (51%), Gaps = 11/108 (10%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           +ADL  G+GA  +AVA   +  ++  ++ S +    A   + L     +  R+SL++ D+
Sbjct: 116 IADLCCGSGAISVAVAVNNNRVRVYASDISDVACEVASTNIKLHG---VQDRVSLMQGDL 172

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPF--NERIGTMTPDKIKEEAHVML 120
            +  E +N+ G     +D V+ NPP+   E + T+ PD +K E  + L
Sbjct: 173 WMPFEEKNIRG-----FDVVVSNPPYIPKEELSTL-PDDVKNEPQIAL 214


>gi|315925469|ref|ZP_07921680.1| SAM-dependent methyltransferase [Pseudoramibacter alactolyticus
           ATCC 23263]
 gi|315621370|gb|EFV01340.1| SAM-dependent methyltransferase [Pseudoramibacter alactolyticus
           ATCC 23263]
          Length = 261

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 56/205 (27%), Positives = 87/205 (42%), Gaps = 15/205 (7%)

Query: 12  SFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIE 71
           S  + DLG G G   L +  R     I   E  P++A  A +++A+     ++  I +  
Sbjct: 50  SSKVVDLGTGTGILPLLLHGRTGVRHIDALELQPVVADMAARSVAI---NHLTDVIHIHC 106

Query: 72  VDVTLVGENRNLAGLKNNFYDHVIMNPPF-NERIGTMTPDKIKEEAHVMLEDSFEKWIRT 130
            D+   G          + YD VI NPPF     G + PD     A   +  + E   R 
Sbjct: 107 GDLRQPG-----TAFHASAYDAVISNPPFLPVGHGGVNPDDALAIARHEITCTLEDIARF 161

Query: 131 ACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPL---HPREGECASRILVTGRKG 187
           A  +++  G+L L+ R   L  I  A   R   LE+  L   HPR  + A+ +L    K 
Sbjct: 162 ARTMLKDRGKLFLVHRADRLTDI--AVTLRAHGLELKRLRAVHPRPDKPANLVLCEAMKK 219

Query: 188 MRGQLRFRYPIVLHKPNGQPYSRFV 212
            R  L    P+ +++ +G+ YS  V
Sbjct: 220 GRPGLTIAPPLTIYREDGR-YSDTV 243


>gi|169351613|ref|ZP_02868551.1| hypothetical protein CLOSPI_02393 [Clostridium spiroforme DSM 1552]
 gi|169291835|gb|EDS73968.1| hypothetical protein CLOSPI_02393 [Clostridium spiroforme DSM 1552]
          Length = 249

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/210 (22%), Positives = 96/210 (45%), Gaps = 17/210 (8%)

Query: 1   MILASLVNATGSFH-LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPA 59
           ++LA+    T     + D G    A  L ++ R ++  I+  E        A+K + L +
Sbjct: 36  VLLANFCTITKDVKKIVDFGTNNAAIPLILSRRTNKP-IIGVEIQKEAVELAKKNITLNS 94

Query: 60  NAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFN--ERIGTMTPDKIKEEAH 117
              +  +I ++  D+     +    GL       V+ NPPF   +    +  ++    A 
Sbjct: 95  ---LDNQIKIVHSDIKEFVNDSIKVGL-------VVCNPPFFKVDEDSNLNDNEFLTIAR 144

Query: 118 VMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGEC 176
             ++ + E+ I++A  I+ + G+ +++ RPQ +I+I+N   +  I    I  ++P+  + 
Sbjct: 145 HEIKINLEEIIKSAAKILDNRGKFAMVHRPQRMIEILNLMQKYDIEPKRIKFVYPKYNKE 204

Query: 177 ASRILVTG-RKGMRGQLRFRYPIVLHKPNG 205
           +  +LV G  KG +G L+   P+  H  +G
Sbjct: 205 SHILLVEGIYKGKKG-LKIEPPLYAHNNDG 233


>gi|312142729|ref|YP_003994175.1| methyltransferase small [Halanaerobium sp. 'sapolanicus']
 gi|311903380|gb|ADQ13821.1| methyltransferase small [Halanaerobium sp. 'sapolanicus']
          Length = 241

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/220 (21%), Positives = 98/220 (44%), Gaps = 26/220 (11%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+ V      ++ DLG G+G   L +A +    ++   E    +A  A++ + L   
Sbjct: 28  VLLANFVKLRRGDNVIDLGTGSGVIPLLLAYKNQGVKVSGVEIQKPLADLAQRNVEL--- 84

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNF----YDHVIMNPPF-NERIGTMTPDKI--- 112
            Q+  +I +I         N++L  LK       +D V+ NPP+     G +  +K    
Sbjct: 85  NQMDDKIKII---------NQDLCPLKQEMEAGSFDVVVSNPPYLPVDAGKIKANKYLAA 135

Query: 113 -KEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLH 170
            + E H  LED     I  A  +++  G   L+ R + L +++   A+    + ++  + 
Sbjct: 136 ARHEIHAELED----VIAAAAHLLKFGGLFYLVYRVERLTEVIELLAKYNCQAKKLRFVQ 191

Query: 171 PREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSR 210
            R+ + A   L+  + G +  LR    +++++P+   Y+ 
Sbjct: 192 ARQDKEADIFLLQAKLGAKPGLRVEPVLIIYQPDSSQYTE 231


>gi|310821830|ref|YP_003954188.1| hypothetical protein STAUR_4581 [Stigmatella aurantiaca DW4/3-1]
 gi|309394902|gb|ADO72361.1| conserved uncharacterized protein [Stigmatella aurantiaca DW4/3-1]
          Length = 250

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 93/211 (44%), Gaps = 22/211 (10%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           L DLG G+G   L +A RL   ++   E  P +   A + + L    +  ++++L++ D+
Sbjct: 54  LIDLGTGSGIIPLVLAKRLGLREVTGLELQPRLYSLAERNVYL---NRCEQQVTLVQGDL 110

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNE----RIGTMTPDKI-KEEAHVMLEDSFEKWIR 129
             V  +R  A      + HV+ NPP+      R   M    I + E    L D      R
Sbjct: 111 RQV--SRLFAA---GSFCHVLCNPPYRACATGRSSVMMERAIARHEVACSLPD----VAR 161

Query: 130 TACAIMRSSGQLSLI---ARPQSLIQIVNACARRIGSLEITPLHPREGECASRILVTGRK 186
            A  ++   G LSL+   AR   L+ ++     R+    +  +HPR    A  +L+   K
Sbjct: 162 AARHLLTPRGGLSLVYPAARFAELVAVLRE--HRLEPKTVRMVHPRAERPAKLVLLHAVK 219

Query: 187 GMRGQLRFRYPIVLHKPNGQPYSRFVTDLIN 217
           G R  LR   P+VLH  +   ++  V+ ++ 
Sbjct: 220 GGRADLRVLPPLVLHAEDEHAFTDEVSAMVG 250


>gi|228472752|ref|ZP_04057510.1| methyltransferase small [Capnocytophaga gingivalis ATCC 33624]
 gi|228275803|gb|EEK14569.1| methyltransferase small [Capnocytophaga gingivalis ATCC 33624]
          Length = 237

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 53/113 (46%), Gaps = 10/113 (8%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++L +   A    ++ D+G G G   L +A R   + I   E  PL A   R  ++L   
Sbjct: 26  VLLGAWTPAINPNYILDIGTGTGVLSLMMAQRFPLSHIHAVELHPLSAKECRLNVSL--- 82

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIK 113
           +   + + + E+D+      R+ A      YD +I NPPF     T++PD+++
Sbjct: 83  SPWHQAVEVFEMDI------RDFASTSATAYDLIISNPPFFSE-NTLSPDRVR 128


>gi|42519373|ref|NP_965303.1| hypothetical protein LJ1501 [Lactobacillus johnsonii NCC 533]
 gi|41583661|gb|AAS09269.1| hypothetical protein LJ_1501 [Lactobacillus johnsonii NCC 533]
          Length = 340

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 92/201 (45%), Gaps = 17/201 (8%)

Query: 11  GSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLI 70
            ++ + DL +G GAA + + S  + A     E    +A  AR+++ L    ++  RI   
Sbjct: 46  DNYKVVDLCSGNGAASIYL-SYFNRAHYDAVEIQKEIADQARRSIKL---NKLENRI--- 98

Query: 71  EVDVTLVGENRNLAGLKNNFYDHVIMNPPFNE--RIGTMTPDKIKEEAHVMLEDSFEKWI 128
             +V  +        L  + YD V++NPP+ +  +   + PD+ K  A   L  + E+ I
Sbjct: 99  --EVHCLNALDAPKKLGKDKYDVVVVNPPYFKVPKGHIVNPDEKKALARHELAINLEQII 156

Query: 129 RTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHP----REGECASRILVTG 184
           + +  +++  G++ ++ RP+ L +I++ C      L +  + P    RE +    ++   
Sbjct: 157 KVSSDLLKMKGKMFMVHRPERLGEIMHYCLE--NQLSVKWVQPFVSKREADANLVVVEAI 214

Query: 185 RKGMRGQLRFRYPIVLHKPNG 205
           R      L  R  IV+H  +G
Sbjct: 215 RNTASDGLVLRDAIVVHNQDG 235


>gi|220903309|ref|YP_002478621.1| hypothetical protein Ddes_0023 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
 gi|219867608|gb|ACL47943.1| conserved hypothetical protein [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
          Length = 335

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/137 (30%), Positives = 62/137 (45%), Gaps = 16/137 (11%)

Query: 81  RNLAGLKNNFYDHVIM-NPPFNERIGTMTPDKIKEEA------HVMLEDSFEKWIRTACA 133
           R LAG +     H++M NPP++   G  +P  ++E A          E+  + + R A  
Sbjct: 178 RRLAGNQ-----HIVMANPPYDTG-GRPSPRAMRERALRGNGNTAGGENVLDTFCRAAAM 231

Query: 134 IMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTGRKGMRGQL 192
           ++R  G    I   ++L Q+  A  A R G   I P+H R G  A RILV  RK      
Sbjct: 232 LLRHQGYFFCIHDARALPQLCAAMQAARFGIRRILPVHARAGGPALRILVESRKNAAHDT 291

Query: 193 RFRYPIVLH--KPNGQP 207
               P+ LH   P+ +P
Sbjct: 292 VLEAPLCLHGDSPDAKP 308


>gi|329667108|gb|AEB93056.1| hypothetical protein LJP_0728 [Lactobacillus johnsonii DPC 6026]
          Length = 340

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 92/201 (45%), Gaps = 17/201 (8%)

Query: 11  GSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLI 70
            ++ + DL +G GAA + + S  + A     E    +A  AR+++ L    ++  RI   
Sbjct: 46  DNYKVVDLCSGNGAASIYM-SYFNRAHYDAVEIQKEIADQARRSIKL---NKLENRI--- 98

Query: 71  EVDVTLVGENRNLAGLKNNFYDHVIMNPPFNE--RIGTMTPDKIKEEAHVMLEDSFEKWI 128
             +V  +        L  + YD V++NPP+ +  +   + PD+ K  A   L  + E+ I
Sbjct: 99  --EVHCLNALDAPKKLGKDKYDVVVVNPPYFKVPKGHIVNPDEKKALARHELAINLEQII 156

Query: 129 RTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHP----REGECASRILVTG 184
           + +  +++  G++ ++ RP+ L +I++ C      L +  + P    RE +    ++   
Sbjct: 157 KVSSDMLKMKGKMFMVHRPERLGEIMHYCLE--NQLSVKWVQPFVSKREADANLVVVEAI 214

Query: 185 RKGMRGQLRFRYPIVLHKPNG 205
           R      L  R  IV+H  +G
Sbjct: 215 RNTASDGLVLRDAIVVHNQDG 235


>gi|56961837|ref|YP_173559.1| hypothetical protein ABC0055 [Bacillus clausii KSM-K16]
 gi|56908071|dbj|BAD62598.1| conserved hypothetical protein [Bacillus clausii KSM-K16]
          Length = 243

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 90/194 (46%), Gaps = 18/194 (9%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DL +G G  GL +++R  +A I L E    +   A +T+ +    Q+ K+++ +  DV  
Sbjct: 49  DLCSGNGIVGLVLSART-KALIDLVEVQARLHDMAERTIRV---NQLEKQVTSLCFDVKD 104

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEE-----AHVMLEDSFEKWIRTA 131
              N     L ++ YD V  NPP+ +  G     ++KE+     A   L  +    ++  
Sbjct: 105 TKNN-----LAHSSYDTVTCNPPYFQLGGN---KQVKEQRALSVARHELACTLADVVQAG 156

Query: 132 CAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRKGMRG 190
              ++  G+L+L+ RP+ L  ++    +  I    +   HPR    A+ +L+ G KG + 
Sbjct: 157 SYALKYGGKLALVHRPERLADMMEEMRKCNIEPKRLRFCHPRGEANANIVLLEGTKGGKP 216

Query: 191 QLRFRYPIVLHKPN 204
            L    P++++  +
Sbjct: 217 GLVCEPPLIVYNED 230


>gi|153815173|ref|ZP_01967841.1| hypothetical protein RUMTOR_01405 [Ruminococcus torques ATCC 27756]
 gi|317502368|ref|ZP_07960534.1| SAM-dependent methyltransferase [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|331089969|ref|ZP_08338860.1| hypothetical protein HMPREF1025_02443 [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|145847432|gb|EDK24350.1| hypothetical protein RUMTOR_01405 [Ruminococcus torques ATCC 27756]
 gi|316896241|gb|EFV18346.1| SAM-dependent methyltransferase [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|330403107|gb|EGG82670.1| hypothetical protein HMPREF1025_02443 [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 237

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/204 (20%), Positives = 85/204 (41%), Gaps = 10/204 (4%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           + L+  V         DLG G G   + ++ +         E  P MA  AR+++     
Sbjct: 42  VFLSDFVKIKAGERALDLGTGNGIIPILLSEKTQGRHFTGLEIQPEMAEMARRSVDYNG- 100

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFN-ERIGTMTPDKIKEEAHVM 119
             +  ++ ++  D+    E       K  F+D +  NPP+     G   P   K  A   
Sbjct: 101 --LEDKVDIVTGDIKEAAEI-----FKPAFFDVITTNPPYMIADHGLRNPADAKAIARHE 153

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQI-VNACARRIGSLEITPLHPREGECAS 178
           +  S +  +R +  +++  G+  +I RP  L +I +     +I    I  ++P   +  +
Sbjct: 154 VLCSLDDILRESMRLLQDKGRFYMIHRPFRLTEIMIKMNYYKIEPKRIQFIYPYLDKEPT 213

Query: 179 RILVTGRKGMRGQLRFRYPIVLHK 202
            +++ G +G + ++    P+V++K
Sbjct: 214 MVMIEGVRGAKPRITVEPPLVIYK 237


>gi|239825614|ref|YP_002948238.1| methyltransferase small [Geobacillus sp. WCH70]
 gi|239805907|gb|ACS22972.1| methyltransferase small [Geobacillus sp. WCH70]
          Length = 249

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/211 (21%), Positives = 98/211 (46%), Gaps = 19/211 (9%)

Query: 14  HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVD 73
            + DL  G G   L ++ R  + +I+  E    +   A++++       + K+I +I  D
Sbjct: 48  QIVDLCTGNGVIPLLLSMRT-KGKIIGIEIQERLCDMAKRSVQYNG---LEKQIEIIHGD 103

Query: 74  VTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLED-----SFEKWI 128
           +    +      L  + YD V  NPP+     T++ +++ +  H+ +       + E  I
Sbjct: 104 IKDAPKQ-----LGYSKYDVVTCNPPY---FPTISKEEMNKNIHLAIARHEIYCTLEDVI 155

Query: 129 RTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRKG 187
           R +  +++  G+ + + RP  L+ I+    + R+    +  ++P+ G+ A+ IL+ G K 
Sbjct: 156 RVSSQLLKQGGKAAFVHRPGRLLDIITLMRKYRLEPKRLRFVYPKIGKEANTILIEGIKD 215

Query: 188 MRGQLRFRYPIVLHKPNGQPYSRFVTDLING 218
               L+   P++++  N + Y+  V  L+ G
Sbjct: 216 GNPDLKVLPPLIVYHDNNE-YTDEVKQLLYG 245


>gi|95930758|ref|ZP_01313491.1| methyltransferase small [Desulfuromonas acetoxidans DSM 684]
 gi|95133238|gb|EAT14904.1| methyltransferase small [Desulfuromonas acetoxidans DSM 684]
          Length = 272

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/192 (23%), Positives = 85/192 (44%), Gaps = 15/192 (7%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DLG G+    L +A       ++  E        ARK++ L     +  RI + + DV
Sbjct: 62  VVDLGCGSAVMALILARAFPSLSVVALELQAAQVARARKSVVLNG---LEGRIDVQQTDV 118

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDS--FEKWIRTAC 132
                 R +    +  +D V+ NPPF   +G     +  E A    E S   + ++R A 
Sbjct: 119 ------REVPSAWHGDFDLVVCNPPFRP-LGQGRCSQGDERAVSRHEVSGGLDAFVRGAA 171

Query: 133 AIMRSSGQLSLI--ARPQSLIQIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRG 190
            +++  G+LS++  A   + + +  +C   +    +  +H R+G  A  +LV GRKG + 
Sbjct: 172 VLLKHGGRLSMVHLAERSAELMVALSC-HGLAVKRLRYVHSRQGSPARLVLVEGRKGGQP 230

Query: 191 QLRFRYPIVLHK 202
            +    P+ L++
Sbjct: 231 GVTIEAPLYLYR 242


>gi|294101614|ref|YP_003553472.1| methyltransferase small [Aminobacterium colombiense DSM 12261]
 gi|293616594|gb|ADE56748.1| methyltransferase small [Aminobacterium colombiense DSM 12261]
          Length = 246

 Score = 46.6 bits (109), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 54/214 (25%), Positives = 96/214 (44%), Gaps = 23/214 (10%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEA-QILLAERSPLMAHYARKTLALPA 59
           ++LAS V A G   + +LG   G   L +A RL EA +I   +    + + A++      
Sbjct: 32  ILLASFVKARGKDRILELGCATGVISLLLALRLPEATKIEGIDIQEDLVNLAKR------ 85

Query: 60  NAQ---ISKRISLIEVDVTLVGENRNLAG-LKNNFYDHVIMNPPFNERIGTMTPDKIKE- 114
           NAQ   +  R+S    D+      RN+     +  +D V+ NPP++E   +   D   + 
Sbjct: 86  NAQENGLDARVSFFLSDL------RNIKDRYASQSFDVVVTNPPYDEPHRSRWTDSFSDA 139

Query: 115 EAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE---ITPLHP 171
            A   L  S +  ++ A  ++++ G L +I R Q   ++V A      +LE   +  +HP
Sbjct: 140 TARQGLYCSLKDVVKAAHFVLKNKGHLFMIFRAQRGAELVAALVNE--NLEPKRLQMVHP 197

Query: 172 REGECASRILVTGRKGMRGQLRFRYPIVLHKPNG 205
             G+ A+ ILV   +     +    P+ ++   G
Sbjct: 198 YPGKKATVILVEAVRSAGKGVVIESPLYIYDGEG 231


>gi|322387426|ref|ZP_08061036.1| methyltransferase [Streptococcus infantis ATCC 700779]
 gi|321141955|gb|EFX37450.1| methyltransferase [Streptococcus infantis ATCC 700779]
          Length = 249

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/200 (22%), Positives = 101/200 (50%), Gaps = 23/200 (11%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + D  AG GA GL  +SR  +A+IL  E    +A  A +++ L     +  ++ +I  D+
Sbjct: 51  IVDFCAGNGAVGLFASSRT-KAKILSVEIQERLADMAERSVRLNG---LGGQMQVICDDL 106

Query: 75  TLVGENRNL-AGLKNNFYDHVIMNPPFNERIGTMTPD-KIKEEAHVML-----EDSFEKW 127
                 +N+ + ++ +  D ++ NPP+ +    + P+  + E  H +L       + ++ 
Sbjct: 107 ------KNMPSHIQGSKVDLILCNPPYFK----VDPNSNLNESEHYLLARHEITTNLKEI 156

Query: 128 IRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTG-R 185
            R+A +I++S+G+L+++ RP  L+ I+    +  +    +  ++P+  + A+ +L+   +
Sbjct: 157 CRSAQSILKSNGRLAMVHRPDRLLDILATLQQHNLAPKRLQFVYPKREKEANMLLIEAIK 216

Query: 186 KGMRGQLRFRYPIVLHKPNG 205
            G     +   P+++H  +G
Sbjct: 217 DGSTSGFKVLPPLIVHNSDG 236


>gi|315498624|ref|YP_004087428.1| methyltransferase small [Asticcacaulis excentricus CB 48]
 gi|315416636|gb|ADU13277.1| methyltransferase small [Asticcacaulis excentricus CB 48]
          Length = 244

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 49/97 (50%), Gaps = 3/97 (3%)

Query: 91  YDHVIMNPPFNERIGTM-TPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQS 149
           +D V+ NPP+ +   T+  P ++K  A +  +D  + W+  A A +   G++  I R   
Sbjct: 112 FDLVLSNPPYFDDPETLRAPHELKRPAWIA-DDGLQAWLDFAQAAVVDGGEIMFIHRADR 170

Query: 150 LIQIVNACARRIGSLEITPLHPREGECASRILVTGRK 186
           L  I++   +  GS  I P+    GE A R+LV  ++
Sbjct: 171 LGDILSGLPK-CGSFVIRPIQAFAGEAAKRVLVRAKR 206


>gi|145634581|ref|ZP_01790290.1| phosphatidylserine synthase [Haemophilus influenzae PittAA]
 gi|148825297|ref|YP_001290050.1| phosphatidylserine synthase [Haemophilus influenzae PittEE]
 gi|229844417|ref|ZP_04464557.1| phosphatidylserine synthase [Haemophilus influenzae 6P18H1]
 gi|262828354|sp|A5UA66|TRMN6_HAEIE RecName: Full=tRNA (adenine-N(6)-)-methyltransferase; AltName:
           Full=tRNA m6A37 methyltransferase
 gi|145268126|gb|EDK08121.1| phosphatidylserine synthase [Haemophilus influenzae PittAA]
 gi|148715457|gb|ABQ97667.1| phosphatidylserine synthase [Haemophilus influenzae PittEE]
 gi|229812666|gb|EEP48355.1| phosphatidylserine synthase [Haemophilus influenzae 6P18H1]
          Length = 232

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 45/213 (21%), Positives = 98/213 (46%), Gaps = 16/213 (7%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHE-AQILLAERSPLMAHYARKTLALPA 59
           ++L +  +     ++ D+G+G G   L +A R  E  QI   E  P+ A  A++ +    
Sbjct: 25  ILLGAWADVKHCKNILDMGSGTGLLALMLAQRTEENCQIQAVELDPIAAKQAQENI---N 81

Query: 60  NAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVM 119
           N+    RI LI+ D+      ++        +D ++ NPP+ E+ G    ++ +E A   
Sbjct: 82  NSVWKNRIQLIQTDI------QHFLQTTAQTFDLIVANPPYFEQ-GIACKNEERELARYT 134

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASR 179
            + S   W+  A   +  +G++S +    +   ++ + A  +  ++ T +  + G+   R
Sbjct: 135 -KQSHLNWLEWAATRLSENGRISFVLPYDAGKTLIKSTA--LFCIKQTNVITKIGKTPQR 191

Query: 180 ILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFV 212
           +L+T  K  + Q+  +  +V++  + Q    F+
Sbjct: 192 MLLTFAK--QPQVLMQDQLVIYDADNQYTEAFI 222


>gi|197301950|ref|ZP_03167014.1| hypothetical protein RUMLAC_00672 [Ruminococcus lactaris ATCC
           29176]
 gi|197299018|gb|EDY33554.1| hypothetical protein RUMLAC_00672 [Ruminococcus lactaris ATCC
           29176]
          Length = 253

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 75/149 (50%), Gaps = 4/149 (2%)

Query: 61  AQISKRISLIEVDVTLV-GENRNLAGL-KNNFYDHVIMNPPFN-ERIGTMTPDKIKEEAH 117
           AQ S R + +E  V +V G+ +  A + K  F+D +  NPP+     G   PD  K  A 
Sbjct: 92  AQRSVRYNHLEDRVEIVTGDIKEAATIFKPAFFDVITTNPPYMLAEHGLRNPDDRKAIAR 151

Query: 118 VMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGEC 176
             +  + +  +R +  +++  G+  +I RP  L +I+   ++ +I    I  +HP   + 
Sbjct: 152 HEVLCTLDDILRESMRLLQDKGRFYMIHRPFRLTEILTKMSQYKIEPKRIQFVHPYLDKE 211

Query: 177 ASRILVTGRKGMRGQLRFRYPIVLHKPNG 205
            + +LV G +G + +++   P++++  +G
Sbjct: 212 PTMVLVEGMRGAKPRVKIEPPLIMYSRDG 240


>gi|312871364|ref|ZP_07731460.1| GIY-YIG catalytic domain protein [Lactobacillus iners LEAF 3008A-a]
 gi|312872477|ref|ZP_07732546.1| GIY-YIG catalytic domain protein [Lactobacillus iners LEAF
           2062A-h1]
 gi|311092059|gb|EFQ50434.1| GIY-YIG catalytic domain protein [Lactobacillus iners LEAF
           2062A-h1]
 gi|311093116|gb|EFQ51464.1| GIY-YIG catalytic domain protein [Lactobacillus iners LEAF 3008A-a]
          Length = 342

 Score = 46.2 bits (108), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 91/195 (46%), Gaps = 13/195 (6%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL  G GAA L + S  + A     E  P +A  A ++++L      +K  + IEV  
Sbjct: 50  VVDLCCGNGAATLYM-SYFNLAHYDAVEIQPEIASQAERSVSL------NKLENRIEVHC 102

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIG--TMTPDKIKEEAHVMLEDSFEKWIRTAC 132
               +  N+ G K+ F D V +NPP+ +      + P++ K  A   +  + E+ I  A 
Sbjct: 103 MNALDTPNVLG-KDKF-DVVTVNPPYFKVSDGHRINPNQQKAIARHEILINLEQVIIVAS 160

Query: 133 AIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTG-RKGMRG 190
            +++  G+L ++ RP+ L +I++ C +  +G   I P  P++    + ++V         
Sbjct: 161 QLLKMKGKLFIVHRPERLAEIIHYCLSNHMGVKNIQPFAPQKDHKTNLVVVEAVNNAPTD 220

Query: 191 QLRFRYPIVLHKPNG 205
            L    PI++H  + 
Sbjct: 221 GLVLNNPIIVHNSDS 235


>gi|228476236|ref|ZP_04060939.1| methyltransferase [Staphylococcus hominis SK119]
 gi|228269721|gb|EEK11220.1| methyltransferase [Staphylococcus hominis SK119]
          Length = 241

 Score = 46.2 bits (108), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 50/223 (22%), Positives = 100/223 (44%), Gaps = 18/223 (8%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA       +  + DL AG G   L +A++ H+ +I   E    +A  A+++      
Sbjct: 32  LLLAHFTKVRKNDSILDLCAGNGVIALLLAAKSHQ-KIESIEIQEQLADMAQRSFKYN-- 88

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
            Q+ +R+S+  +D+  V +       K + +  +  NPP+ ++       K   EAH + 
Sbjct: 89  -QLEERLSMHNMDLKDVYQT-----FKPSQFTLITCNPPYFKQNQLHQHQK---EAHKIA 139

Query: 121 ED----SFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGE 175
                 S E  +  A  +++  G+L ++ R + L+ ++    +  I    I  ++ + G+
Sbjct: 140 RHEIMCSLEDCMFAARHLLKQGGRLVMVHRAERLMDVLTEMRQANIEPKRIVFIYSKHGK 199

Query: 176 CASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLING 218
            A  I+V GRK     L    P  ++  NG+ YS  + ++  G
Sbjct: 200 SAVTIVVEGRKNGNQGLEIAPPFYIYNENGE-YSEQMKEVYYG 241


>gi|227890238|ref|ZP_04008043.1| O-methyltransferase [Lactobacillus johnsonii ATCC 33200]
 gi|227849240|gb|EEJ59326.1| O-methyltransferase [Lactobacillus johnsonii ATCC 33200]
          Length = 340

 Score = 46.2 bits (108), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 47/199 (23%), Positives = 94/199 (47%), Gaps = 13/199 (6%)

Query: 11  GSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLI 70
            ++ + DL +G GAA + + S  + A     E    +A  AR+++ L    ++  RI   
Sbjct: 46  DNYKVVDLCSGNGAASIYM-SYFNRAHYDAVEIQKEIADQARRSIKL---NKLENRI--- 98

Query: 71  EVDVTLVGENRNLAGLKNNFYDHVIMNPPFNE--RIGTMTPDKIKEEAHVMLEDSFEKWI 128
             +V  +        L  + YD V++NPP+ +  +   + PD+ K  A   L  + E+ I
Sbjct: 99  --EVHCLNALDAPKKLGKDKYDVVVVNPPYFKVPKGHIVNPDEKKALARHELAINLEQII 156

Query: 129 RTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE-ITPLHPREGECASRILVTG-RK 186
           + +  +++  G++ ++ RP+ L +I++ C     S++ + P   +    A+ ++V   R 
Sbjct: 157 KVSSDMLKMKGKMFMVHRPERLGEIMHYCLENQLSVKWVQPFVSKRVADANLVVVEAIRN 216

Query: 187 GMRGQLRFRYPIVLHKPNG 205
                L  R  IV+H  +G
Sbjct: 217 TASDGLVLRDAIVVHNQDG 235


>gi|322381211|ref|ZP_08055214.1| methyltransferase-like protein [Paenibacillus larvae subsp. larvae
           B-3650]
 gi|321154787|gb|EFX47058.1| methyltransferase-like protein [Paenibacillus larvae subsp. larvae
           B-3650]
          Length = 259

 Score = 46.2 bits (108), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 52/226 (23%), Positives = 103/226 (45%), Gaps = 18/226 (7%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA          + DL  G G   L +++R  +A I   E    +A  A + + L   
Sbjct: 44  VLLARFCTVPNKGKIMDLCTGNGVIPLLLSTRT-KAHIWGIEIQQKLADMAMRNVDL--- 99

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEE----A 116
             + +++ +I  D+  + +      L    +D V +NPP+   +   T +K K E    A
Sbjct: 100 NMLQEQLHMIHGDLRHIYQV-----LGTGQFDLVTVNPPY---LPVPTGEKNKNEHVAAA 151

Query: 117 HVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGE 175
              +  + E  I  A  ++R+ G+++++ R   L+ I     + RI    I  +HPR GE
Sbjct: 152 RHEIFCTLEDVIVVASKLLRTGGKMAMVHRSSRLVDICFLMRQYRIEPKRIRFIHPRIGE 211

Query: 176 CASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRS 221
            A  +L+ G K  + ++R + P++++    + Y   +  +  G+R+
Sbjct: 212 EAMMVLIEGVKDGKPEIRTQPPLIVYNEQNE-YCDELMAVYYGERT 256


>gi|326789154|ref|YP_004306975.1| methyltransferase small [Clostridium lentocellum DSM 5427]
 gi|326539918|gb|ADZ81777.1| methyltransferase small [Clostridium lentocellum DSM 5427]
          Length = 253

 Score = 46.2 bits (108), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 51/218 (23%), Positives = 92/218 (42%), Gaps = 45/218 (20%)

Query: 17  DLGAGAGAAGL---AVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVD 73
           D+G G G   +   A+  + H   I + E    MA               S+ + L E+D
Sbjct: 54  DIGTGTGIIPIVMHAIYGKGHFTGIDIQEEMIEMA---------------SRSVKLNEID 98

Query: 74  VTLVGENRNLAGLKNNF----YDHVIMNPPF---NERIGTMTPDKI--KEEAHVMLEDSF 124
             +  +  ++   K +F    +D +  NPP+   +  +    P K   + E    LED  
Sbjct: 99  TDVTMKVMDIKDYKEHFSTGYFDIITCNPPYMKGHAGLKNEHPSKTIARHEVACTLED-- 156

Query: 125 EKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITP-----LHPREGECASR 179
              I     +++  G++ +I RP  L+ I  A  R+     I P     ++P++G+  + 
Sbjct: 157 --IISATSYMLKYGGKMCMIHRPHRLVDIF-ATMRQ---YNIEPKVMRMIYPKQGKEPTM 210

Query: 180 ILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLIN 217
           +LV G K  + +LR + P+ ++  +G       TD IN
Sbjct: 211 VLVEGVKNGKPELRVQSPLTVYNEDGT-----YTDEIN 243


>gi|149003242|ref|ZP_01828138.1| hypothetical protein CGSSp14BS69_02514 [Streptococcus pneumoniae
           SP14-BS69]
 gi|147758702|gb|EDK65699.1| hypothetical protein CGSSp14BS69_02514 [Streptococcus pneumoniae
           SP14-BS69]
          Length = 161

 Score = 46.2 bits (108), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 76/150 (50%), Gaps = 21/150 (14%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           D  AG GA GL  ++R  +AQIL  E    +A  A +++          R++ +E  + +
Sbjct: 2   DFCAGNGAVGLFASTRT-QAQILSVEIQERLADMAERSV----------RLNGLEEQMQV 50

Query: 77  VGEN-RNL-AGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML-----EDSFEKWIR 129
           + ++ +N+ A ++ +  D ++ NPP+           + E  H +L       + E+   
Sbjct: 51  ICDDLKNMPAHIQGSKVDMILCNPPY---FKVDPYSNLNESEHYLLARHEITTNLEEICH 107

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNACAR 159
           +A +I++S+G+L+++ RP  L+ I++   R
Sbjct: 108 SAQSILKSNGRLAMVHRPDRLLDILDTLKR 137


>gi|167462406|ref|ZP_02327495.1| methyltransferase [Paenibacillus larvae subsp. larvae BRL-230010]
          Length = 251

 Score = 46.2 bits (108), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 52/226 (23%), Positives = 103/226 (45%), Gaps = 18/226 (7%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA          + DL  G G   L +++R  +A I   E    +A  A + + L   
Sbjct: 36  VLLARFCTVPNKGKIMDLCTGNGVIPLLLSTRT-KAHIWGIEIQQKLADMAMRNVDL--- 91

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEE----A 116
             + +++ +I  D+  + +      L    +D V +NPP+   +   T +K K E    A
Sbjct: 92  NMLQEQLHMIHGDLRHIYQV-----LGTGQFDLVTVNPPY---LPVPTGEKNKNEHVAAA 143

Query: 117 HVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGE 175
              +  + E  I  A  ++R+ G+++++ R   L+ I     + RI    I  +HPR GE
Sbjct: 144 RHEIFCTLEDVIVVASKLLRTGGKMAMVHRSSRLVDICFLMRQYRIEPKRIRFIHPRIGE 203

Query: 176 CASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRS 221
            A  +L+ G K  + ++R + P++++    + Y   +  +  G+R+
Sbjct: 204 EAMMVLIEGVKDGKPEIRTQPPLIVYNEQNE-YCDELMAVYYGERT 248


>gi|268319250|ref|YP_003292906.1| hypothetical protein FI9785_765 [Lactobacillus johnsonii FI9785]
 gi|262397625|emb|CAX66639.1| hypothetical protein predicted by Glimmer/Critica [Lactobacillus
           johnsonii FI9785]
          Length = 340

 Score = 46.2 bits (108), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 47/199 (23%), Positives = 94/199 (47%), Gaps = 13/199 (6%)

Query: 11  GSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLI 70
            ++ + DL +G GAA + + S  + A     E    +A  AR+++ L    ++  RI   
Sbjct: 46  DNYKVVDLCSGNGAASIYM-SYFNRAHYDAVEIQKEIADQARRSIKL---NKLENRI--- 98

Query: 71  EVDVTLVGENRNLAGLKNNFYDHVIMNPPFNE--RIGTMTPDKIKEEAHVMLEDSFEKWI 128
             +V  +        L  + YD V++NPP+ +  +   + PD+ K  A   L  + E+ I
Sbjct: 99  --EVHCLNALDAPKKLGKDKYDVVVVNPPYFKVPKGHIVNPDEKKALARHELAINLEQII 156

Query: 129 RTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE-ITPLHPREGECASRILVTG-RK 186
           + +  +++  G++ ++ RP+ L +I++ C     S++ + P   +    A+ ++V   R 
Sbjct: 157 KVSSDMLKMKGKMFMVHRPERLGEIMHYCLENQLSVKWVQPFVSKRVADANLVVVEAIRN 216

Query: 187 GMRGQLRFRYPIVLHKPNG 205
                L  R  IV+H  +G
Sbjct: 217 TASDGLVLRDAIVVHNQDG 235


>gi|261866895|ref|YP_003254817.1| phosphatidylserine synthase [Aggregatibacter actinomycetemcomitans
           D11S-1]
 gi|261412227|gb|ACX81598.1| phosphatidylserine synthase [Aggregatibacter actinomycetemcomitans
           D11S-1]
          Length = 232

 Score = 46.2 bits (108), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 68/146 (46%), Gaps = 13/146 (8%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLH-EAQILLAERSPLMAHYARKTL-ALP 58
           ++L +  N T +  + DLG G+G   L +A R   E++I   E  P  A  A++ + A P
Sbjct: 24  ILLGAWANVTQAKQILDLGCGSGLIALMLAQRSSAESRICAVEIDPAAAQQAQENVSASP 83

Query: 59  ANAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHV 118
              +I      IE   T   ++++        +D ++ NPP+ +  G    ++ +  A  
Sbjct: 84  WKDKIQVYQQNIE---TFCAQSKHA-------FDLIVANPPYFQ-TGVDCRNEARNTARY 132

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLI 144
           +   S   W+ TA + + S G++S +
Sbjct: 133 LASQSHLHWLETAASCLASKGKISFV 158


>gi|295402000|ref|ZP_06811962.1| putative RNA methylase [Geobacillus thermoglucosidasius C56-YS93]
 gi|312109181|ref|YP_003987497.1| methyltransferase small [Geobacillus sp. Y4.1MC1]
 gi|294976002|gb|EFG51618.1| putative RNA methylase [Geobacillus thermoglucosidasius C56-YS93]
 gi|311214282|gb|ADP72886.1| methyltransferase small [Geobacillus sp. Y4.1MC1]
          Length = 249

 Score = 45.8 bits (107), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/210 (20%), Positives = 97/210 (46%), Gaps = 19/210 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL  G G   L ++ R  + +I+  E    +   A++++       + K+I +I  D+
Sbjct: 49  IVDLCTGNGVIPLLLSMRT-KGKIIGVEIQERLCDMAKRSVKYNG---LEKQIEIIHGDI 104

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLED-----SFEKWIR 129
               +      L  + YD V  NPP+     T++ +++ +  H+ +       + E  +R
Sbjct: 105 KDAPKQ-----LGYSKYDVVTCNPPY---FPTISKEEMNKNVHLAIARHEIYCTLEDVVR 156

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTGRKGM 188
            +  +++  G+ + + RP  L+ I+      R+    +  ++P+ G+ A+ IL+ G K  
Sbjct: 157 VSSQLLKQGGKAAFVHRPGRLLDIITLMREYRLEPKRLRFVYPKAGKEANTILIEGIKDG 216

Query: 189 RGQLRFRYPIVLHKPNGQPYSRFVTDLING 218
              L+   P++++  + + Y+  V  L+ G
Sbjct: 217 NPDLKILPPLIVYNDDNE-YTDEVKQLLYG 245


>gi|167747821|ref|ZP_02419948.1| hypothetical protein ANACAC_02543 [Anaerostipes caccae DSM 14662]
 gi|167653183|gb|EDR97312.1| hypothetical protein ANACAC_02543 [Anaerostipes caccae DSM 14662]
          Length = 250

 Score = 45.8 bits (107), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 50/211 (23%), Positives = 98/211 (46%), Gaps = 16/211 (7%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++L+S V    + ++ DLG G G   + + ++         E    MA  A ++ AL   
Sbjct: 35  VLLSSFVKVKKNGNVLDLGTGTGILPILMEAKTPGRHFTGLEIQSEMAGMAARSAALNG- 93

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF--NERIGTMTPDKIKEEAHV 118
             + ++I ++E D+T     +  A   ++ +D +  NPP+  N+  G   P+  K  A  
Sbjct: 94  --LEEKIEIVEGDIT-----KASAIFSHDSFDVITSNPPYMVNDH-GFRNPNDAKAIARH 145

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE---ITPLHPREGE 175
            +   F      A  +++ SG L L+ R   L +I+N C    G LE   I  ++P   +
Sbjct: 146 EILCRFRDISGAARVLLKHSGSLFLVHRSYRLSEILN-CLSNDG-LEPKRIRFVYPYREK 203

Query: 176 CASRILVTGRKGMRGQLRFRYPIVLHKPNGQ 206
            ++  L+   KG + +++   P+++++  GQ
Sbjct: 204 ESNIFLLEAVKGGKSRMKVEPPLIIYEKPGQ 234


>gi|309972420|gb|ADO95621.1| Putative methyltransferase [Haemophilus influenzae R2846]
          Length = 240

 Score = 45.8 bits (107), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 44/213 (20%), Positives = 98/213 (46%), Gaps = 16/213 (7%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHE-AQILLAERSPLMAHYARKTLALPA 59
           ++L +  +     ++ D+G+G G   L +A R  E  QI   E  P+ A  A++ +    
Sbjct: 33  ILLGAWTDVKHCKNILDMGSGTGLLALMLAQRTEENCQIQAVELDPIAAKQAQENI---N 89

Query: 60  NAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVM 119
           N+    RI LI+ D+      ++        +D ++ NPP+ E+ G    ++ +E A   
Sbjct: 90  NSVWKNRIQLIQTDI------QHFLQTTEQTFDLIVANPPYFEQ-GIACKNEERELARYT 142

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASR 179
            + S   W+  A   +  +G++S +    +   ++ + A  +  ++ T +  + G+   R
Sbjct: 143 -KQSHLNWLEWAATRLSENGRISFVLPYDAGKTLIKSTA--LFCIKQTNVITKIGKTPQR 199

Query: 180 ILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFV 212
           +L+T  K  + ++  +  +V++  + Q    F+
Sbjct: 200 MLLTFAK--QPEVLMQDQLVIYDADNQYTEAFI 230


>gi|170725256|ref|YP_001759282.1| methyltransferase small [Shewanella woodyi ATCC 51908]
 gi|262828737|sp|B1KF36|TRMN6_SHEWM RecName: Full=tRNA (adenine-N(6)-)-methyltransferase; AltName:
           Full=tRNA m6A37 methyltransferase
 gi|169810603|gb|ACA85187.1| methyltransferase small [Shewanella woodyi ATCC 51908]
          Length = 243

 Score = 45.8 bits (107), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 66/141 (46%), Gaps = 7/141 (4%)

Query: 14  HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVD 73
           +L D+GAG+G   L  A R  EAQI   E      H   K       ++   R++L+   
Sbjct: 37  NLLDIGAGSGLLSLMAAQR-SEAQITAVELDDTAFHACNKNFIA---SKWQSRLNLVYAS 92

Query: 74  VTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACA 133
           V     N++  G  N  +DH+I NPP+  + GT + ++++ +A      +F   +     
Sbjct: 93  VQEFC-NQHTDG-NNAQFDHIICNPPY-FKGGTQSSNRLRAQARHTDSLTFHALLEVITK 149

Query: 134 IMRSSGQLSLIARPQSLIQIV 154
           ++ ++G  SLI   QS+   +
Sbjct: 150 LLAATGTASLILPSQSMTPFI 170


>gi|296138964|ref|YP_003646207.1| modification methylase, HemK family [Tsukamurella paurometabola DSM
           20162]
 gi|296027098|gb|ADG77868.1| modification methylase, HemK family [Tsukamurella paurometabola DSM
           20162]
          Length = 280

 Score = 45.8 bits (107), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 45/86 (52%), Gaps = 5/86 (5%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL AG+GA GL +A+ +  A++ L ER P    Y          A ++ R+++++ DV
Sbjct: 111 IVDLCAGSGALGLYLAATVPAARVALVERDPHALGYLNDN-----AAGLAGRVTVLDRDV 165

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPF 100
           T VG +  +        D V+ NPP+
Sbjct: 166 TAVGLDAEIEAALGGTVDLVVCNPPY 191


>gi|166033096|ref|ZP_02235925.1| hypothetical protein DORFOR_02818 [Dorea formicigenerans ATCC
           27755]
 gi|166027453|gb|EDR46210.1| hypothetical protein DORFOR_02818 [Dorea formicigenerans ATCC
           27755]
          Length = 246

 Score = 45.8 bits (107), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 48/226 (21%), Positives = 102/226 (45%), Gaps = 21/226 (9%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASR---LHEAQILLAERSPLMAHYARKTLAL 57
           ++L+S           DLG G G   + + ++   LH   + + E S   A  AR+++A 
Sbjct: 35  VLLSSYAKVKRGEQALDLGTGTGILPILLEAKNPGLHYTGLEVQEES---ADMARRSVA- 90

Query: 58  PANAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAH 117
             +  +  +I ++  D+    E  ++ G  N+ Y+ ++ NPP+   IG        E  +
Sbjct: 91  --HNGLENKIDIVTGDIK---EASHIFG--NDSYEVIVSNPPY--MIGEHGLKNDNEALY 141

Query: 118 VMLED---SFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNA-CARRIGSLEITPLHPRE 173
           +   +   + +  +R +  +++  G+  ++ RP  L +I    C   I    +  +HP  
Sbjct: 142 IARHEALCTLDDLLRESAKVLKMKGRFYMVHRPFRLPEIFTKMCNYGIEPKRMRLVHPYA 201

Query: 174 GECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
            +  + +L+ G KG + +L    P++++  +G+ Y+  V  L   K
Sbjct: 202 DKEPNMVLIEGLKGGKPRLAVDPPLIVYTKDGE-YTEEVLKLYGMK 246


>gi|222054578|ref|YP_002536940.1| methyltransferase small [Geobacter sp. FRC-32]
 gi|221563867|gb|ACM19839.1| methyltransferase small [Geobacter sp. FRC-32]
          Length = 259

 Score = 45.8 bits (107), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 45/197 (22%), Positives = 87/197 (44%), Gaps = 18/197 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           +ADLG G G   L +A +   A I+  +    MA  AR  + L        R+S++  D+
Sbjct: 44  IADLGTGCGIIPLLLAKQNKSATIVGIDFQEHMAALARHNVILNG---YDDRVSILTEDI 100

Query: 75  TLVGENRNLAGLKNNF----YDHVIMNPPFNE-RIGTMTPDKIKEEAHVMLEDSFEKWIR 129
                    A LK +F    +D V+ NPP+ +   G ++P   +++A      +   ++ 
Sbjct: 101 ---------ASLKGHFPVSSFDLVVSNPPYRKPGTGRVSPKAGRDKARHETTATLADFMS 151

Query: 130 TACAIMRSSGQLSLIARPQSLIQIV-NACARRIGSLEITPLHPREGECASRILVTGRKGM 188
            A  +++ +G++  I     L+++   A A ++  L +  +H      A   +V   KG 
Sbjct: 152 MAKYLVKPAGRICFIYHVSRLVELFAEAVALKLAPLRLRMIHDNALSEAGMFMVELAKGR 211

Query: 189 RGQLRFRYPIVLHKPNG 205
            G +    P+++   +G
Sbjct: 212 GGDMIIDPPLLVRDAHG 228


>gi|58337548|ref|YP_194133.1| hypothetical protein LBA1271 [Lactobacillus acidophilus NCFM]
 gi|227904189|ref|ZP_04021994.1| O-methyltransferase [Lactobacillus acidophilus ATCC 4796]
 gi|58254865|gb|AAV43102.1| hypothetical protein LBA1271 [Lactobacillus acidophilus NCFM]
 gi|227868208|gb|EEJ75629.1| O-methyltransferase [Lactobacillus acidophilus ATCC 4796]
          Length = 343

 Score = 45.8 bits (107), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 51/199 (25%), Positives = 93/199 (46%), Gaps = 19/199 (9%)

Query: 15  LADLGAGAGAAGLAVA--SRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEV 72
           +ADL AG  AA + +A  +R H   I + +       Y++   ++  N  +  RIS+ + 
Sbjct: 50  VADLCAGNCAATIYMAYFNRAHYDAIEIQDEI-----YSQAKRSVELN-DMENRISVYKD 103

Query: 73  DVTLVGENRNLAGLKNNFYDHVIMNPPFNE--RIGTMTPDKIKEEAHVMLEDSFEKWIRT 130
           +V    ++     L+ + YD V +NPP+ +      + PD  K  A   L  + E+ I  
Sbjct: 104 NVLNASKH-----LRKDSYDVVTVNPPYFKAPEGHEVNPDPKKAIARHELLINLEQIIEV 158

Query: 131 ACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE-ITPLHPREGECASRILVTGRK--G 187
           A  +++  G++ ++ RP+ L +I   C R   S++ + P      E A+ I+V   K  G
Sbjct: 159 ASGLLKMKGKMFMVHRPERLAEICYYCMRHDLSIKLVQPFVSHRDEDANLIIVEAVKHTG 218

Query: 188 MRGQLRFRYPIVLHKPNGQ 206
             G    +  I +H  +G+
Sbjct: 219 TDGT-ELKDAIEVHDQSGE 236


>gi|304437471|ref|ZP_07397429.1| SAM-dependent methyltransferase [Selenomonas sp. oral taxon 149
           str. 67H29BP]
 gi|304369521|gb|EFM23188.1| SAM-dependent methyltransferase [Selenomonas sp. oral taxon 149
           str. 67H29BP]
          Length = 245

 Score = 45.8 bits (107), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 70/157 (44%), Gaps = 12/157 (7%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA     TG   + DLG G G   L +A   H A +  AE  P+ A  A +  AL   
Sbjct: 35  VLLAHFPTLTGRERVLDLGTGMGIIPLLIAD--HAAIVTAAEIDPVQAELAARNAALNG- 91

Query: 61  AQISKRISLIEVDVTLVGENRNLAGL-KNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVM 119
             ++++I++ E      G+ R+ A L     YD V  NPP+            +  A   
Sbjct: 92  --LTEKITVRE------GDYRDPAALFSYEAYDIVFANPPYRPVGRGALSMGARAAARHE 143

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNA 156
           L  +    IR A   +R  G+L+++  P+ L +I+ A
Sbjct: 144 LTATLADVIRAAAFALRHGGRLAMVHLPERLSEIIPA 180


>gi|309805484|ref|ZP_07699529.1| GIY-YIG catalytic domain protein [Lactobacillus iners LactinV
           09V1-c]
 gi|308165135|gb|EFO67373.1| GIY-YIG catalytic domain protein [Lactobacillus iners LactinV
           09V1-c]
          Length = 334

 Score = 45.8 bits (107), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 49/207 (23%), Positives = 92/207 (44%), Gaps = 17/207 (8%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL  G GAA L + S  + A     E  P +A  A +++ L    Q+  RI+     V
Sbjct: 50  VVDLCCGNGAATLYM-SYFNLAHYDAVEIQPEIASQAERSVNL---NQLENRIA-----V 100

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNE--RIGTMTPDKIKEEAHVMLEDSFEKWIRTAC 132
             +        L  + +D V +NPP+ +      + P++ K  A   +  + E+ I+ A 
Sbjct: 101 HCINALDAPKKLGKDKFDVVTVNPPYFKVPEGHVINPNQQKAIARHEILINLEQVIKVAS 160

Query: 133 AIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTG-RKGMRG 190
            +++  G+L ++ RP+ L +I++ C    +G   I P  P++    + ++V         
Sbjct: 161 QLLKMKGKLFIVHRPERLAEIIHYCLNNHMGVKNIQPFAPQKDHETNLVVVEAVNNAPTD 220

Query: 191 QLRFRYPIVLHKPNGQPYSRFVTDLIN 217
            L    PI++H  +    S F  ++ N
Sbjct: 221 GLVLNNPIIVHNSD----SSFTDEIEN 243


>gi|314937306|ref|ZP_07844648.1| methyltransferase [Staphylococcus hominis subsp. hominis C80]
 gi|313654602|gb|EFS18352.1| methyltransferase [Staphylococcus hominis subsp. hominis C80]
          Length = 241

 Score = 45.8 bits (107), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 50/223 (22%), Positives = 100/223 (44%), Gaps = 18/223 (8%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA       +  + DL AG G   L +A++ H+ +I   E    +A  A+++      
Sbjct: 32  LLLAHFTKVRKNDSILDLCAGNGVIALLLAAKSHQ-KIESIEIQEQLADMAQRSFKYN-- 88

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
            Q+ +R+S+  +D+  V +       K + +  +  NPP+ ++       K   EAH + 
Sbjct: 89  -QLEERLSMHNMDLKDVYQT-----FKPSQFTLITCNPPYFKQNQLHQHQK---EAHKIA 139

Query: 121 ED----SFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGE 175
                 S E  +  A  +++  G+L ++ R + L+ ++    +  I    I  ++ + G+
Sbjct: 140 RHEIMCSLEDCMFAARHLLKQGGRLVMVHRAERLMDVLTEMRQANIEPKRIVFIYSKHGK 199

Query: 176 CASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLING 218
            A  I+V GRK     L    P  ++  NG+ YS  + ++  G
Sbjct: 200 SAVTIVVEGRKNGNQGLDIAPPFYIYNENGE-YSEQMKEVYYG 241


>gi|319648558|ref|ZP_08002772.1| hypothetical protein HMPREF1012_03811 [Bacillus sp. BT1B_CT2]
 gi|317389325|gb|EFV70138.1| hypothetical protein HMPREF1012_03811 [Bacillus sp. BT1B_CT2]
          Length = 255

 Score = 45.4 bits (106), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 54/218 (24%), Positives = 99/218 (45%), Gaps = 33/218 (15%)

Query: 14  HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVD 73
           ++ DL  G G   L +++R  +A I   E    +   A +++       + K+I LI  D
Sbjct: 56  NIIDLCTGNGIVPLLLSTRT-KAAITGVEIQERLYDMALRSVEY---NNLQKQIHLIRDD 111

Query: 74  VTLVGENRNLAG-LKNNFYDHVIMNPPFNERIGTMTPDKIKE-----------EAHVMLE 121
           +      +N+   L  N  D V  NPP+ +     TP K ++           E +  LE
Sbjct: 112 L------KNMPQVLGYNKADVVTCNPPYFK-----TPQKTEQNLNEHLAIARHEIYCTLE 160

Query: 122 DSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRI 180
           D     IR +  +++  G+L+L+ RP  L++I     A +I    +  ++P++ + A+ I
Sbjct: 161 D----VIRVSSKLLKQGGKLALVHRPGRLLEIFELMKAFQIEPKRVQFVYPKKSKEANTI 216

Query: 181 LVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLING 218
           LV G K  R  L+   P+ ++    Q Y+  +  ++ G
Sbjct: 217 LVEGIKDGRPDLKILPPLFVYDEQDQ-YTHEIRKILYG 253


>gi|327183783|gb|AEA32230.1| hypothetical protein LAB52_06505 [Lactobacillus amylovorus GRL
           1118]
          Length = 343

 Score = 45.4 bits (106), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 52/199 (26%), Positives = 91/199 (45%), Gaps = 19/199 (9%)

Query: 15  LADLGAGAGAAGLAVA--SRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEV 72
           +ADL AG  AA + +A  +R H   I + +       Y++   ++  N  +  RIS+   
Sbjct: 50  VADLCAGNCAATIYMAYFNRAHYDAIEIQDEI-----YSQAVRSVELN-DMENRISVYRD 103

Query: 73  DVTLVGENRNLAGLKNNFYDHVIMNPPFNE--RIGTMTPDKIKEEAHVMLEDSFEKWIRT 130
           +V    +      L+ + YD V +NPP+ +  +   + PD+ K  A   L    E  I  
Sbjct: 104 NVLNAPK-----FLRKDSYDVVTVNPPYFKAPKGHEVNPDRKKAIARHELLIDLEHIIAV 158

Query: 131 ACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE-ITPLHPREGECASRILVTGRK--G 187
           A  +++  G++ ++ RP+ L +I   C +   S++ + P     GE  + I+V   K  G
Sbjct: 159 ASGLLKMKGKMFMVHRPERLGEICYYCMKYDLSVKLVQPFVSHRGENTNLIIVEAVKHTG 218

Query: 188 MRGQLRFRYPIVLHKPNGQ 206
             G    R  I +H  NG+
Sbjct: 219 TDGT-ELRDAIEVHDQNGE 236


>gi|315038586|ref|YP_004032154.1| hypothetical protein LA2_07180 [Lactobacillus amylovorus GRL 1112]
 gi|312276719|gb|ADQ59359.1| hypothetical protein LA2_07180 [Lactobacillus amylovorus GRL 1112]
          Length = 343

 Score = 45.4 bits (106), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 52/199 (26%), Positives = 91/199 (45%), Gaps = 19/199 (9%)

Query: 15  LADLGAGAGAAGLAVA--SRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEV 72
           +ADL AG  AA + +A  +R H   I + +       Y++   ++  N  +  RIS+   
Sbjct: 50  VADLCAGNCAATIYMAYFNRAHYDAIEIQDEI-----YSQAVRSVELN-DMENRISVYRD 103

Query: 73  DVTLVGENRNLAGLKNNFYDHVIMNPPFNE--RIGTMTPDKIKEEAHVMLEDSFEKWIRT 130
           +V    +      L+ + YD V +NPP+ +  +   + PD+ K  A   L    E  I  
Sbjct: 104 NVLNAPK-----FLRKDSYDVVTVNPPYFKAPKGHEVNPDRKKAIARHELLIDLEHIIAV 158

Query: 131 ACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE-ITPLHPREGECASRILVTGRK--G 187
           A  +++  G++ ++ RP+ L +I   C +   S++ + P     GE  + I+V   K  G
Sbjct: 159 ASGLLKMKGKMFMVHRPERLGEICYYCMKYDLSVKLVQPFVSHRGENTNLIIVEAVKHTG 218

Query: 188 MRGQLRFRYPIVLHKPNGQ 206
             G    R  I +H  NG+
Sbjct: 219 TDGT-ELRDAIEVHDQNGE 236


>gi|239907527|ref|YP_002954268.1| hypothetical protein DMR_28910 [Desulfovibrio magneticus RS-1]
 gi|239797393|dbj|BAH76382.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 266

 Score = 45.4 bits (106), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 49/190 (25%), Positives = 79/190 (41%), Gaps = 10/190 (5%)

Query: 16  ADLGAGAGAAGLA--VASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVD 73
           ADLG G GAAGL   +A     A  L  +R P M   A +     A   +++R + + VD
Sbjct: 53  ADLGTGCGAAGLGCLLAGADPAATCLGLDRDPDMVRAAGQNA---ARLGLAERFTALAVD 109

Query: 74  VTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPD-KIKEEAHVMLEDSFEKWIRTAC 132
           +  + E+   A       D VI NPP+ +      P    +E A    +     +     
Sbjct: 110 LRGIRED---ARCLPESCDLVICNPPYRDPASGRRPSGPAREAARFETDGDMTDFAAAGS 166

Query: 133 AIMRSSGQLSLIARPQSLIQIVNACA-RRIGSLEITPLHPREGECASRILVTGRKGMRGQ 191
            ++ + G  + I   + L  +  A A +R+    + P+ PR G  A  +LV  RK     
Sbjct: 167 YLLANKGLFACIHLAERLPLVFAALADKRLVVKRVLPVSPRAGAPARLVLVAARKNGGPG 226

Query: 192 LRFRYPIVLH 201
           +    P+ L+
Sbjct: 227 MILDAPLALY 236


>gi|52078529|ref|YP_077320.1| hypothetical protein BL00537 [Bacillus licheniformis ATCC 14580]
 gi|52783891|ref|YP_089720.1| YabB [Bacillus licheniformis ATCC 14580]
 gi|52001740|gb|AAU21682.1| conserved hypothetical protein containing SAM (and some other
           nucleotide) binding motif YabB [Bacillus licheniformis
           ATCC 14580]
 gi|52346393|gb|AAU39027.1| YabB [Bacillus licheniformis ATCC 14580]
          Length = 247

 Score = 45.4 bits (106), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 54/218 (24%), Positives = 99/218 (45%), Gaps = 33/218 (15%)

Query: 14  HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVD 73
           ++ DL  G G   L +++R  +A I   E    +   A +++       + K+I LI  D
Sbjct: 48  NIIDLCTGNGIVPLLLSTRT-KAAITGVEIQERLYDMALRSVEY---NNLQKQIHLIRDD 103

Query: 74  VTLVGENRNLAG-LKNNFYDHVIMNPPFNERIGTMTPDKIKE-----------EAHVMLE 121
           +      +N+   L  N  D V  NPP+ +     TP K ++           E +  LE
Sbjct: 104 L------KNMPQVLGYNKADVVTCNPPYFK-----TPQKTEQNLNEHLAIARHEIYCTLE 152

Query: 122 DSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRI 180
           D     IR +  +++  G+L+L+ RP  L++I     A +I    +  ++P++ + A+ I
Sbjct: 153 D----VIRVSSKLLKQGGKLALVHRPGRLLEIFELMKAFQIEPKRVQFVYPKKSKEANTI 208

Query: 181 LVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLING 218
           LV G K  R  L+   P+ ++    Q Y+  +  ++ G
Sbjct: 209 LVEGIKDGRPDLKILPPLFVYDEQDQ-YTHEIRKILYG 245


>gi|145628789|ref|ZP_01784589.1| hypothetical protein CGSHi22121_07225 [Haemophilus influenzae
           22.1-21]
 gi|145638667|ref|ZP_01794276.1| phosphatidylserine synthase [Haemophilus influenzae PittII]
 gi|144979259|gb|EDJ88945.1| hypothetical protein CGSHi22121_07225 [Haemophilus influenzae
           22.1-21]
 gi|145272262|gb|EDK12170.1| phosphatidylserine synthase [Haemophilus influenzae PittII]
          Length = 232

 Score = 45.4 bits (106), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 44/213 (20%), Positives = 98/213 (46%), Gaps = 16/213 (7%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHE-AQILLAERSPLMAHYARKTLALPA 59
           ++L +  +     ++ D+G+G G   L +A R  E  QI   E  P+ A  A++ +    
Sbjct: 25  ILLGAWADVKHCKNILDMGSGTGLLALMLAQRTEENCQIQAVELDPIAAKQAQENI---N 81

Query: 60  NAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVM 119
           N+     I LI+ D+      ++        +D ++ NPP+ E+ G    ++ +E A   
Sbjct: 82  NSVWKNHIQLIQTDI------QHFLQTTEQTFDLIVANPPYFEQ-GIACKNEERELARYT 134

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASR 179
            + S   W+  A   +  +G++S +   ++   ++ + A  +  ++ T +  + G+   R
Sbjct: 135 -KQSHLNWLEWAATRLSENGRISFVLPYEAGKTLIKSTA--LFCIKQTNVITKIGKTPQR 191

Query: 180 ILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFV 212
           +L+T  K  + Q+  +  +V++  + Q    F+
Sbjct: 192 MLLTFAK--QPQVLMQDQLVIYDADNQYTEAFI 222


>gi|329919887|ref|ZP_08276825.1| GIY-YIG catalytic domain protein [Lactobacillus iners SPIN 1401G]
 gi|328936977|gb|EGG33407.1| GIY-YIG catalytic domain protein [Lactobacillus iners SPIN 1401G]
          Length = 344

 Score = 45.4 bits (106), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 49/207 (23%), Positives = 92/207 (44%), Gaps = 17/207 (8%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL  G GAA L + S  + A     E  P +A  A +++ L    Q+  RI+     V
Sbjct: 50  VVDLCCGNGAATLYM-SYFNLAHYDAVEIQPEIASQAERSVNL---NQLENRIA-----V 100

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNE--RIGTMTPDKIKEEAHVMLEDSFEKWIRTAC 132
             +        L  + +D V +NPP+ +      + P++ K  A   +  + E+ I+ A 
Sbjct: 101 HCINALDAPKKLGKDKFDVVTVNPPYFKVPEGHVINPNQQKAIARHEILINLEQVIKVAS 160

Query: 133 AIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTG-RKGMRG 190
            +++  G+L ++ RP+ L +I++ C    +G   I P  P++    + ++V         
Sbjct: 161 QLLKMKGKLFIVHRPERLAEIIHYCLNNHMGVKNIQPFAPQKDHETNLVVVEAVNNAPTD 220

Query: 191 QLRFRYPIVLHKPNGQPYSRFVTDLIN 217
            L    PI++H  +    S F  ++ N
Sbjct: 221 GLVLNNPIIVHNSD----SSFTDEIEN 243


>gi|171920142|ref|ZP_02691338.2| DNA methylase [Ureaplasma parvum serovar 1 str. ATCC 27813]
 gi|171902509|gb|EDT48798.1| DNA methylase [Ureaplasma parvum serovar 1 str. ATCC 27813]
          Length = 255

 Score = 45.4 bits (106), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 46/226 (20%), Positives = 105/226 (46%), Gaps = 10/226 (4%)

Query: 1   MILASLVN-ATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPA 59
           ++LA+ ++ ++ +  + ++G    A  + +ASR  + +I   E      + A   L +  
Sbjct: 32  ILLANFISLSSKTKKILEIGTNNAALSIFLASRKEDIKIDAIEIQIEAINLA--LLNISQ 89

Query: 60  NAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF--NERIGTMTPDKIKEEAH 117
           N    K+I++I  D       ++    +NN YD +I NPPF   ++I   T + +K  A 
Sbjct: 90  N-HFEKQINIIHADFNQYW--KDFDKSENNKYDAIICNPPFYKQDKIIPSTKNPLKTLAL 146

Query: 118 VMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGEC 176
             +  +FE+ ++    I++  G L+++     L+ ++    + +     I  ++PR  E 
Sbjct: 147 YEITLNFEQIMQGCAKIIKQKGNLAMVIPTTRLVDLLEIMRKYQFEPKRIKMIYPRIYEQ 206

Query: 177 ASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSL 222
           ++ +L+  R        F   + LH  + Q + ++  +++N  + +
Sbjct: 207 SNLVLIEARYKSGWGTHFEPNLYLHYEDKQNH-QYTEEVLNWYKPI 251


>gi|309750161|gb|ADO80145.1| Putative methyltransferase [Haemophilus influenzae R2866]
          Length = 240

 Score = 45.4 bits (106), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 44/213 (20%), Positives = 98/213 (46%), Gaps = 16/213 (7%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHE-AQILLAERSPLMAHYARKTLALPA 59
           ++L +  +     ++ D+G+G G   L +A R  E  QI   E  P+ A  A++ +    
Sbjct: 33  ILLGAWADVKHCKNILDMGSGTGLLALMLAQRTEENCQIQAVELDPIAAKQAQENI---N 89

Query: 60  NAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVM 119
           N+     I LI+ D+      ++        +D ++ NPP+ E+ G    ++ +E A   
Sbjct: 90  NSVWKNHIQLIQTDI------QHFLQTTEQTFDLIVANPPYFEQ-GIACKNEERELARYT 142

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASR 179
            + S   W+  A   +  +G++S +   ++   ++ + A  +  ++ T +  + G+   R
Sbjct: 143 -KQSHLNWLEWAATRLSENGRISFVLPYEAGKTLIKSTA--LFCIKQTNVITKIGKTPQR 199

Query: 180 ILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFV 212
           +L+T  K  + Q+  +  +V++  + Q    F+
Sbjct: 200 MLLTFAK--QPQVLMQDQLVIYDADNQYTEAFI 230


>gi|289422828|ref|ZP_06424661.1| methyltransferase small [Peptostreptococcus anaerobius 653-L]
 gi|289156738|gb|EFD05370.1| methyltransferase small [Peptostreptococcus anaerobius 653-L]
          Length = 249

 Score = 45.4 bits (106), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 46/211 (21%), Positives = 94/211 (44%), Gaps = 19/211 (9%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+         + DLG G G   + ++ +    +I+  E    +A  A +++ L   
Sbjct: 35  VLLANFSKVKRGSKVVDLGTGTGIIPVLISGKSRADKIIGVEIQEEVAEMATRSVKL--- 91

Query: 61  AQISKRISLIEVDV----TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTP-DKIKEE 115
             +  R+ ++  D+    +L+G+N           D V+ NPP+    G +   DK    
Sbjct: 92  NDLEDRVIILNEDLNNITSLIGKNT---------VDVVVSNPPYMHSKGIINENDKKAIS 142

Query: 116 AHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQ-IVNACARRIGSLEITPLHPREG 174
            H ++ D  E   R A  I++ +G+L +I R   L+  +V A    +    +  +H + G
Sbjct: 143 RHGIMCD-LEDIFRVAKDILKPNGKLYMINRTLRLVDMMVYARNHNLEPKTMKFVHSKIG 201

Query: 175 ECASRILVTGRKGMRGQLRFRYPIVLHKPNG 205
           +    +LV   K  + +++   P+ ++K +G
Sbjct: 202 KAPKLVLVEFVKCAKPEVKVLEPLYIYKEDG 232


>gi|292669920|ref|ZP_06603346.1| SAM-dependent methyltransferase [Selenomonas noxia ATCC 43541]
 gi|292648717|gb|EFF66689.1| SAM-dependent methyltransferase [Selenomonas noxia ATCC 43541]
          Length = 248

 Score = 45.1 bits (105), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 86/190 (45%), Gaps = 14/190 (7%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA     TG  H+ DLG G G   L  A     AQI   E +P+ A  A + + L   
Sbjct: 37  VLLAHFPRLTGREHILDLGTGTGVIPLLAAD--GAAQITAVELNPVQAALAARNVQLNG- 93

Query: 61  AQISKRISLIEVDVTLVGENRNLAGL-KNNFYDHVIMNPPFNERI-GTMTPDKIKEEAHV 118
             +S++I++ E      G+ R+ + L     +D V  NPP+     G ++    +  A  
Sbjct: 94  --LSEKITVRE------GDYRDPSALFACAVFDLVFANPPYRPVASGAVSIGDGRATARH 145

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNA-CARRIGSLEITPLHPREGECA 177
            +  +    +R A   +R  G+L+++  P+ L ++V A  A  +    +  + PR  +  
Sbjct: 146 EITATLADTVRAAAYALRHGGRLAMVHLPERLGELVLALTAEELAVKRLRMVQPRADKAP 205

Query: 178 SRILVTGRKG 187
           + +L+   KG
Sbjct: 206 NLLLLEAVKG 215


>gi|138893706|ref|YP_001124159.1| methyltransferase [Geobacillus thermodenitrificans NG80-2]
 gi|196250749|ref|ZP_03149436.1| methyltransferase small [Geobacillus sp. G11MC16]
 gi|134265219|gb|ABO65414.1| Methyltransferase [Geobacillus thermodenitrificans NG80-2]
 gi|196209699|gb|EDY04471.1| methyltransferase small [Geobacillus sp. G11MC16]
          Length = 249

 Score = 45.1 bits (105), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 42/199 (21%), Positives = 89/199 (44%), Gaps = 18/199 (9%)

Query: 14  HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVD 73
            + DL  G G   L ++ R  +  I+  E    +   AR+++       + ++I +I  D
Sbjct: 48  QIVDLCTGNGVIPLLLSQRT-KGTIIGIEIQERLCDMARRSIQYNG---LEEQIEIIHGD 103

Query: 74  VTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLED-----SFEKWI 128
           +    +      +  + YD V  NPP+     T   D++ +  H+ +       + E  +
Sbjct: 104 IKEAPQQ-----IGYSRYDVVTCNPPY---FPTAGQDELSKNEHLAIARHEIYCTLEDAV 155

Query: 129 RTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRKG 187
           R +  +++  G+ + + RP  L+ IV    + R+    +  ++P+ G+ A+ IL+ G K 
Sbjct: 156 RVSSQLLKQGGKAAFVHRPGRLLDIVMLMRQYRLEPKRLRFVYPKAGKEANMILIEGMKD 215

Query: 188 MRGQLRFRYPIVLHKPNGQ 206
               L+   P+V++  N +
Sbjct: 216 ASPDLKVLPPLVVYDENNE 234


>gi|325264822|ref|ZP_08131550.1| SAM-dependent methyltransferase [Clostridium sp. D5]
 gi|324029811|gb|EGB91098.1| SAM-dependent methyltransferase [Clostridium sp. D5]
          Length = 239

 Score = 45.1 bits (105), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 41/209 (19%), Positives = 91/209 (43%), Gaps = 11/209 (5%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++L+  V       + DLG G G   + +A++         E     A  A +++    +
Sbjct: 35  VLLSDFVRVKKDETVLDLGTGTGILPILLAAKTRGKHFTGLEIQAESADMAERSVE---H 91

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFN-ERIGTMTPDKIKEEAHVM 119
            ++  +I ++  D+    E       +  F+D ++ NPP+     G   P   K  A   
Sbjct: 92  NRLGDQIDIVTGDIKEAAEI-----FRPAFFDVIVTNPPYMLSEHGLQNPQDAKAIARHE 146

Query: 120 LEDSFEKWIRTACAIMRSS-GQLSLIARPQSLIQIV-NACARRIGSLEITPLHPREGECA 177
           +  + +  +R +  +++ S G+  +I +P  L +I+      +I    I  +HP   +  
Sbjct: 147 VLCTLDDILRESGKLLQESKGRFYMIHKPFRLAEIIIKMNQYKIEPKRIQFIHPYVDKEP 206

Query: 178 SRILVTGRKGMRGQLRFRYPIVLHKPNGQ 206
           S +L+ G KG + +++   P++++   G+
Sbjct: 207 SMVLIEGIKGGKSRVKIEAPVIMYDRGGR 235


>gi|319898056|ref|YP_004136253.1| o-methyltransferase [Haemophilus influenzae F3031]
 gi|317433562|emb|CBY81946.1| predicted O-methyltransferase [Haemophilus influenzae F3031]
          Length = 232

 Score = 45.1 bits (105), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 43/213 (20%), Positives = 98/213 (46%), Gaps = 16/213 (7%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHE-AQILLAERSPLMAHYARKTLALPA 59
           ++L +  +     ++ D+G+G G   L +A R  E  QI   E  P+ A  A++ +    
Sbjct: 25  ILLGAWADVKHCKNILDMGSGTGLLALMLAQRTEENCQIQAVELDPIAAKQAQENI---N 81

Query: 60  NAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVM 119
           N+    RI L + D+      ++        +D ++ NPP+ E+ G    ++ +E A   
Sbjct: 82  NSVWKNRIQLTQADI------QHFLQTTEQTFDLIVANPPYFEQ-GIACKNEERELARYT 134

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASR 179
            + S   W+  A   +  +G++S +   ++   ++ + A  +  ++ T +  + G+   R
Sbjct: 135 -KQSHLNWLEWAATHLSENGKISFVLPYEAGKTLIKSTA--LFCIKQTNVITKIGKTPQR 191

Query: 180 ILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFV 212
           +L+T  K  + ++  +  +V++  + Q    F+
Sbjct: 192 MLLTFAK--QPEILMQDQLVIYDADNQYTEAFI 222


>gi|262065982|ref|ZP_06025594.1| ribosomal RNA small subunit methyltransferase [Fusobacterium
           periodonticum ATCC 33693]
 gi|291380339|gb|EFE87857.1| ribosomal RNA small subunit methyltransferase [Fusobacterium
           periodonticum ATCC 33693]
          Length = 222

 Score = 45.1 bits (105), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 78/184 (42%), Gaps = 20/184 (10%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           L D+G G G   + ++      +I+  +        A K L L    +I K I+   +DV
Sbjct: 48  LLDIGTGNGVLPILLSDNAMIEEIVGIDIQNENIQRANKALEL---NKIEKNINFTSLDV 104

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLED-----SFEKWIR 129
               E +N      N++D VI NPP+ E  G     KI E  H  L       + E++I+
Sbjct: 105 K---EYKNA-----NYFDVVISNPPYMEDNGK----KINENEHKALSRHEIKLNLEEFIQ 152

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRILVTGRKGMR 189
            A  +++  G L  I R   L++I+        S++       +   ++ +++   KG +
Sbjct: 153 NAKRLLKPIGTLYFIHRTHRLVEIIKTLDENKFSIKKITFIFSKNNTSNMMIIEALKGKK 212

Query: 190 GQLR 193
            +L 
Sbjct: 213 IKLE 216


>gi|320109110|ref|YP_004184700.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Terriglobus saanensis SP1PR4]
 gi|319927631|gb|ADV84706.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Terriglobus saanensis SP1PR4]
          Length = 286

 Score = 45.1 bits (105), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 69/151 (45%), Gaps = 22/151 (14%)

Query: 7   VNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKR 66
           ++ +    +AD+G+G+GA G+ +A+    A+I  A+ SP         LA+     I   
Sbjct: 116 IDPSALVMIADIGSGSGAIGVTLAAEFEMARITAADLSP-------AALAVTEQNAIRHH 168

Query: 67  ISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF---NERIGTMTPDKIKEEAHVML--- 120
           +S    D     E+   + L    +D+V+ NPP+   +ER  ++ P     E  + L   
Sbjct: 169 VS----DRVRTFESDLFSALGERIFDYVVSNPPYIAASER-DSLHPQVRDHEPELALYGG 223

Query: 121 EDSFEKWIR---TACAIMRSSGQLSL-IARP 147
           ED FE + R    A   +R  G L L I +P
Sbjct: 224 EDGFEIYTRLIPQAWKHLRPGGMLFLEIGKP 254


>gi|15612610|ref|NP_240913.1| hypothetical protein BH0047 [Bacillus halodurans C-125]
 gi|10172659|dbj|BAB03766.1| BH0047 [Bacillus halodurans C-125]
          Length = 246

 Score = 45.1 bits (105), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 35/150 (23%), Positives = 72/150 (48%), Gaps = 15/150 (10%)

Query: 68  SLIEVDVTLVGENRNLAGLKNNF----YDHVIMNPPF----NERIGTMTP--DKIKEEAH 117
            L +++  L   N +L  L  N     +D V  NPP+    NE +    P     + E H
Sbjct: 89  QLNDLEQQLTFMNLDLKDLPKNMPMHSFDVVTCNPPYFANLNEDLLNDNPYLAIARHEIH 148

Query: 118 VMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGEC 176
             L+D     +R +  ++++ G+++++ RP+ + +++    R RI    +  +HP+ G  
Sbjct: 149 CSLDD----VLRVSSQMVKNRGKVAIVHRPERITELIEGMKRYRIEPKRLQFIHPKAGAE 204

Query: 177 ASRILVTGRKGMRGQLRFRYPIVLHKPNGQ 206
           A+ +L+ G  G    ++   P+ ++  NG+
Sbjct: 205 ANIVLIEGMLGGNSGVKVLPPLTVYDGNGK 234


>gi|262527564|sp|P44702|TRMN6_HAEIN RecName: Full=tRNA (adenine-N(6)-)-methyltransferase; AltName:
           Full=tRNA m6A37 methyltransferase
          Length = 232

 Score = 44.7 bits (104), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 44/213 (20%), Positives = 97/213 (45%), Gaps = 16/213 (7%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHE-AQILLAERSPLMAHYARKTLALPA 59
           ++L +  +     ++ D+G G G   L +A R  E  QI   E  P+ A  A++ +    
Sbjct: 25  ILLGAWADVKHCKNILDMGCGTGLLALMLAQRTEENCQIQAVELDPIAAKQAQENI---N 81

Query: 60  NAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVM 119
           N+    RI L +VD+      ++        +D ++ NPP+ E+ G    ++ +E A   
Sbjct: 82  NSVWKNRIQLTQVDI------QHFLQTTEQTFDLIVANPPYFEQ-GIACKNEERELARYT 134

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASR 179
            + S   W+  A   +  +G++S +   ++   +  + A  +  ++ T +  + G+   R
Sbjct: 135 -KQSHLNWLEWAATRLSENGRISFVLPYEAGKTLTKSTA--LFCIKQTNVITKIGKTPQR 191

Query: 180 ILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFV 212
           +L+T  K  + ++  +  +V++  + Q    F+
Sbjct: 192 MLLTFAK--QPEVLMQDQLVIYDADNQYTEAFI 222


>gi|269792808|ref|YP_003317712.1| Methyltransferase type 11 [Thermanaerovibrio acidaminovorans DSM
           6589]
 gi|269100443|gb|ACZ19430.1| Methyltransferase type 11 [Thermanaerovibrio acidaminovorans DSM
           6589]
          Length = 248

 Score = 44.7 bits (104), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 68/146 (46%), Gaps = 20/146 (13%)

Query: 82  NLAGLKNNF----YDHVIMNPPFNERIGTMTPDK---IKEEAHVM---LEDSFEKWIRTA 131
           +L  LK ++    +D V+ NPP+ E  G+  P     +    H M   LED F +    +
Sbjct: 104 DLMELKGSWEEAPFDLVVCNPPY-EDPGSGRPSPRGPVALAVHRMSFTLEDLFLR----S 158

Query: 132 CAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRKGMRG 190
             ++R  G+  ++ R   + + ++   R R+    +  +HP+ G  AS  LV   KG R 
Sbjct: 159 GKVLRPKGRFFMVMRSHRMGECLDLMRRHRLEPKRLRMVHPKPGRAASVFLVEAIKGARA 218

Query: 191 QLRFRYPIVLHKPNGQPYSRFVTDLI 216
            L    P+ +H P+G+    +  DL+
Sbjct: 219 GLVVESPLFIHGPDGE----YTPDLL 240


>gi|242277527|ref|YP_002989656.1| methyltransferase type 11 [Desulfovibrio salexigens DSM 2638]
 gi|242120421|gb|ACS78117.1| Methyltransferase type 11 [Desulfovibrio salexigens DSM 2638]
          Length = 241

 Score = 44.7 bits (104), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 40/214 (18%), Positives = 92/214 (42%), Gaps = 29/214 (13%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++++S V+      + DLG G+G   L +                 M  +  K L +   
Sbjct: 27  LLISSFVSVPSQARVLDLGTGSGVIPLGI-----------------MLRHPDKGLNITGL 69

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNF----------YDHVIMNPPF-NERIGTMTP 109
              S  ++  E +V  +G    +  ++ N           YD V+ NPP+ +E  G   P
Sbjct: 70  EINSDMVAAAEENVQKLGFAEEIGIVQGNVCTPDFAPAGSYDLVVSNPPYRSEGRGKACP 129

Query: 110 DKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITP 168
           D+ + +A   ++   + ++ TA  ++R+ G++  +   + L +++++  R ++    +  
Sbjct: 130 DEDRNKARFEIDCDLDAFVATASRMVRNRGRVCFVFLAERLTELIDSFTRHKLEPKRMKF 189

Query: 169 LHPREGECASRILVTGRKGMRGQLRFRYPIVLHK 202
           +H R    +  +++   KG +  L    P++L +
Sbjct: 190 IHGRIDSPSKVVMLEAVKGGKPGLILEPPVILFE 223


>gi|308235423|ref|ZP_07666160.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Gardnerella vaginalis ATCC 14018]
          Length = 306

 Score = 44.7 bits (104), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 49/89 (55%), Gaps = 11/89 (12%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DL AG+GA GL+VAS + +AQ+   E+SP    Y +K        +I+++ +++     +
Sbjct: 129 DLCAGSGAIGLSVASEVADAQVWAVEKSPKAFEYLQKNY-----NKIAEKYNILNRYHAI 183

Query: 77  VGENRNL-----AGLKNNFYDHVIMNPPF 100
           +G+  N+     A +K    D VI NPP+
Sbjct: 184 LGDATNVNLPEKAAIKEKV-DVVITNPPY 211


>gi|325957061|ref|YP_004292473.1| hypothetical protein LAC30SC_07100 [Lactobacillus acidophilus 30SC]
 gi|325333626|gb|ADZ07534.1| hypothetical protein LAC30SC_07100 [Lactobacillus acidophilus 30SC]
          Length = 343

 Score = 44.7 bits (104), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 92/199 (46%), Gaps = 19/199 (9%)

Query: 15  LADLGAGAGAAGLAVA--SRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEV 72
           +ADL AG  AA + ++  +R H   I + +       Y++   ++  N  +  RIS+ + 
Sbjct: 50  VADLCAGNCAATIYMSYFNRAHYDAIEIQDEI-----YSQAVRSIELN-DMENRISVYKD 103

Query: 73  DVTLVGENRNLAGLKNNFYDHVIMNPPFNE--RIGTMTPDKIKEEAHVMLEDSFEKWIRT 130
           ++    +      L+ + YD V +NPP+ +  +   + PD+ K  A   L    E  I  
Sbjct: 104 NILNAPK-----FLRKDSYDVVTVNPPYFKAPKGHEVNPDRKKAIARHELLIDLEHIIAV 158

Query: 131 ACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE-ITPLHPREGECASRILVTGRK--G 187
           A  +++  G++ ++ RP+ L +I   C +   S++ + P     GE  + I+V   K  G
Sbjct: 159 ASGLLKMKGKMFMVHRPERLGEICYYCMKYDLSVKLVQPFVSHRGENTNLIIVEAVKHTG 218

Query: 188 MRGQLRFRYPIVLHKPNGQ 206
             G    R  I +H  NG+
Sbjct: 219 TDGT-ELRDAIEVHDQNGE 236


>gi|296454710|ref|YP_003661853.1| HemK family modification methylase [Bifidobacterium longum subsp.
           longum JDM301]
 gi|296184141|gb|ADH01023.1| modification methylase, HemK family [Bifidobacterium longum subsp.
           longum JDM301]
          Length = 313

 Score = 44.7 bits (104), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 47/89 (52%), Gaps = 8/89 (8%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL AG+GA GL++ S +  +Q+   E SP  A + R+ LA+ A     KR   I  + 
Sbjct: 140 MVDLCAGSGAIGLSIVSEVPGSQVWAVELSPRTAEWTRRNLAVTA-----KRYPSIASNY 194

Query: 75  TL-VGENRNLAGLK--NNFYDHVIMNPPF 100
            L V +  +LA L   +   D VI NPP+
Sbjct: 195 QLEVADATSLATLAQLDGTIDIVITNPPY 223


>gi|296107189|ref|YP_003618889.1| hypothetical protein lpa_02323 [Legionella pneumophila 2300/99
           Alcoy]
 gi|295649090|gb|ADG24937.1| Hypothetical protein lpa_02323 [Legionella pneumophila 2300/99
           Alcoy]
          Length = 219

 Score = 44.7 bits (104), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 59/139 (42%), Gaps = 9/139 (6%)

Query: 11  GSFHLADLGAGAGAAGLAVASRLHEA-QILLAERSPLMAHYARKTLALPANAQISKRISL 69
           GS  + DL AG G  G+ ++  L    QI   E   +   Y  + +A     ++  R  L
Sbjct: 47  GSLRVLDLCAGCGVIGIELSWYLQAIRQIDFIEIQDIYTEYFYQNIANVNRPELQFRWHL 106

Query: 70  IEVDVTLVGENRNLAGLKNNFYDHVIMNPP-FNERIGTMTPDKIKEEAHVMLEDSFEKWI 128
           +  D        +    ++ F D +I NPP F    G ++P K K      L+ SF+ +I
Sbjct: 107 LNYD------ELHKKKWEDKF-DLIISNPPYFQPGHGMLSPSKFKNRCRFYLDSSFQSYI 159

Query: 129 RTACAIMRSSGQLSLIARP 147
           +     + + G+   + RP
Sbjct: 160 QALGNSLANRGKAYFLLRP 178


>gi|311114830|ref|YP_003986051.1| protein-(glutamine-N5) methyltransferase [Gardnerella vaginalis
           ATCC 14019]
 gi|310946324|gb|ADP39028.1| protein-(glutamine-N5) methyltransferase [Gardnerella vaginalis
           ATCC 14019]
          Length = 302

 Score = 44.7 bits (104), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 49/89 (55%), Gaps = 11/89 (12%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DL AG+GA GL+VAS + +AQ+   E+SP    Y +K        +I+++ +++     +
Sbjct: 125 DLCAGSGAIGLSVASEVADAQVWAVEKSPKAFEYLQKNY-----NKIAEKYNILNRYHAI 179

Query: 77  VGENRNL-----AGLKNNFYDHVIMNPPF 100
           +G+  N+     A +K    D VI NPP+
Sbjct: 180 LGDATNVNLPEKAAIKEKV-DVVITNPPY 207


>gi|16272371|ref|NP_438584.1| hypothetical protein HI0423 [Haemophilus influenzae Rd KW20]
 gi|260580514|ref|ZP_05848342.1| O-methyltransferase [Haemophilus influenzae RdAW]
 gi|1573395|gb|AAC22079.1| conserved hypothetical protein [Haemophilus influenzae Rd KW20]
 gi|260092856|gb|EEW76791.1| O-methyltransferase [Haemophilus influenzae RdAW]
          Length = 240

 Score = 44.7 bits (104), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 44/213 (20%), Positives = 97/213 (45%), Gaps = 16/213 (7%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHE-AQILLAERSPLMAHYARKTLALPA 59
           ++L +  +     ++ D+G G G   L +A R  E  QI   E  P+ A  A++ +    
Sbjct: 33  ILLGAWADVKHCKNILDMGCGTGLLALMLAQRTEENCQIQAVELDPIAAKQAQENI---N 89

Query: 60  NAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVM 119
           N+    RI L +VD+      ++        +D ++ NPP+ E+ G    ++ +E A   
Sbjct: 90  NSVWKNRIQLTQVDI------QHFLQTTEQTFDLIVANPPYFEQ-GIACKNEERELARYT 142

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASR 179
            + S   W+  A   +  +G++S +   ++   +  + A  +  ++ T +  + G+   R
Sbjct: 143 -KQSHLNWLEWAATRLSENGRISFVLPYEAGKTLTKSTA--LFCIKQTNVITKIGKTPQR 199

Query: 180 ILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFV 212
           +L+T  K  + ++  +  +V++  + Q    F+
Sbjct: 200 MLLTFAK--QPEVLMQDQLVIYDADNQYTEAFI 230


>gi|78776927|ref|YP_393242.1| methyltransferase small [Sulfurimonas denitrificans DSM 1251]
 gi|78497467|gb|ABB44007.1| Methyltransferase small [Sulfurimonas denitrificans DSM 1251]
          Length = 231

 Score = 44.7 bits (104), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 36/190 (18%), Positives = 78/190 (41%), Gaps = 26/190 (13%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISK------RISLI 70
           D+GAG G  GL VA    + ++   E+  L   YA        NA+++K      +   +
Sbjct: 34  DVGAGCGVVGLLVAKDNEKVELEAVEKQELFVKYAT------INARVNKIPYKIHKSDFL 87

Query: 71  EVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRT 130
           E+D             + + YD++I NPPF     T + +++   A        E++ + 
Sbjct: 88  ELD-------------EESKYDYIISNPPFYHDGVTKSENEMLFNARYNSNLPLEQFFKK 134

Query: 131 ACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRKGMR 189
              I++ +              I    ++ ++ ++++  +H +    AS +++  R G +
Sbjct: 135 VTKILKPNSHFIFCYDASQFGLICEELSKVKMRAVDVQFIHSKIDRVASLVMIHARNGSK 194

Query: 190 GQLRFRYPIV 199
             ++   P +
Sbjct: 195 SLMKILPPFI 204


>gi|54297523|ref|YP_123892.1| hypothetical protein lpp1571 [Legionella pneumophila str. Paris]
 gi|148359140|ref|YP_001250347.1| hypothetical protein LPC_1032 [Legionella pneumophila str. Corby]
 gi|53751308|emb|CAH12722.1| hypothetical protein lpp1571 [Legionella pneumophila str. Paris]
 gi|148280913|gb|ABQ55001.1| hypothetical protein LPC_1032 [Legionella pneumophila str. Corby]
          Length = 226

 Score = 44.7 bits (104), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 59/139 (42%), Gaps = 9/139 (6%)

Query: 11  GSFHLADLGAGAGAAGLAVASRLHEA-QILLAERSPLMAHYARKTLALPANAQISKRISL 69
           GS  + DL AG G  G+ ++  L    QI   E   +   Y  + +A     ++  R  L
Sbjct: 54  GSLRVLDLCAGCGVIGIELSWYLQAIRQIDFIEIQDIYTEYFYQNIANVNRPELQFRWHL 113

Query: 70  IEVDVTLVGENRNLAGLKNNFYDHVIMNPP-FNERIGTMTPDKIKEEAHVMLEDSFEKWI 128
           +  D        +    ++ F D +I NPP F    G ++P K K      L+ SF+ +I
Sbjct: 114 LNYD------ELHKKKWEDKF-DLIISNPPYFQPGHGMLSPSKFKNRCRFYLDSSFQSYI 166

Query: 129 RTACAIMRSSGQLSLIARP 147
           +     + + G+   + RP
Sbjct: 167 QALGNSLANRGKAYFLLRP 185


>gi|301169123|emb|CBW28720.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Haemophilus influenzae 10810]
          Length = 240

 Score = 44.7 bits (104), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 45/214 (21%), Positives = 98/214 (45%), Gaps = 18/214 (8%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHE-AQILLAERSPLMAHYARKTLALPA 59
           ++L +  +     ++ D+G G G   L +A R  E  QI   E  P+ A  A++ +    
Sbjct: 33  ILLGAWADVKHCKNILDMGCGTGLLALMLAQRTEENCQIQAVELDPIAAKQAQENI---- 88

Query: 60  NAQISK-RISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHV 118
           N  + K RI LI+ D+      ++        +D ++ NPP+ E+ G    ++ +E A  
Sbjct: 89  NDSVWKNRIQLIQTDI------QHFLQTTAQTFDLIVANPPYFEQ-GIACKNEERELARY 141

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECAS 178
             + S   W+  A   +  +G++S +   ++   +  + A  +  ++ T +  + G+   
Sbjct: 142 T-KQSHLNWLEWAATRLSENGKISFVLPYEAGKTLTKSTA--LFCIKQTNVMTKVGKTPQ 198

Query: 179 RILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFV 212
           R+L+T  K  + ++  +  +V++  + Q    F+
Sbjct: 199 RMLLTFAK--QPEVLMQDQLVIYDADNQYTEAFI 230


>gi|219871403|ref|YP_002475778.1| phosphatidylserine synthase [Haemophilus parasuis SH0165]
 gi|262828453|sp|B8F678|TRMN6_HAEPS RecName: Full=tRNA (adenine-N(6)-)-methyltransferase; AltName:
           Full=tRNA m6A37 methyltransferase
 gi|219691607|gb|ACL32830.1| phosphatidylserine synthase [Haemophilus parasuis SH0165]
          Length = 235

 Score = 44.3 bits (103), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 34/147 (23%), Positives = 68/147 (46%), Gaps = 19/147 (12%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++L S+ + + + H+ DLG G G   + +A R   AQI   E      H A++      N
Sbjct: 25  ILLGSIADPSNARHILDLGTGTGLIAIMLAQRTASAQITALELEENAFHQAQE------N 78

Query: 61  AQ---ISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAH 117
           AQ    + RI +++ D+      +         +D ++ NPP+ E     + +K ++ A 
Sbjct: 79  AQRCPWNNRIDVLQADIMTWKSTKK--------FDLIVSNPPYFEH-SLASRNKQRDLAR 129

Query: 118 VMLEDSFEKWIRTACAIMRSSGQLSLI 144
            +    F+ W++ +   +  +G++S I
Sbjct: 130 AVTYSHFD-WLKQSQQWLTPNGRISFI 155


>gi|307610304|emb|CBW99871.1| hypothetical protein LPW_16291 [Legionella pneumophila 130b]
          Length = 219

 Score = 44.3 bits (103), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 59/139 (42%), Gaps = 9/139 (6%)

Query: 11  GSFHLADLGAGAGAAGLAVASRLHEA-QILLAERSPLMAHYARKTLALPANAQISKRISL 69
           GS  + DL AG G  G+ ++  L    QI   E   +   Y  + +A     ++  R  L
Sbjct: 47  GSLRVLDLCAGCGVIGIELSWYLQAIRQIDFIEIQDIYTKYFYQNIANVNRPELQFRWHL 106

Query: 70  IEVDVTLVGENRNLAGLKNNFYDHVIMNPP-FNERIGTMTPDKIKEEAHVMLEDSFEKWI 128
           +  D        +    ++ F D +I NPP F    G ++P K K      L+ SF+ +I
Sbjct: 107 LNYD------ELHKKKWEDKF-DLIISNPPYFQPGHGMLSPSKFKNRCRFYLDSSFQSYI 159

Query: 129 RTACAIMRSSGQLSLIARP 147
           +     + + G+   + RP
Sbjct: 160 QALGNSLANRGKAYFLLRP 178


>gi|145636309|ref|ZP_01791978.1| phosphatidylserine synthase [Haemophilus influenzae PittHH]
 gi|145270474|gb|EDK10408.1| phosphatidylserine synthase [Haemophilus influenzae PittHH]
          Length = 232

 Score = 44.3 bits (103), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 45/214 (21%), Positives = 99/214 (46%), Gaps = 18/214 (8%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHE-AQILLAERSPLMAHYARKTLALPA 59
           ++L +  +     ++ D+G+G G   L +A R  E  QI   E  P+    A++ +    
Sbjct: 25  ILLGAWADVKHCKNILDMGSGTGLLALMLAQRTEENCQIQAVELDPIAVKQAQENI---- 80

Query: 60  NAQISK-RISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHV 118
           N  + K RI LI+ D+      ++        +D ++ NPP+ E+ G    ++ +E A  
Sbjct: 81  NDSVWKNRIQLIQTDI------QHFLQTTAQTFDLIVANPPYFEQ-GIACKNEERELARY 133

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECAS 178
             + S   W+  A   +  +G++S +   ++   ++ + A  +  ++ T +  + G+   
Sbjct: 134 T-KQSHLNWLEWAATRLSENGRISFVLPYEAGKTLIKSTA--LFCIKQTNVITKIGKTPQ 190

Query: 179 RILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFV 212
           R+L+T  K  + Q+  +  +V++  + Q    F+
Sbjct: 191 RMLLTFAK--QPQVLMQDQLVIYDADNQYTEAFI 222


>gi|301155360|emb|CBW14826.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Haemophilus parainfluenzae T3T1]
          Length = 215

 Score = 44.3 bits (103), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 46/214 (21%), Positives = 95/214 (44%), Gaps = 18/214 (8%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHE-AQILLAERSPLMAHYARKTL-ALP 58
           ++L +  + +   H+ D+G G G   L +A R HE  +I   E  PL A  A++   A P
Sbjct: 8   ILLGAWADVSDCQHILDMGTGTGLVALMLAQRSHEHCKIEAVELDPLAAQQAQENFKASP 67

Query: 59  ANAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHV 118
            +     R+ L   DV      +       + +D ++ NPP+  +      D+     +V
Sbjct: 68  WH----NRLHLTRQDV------QTYCLQTAHQFDLIVANPPYFAQGVECKNDERALARYV 117

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECAS 178
             + S   W+  A + +   G++S +   ++   ++N+ A  +  ++ T +  + G+   
Sbjct: 118 --QQSHLDWLNWAASCLSEKGKISFVLPYEAGKTLINSTA--LYCIKQTDVITKIGKAPQ 173

Query: 179 RILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFV 212
           R+L+T  +    Q++    +V++  N Q    F+
Sbjct: 174 RMLLTFSREHVPQVKD--SLVIYNENNQYTEAFI 205


>gi|78358540|ref|YP_389989.1| hypothetical protein Dde_3501 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|78220945|gb|ABB40294.1| conserved hypothetical protein [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 275

 Score = 44.3 bits (103), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 47/200 (23%), Positives = 80/200 (40%), Gaps = 24/200 (12%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           D G G G  GLA+   L   Q    +  P +A  A    A+     +  R S ++ D   
Sbjct: 60  DAGTGCGVVGLALCLLLDTVQGTGFDIDPQLADAATHNAAM---LGLGNRFSAVQADAQQ 116

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDK-----IKEEAHVMLEDS--FEKWIR 129
           V   R  A +    +D V+ NPP+        PD+      ++    + E +     ++ 
Sbjct: 117 V---RAHADITPESFDLVVTNPPYRR------PDQGRHAATQQRTRALFETAGPLTAFVA 167

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE---ITPLHPREGECASRILVTGRK 186
            +   +R+ G+   I   + L  ++  C  R   LE   + P+H R  + A  IL+  RK
Sbjct: 168 ASAYALRNKGRFFCIYPAERLPDLL--CTLRPAGLEAKSLLPVHSRAEQPARLILLEARK 225

Query: 187 GMRGQLRFRYPIVLHKPNGQ 206
                +    P+VL+  +G 
Sbjct: 226 NANPAITIHPPLVLYAGSGH 245


>gi|148827622|ref|YP_001292375.1| hypothetical protein CGSHiGG_05325 [Haemophilus influenzae PittGG]
 gi|262828400|sp|A5UGT6|TRMN6_HAEIG RecName: Full=tRNA (adenine-N(6)-)-methyltransferase; AltName:
           Full=tRNA m6A37 methyltransferase
 gi|148718864|gb|ABQ99991.1| hypothetical protein CGSHiGG_05325 [Haemophilus influenzae PittGG]
          Length = 232

 Score = 44.3 bits (103), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 45/214 (21%), Positives = 99/214 (46%), Gaps = 18/214 (8%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHE-AQILLAERSPLMAHYARKTLALPA 59
           ++L +  +     ++ D+G+G G   L +A R  E  QI   E  P+    A++ +    
Sbjct: 25  ILLGAWADVKHCKNILDMGSGTGLLALMLAQRTEENCQIQAVELDPIAVKQAQENI---- 80

Query: 60  NAQISK-RISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHV 118
           N  + K RI LI+ D+      ++        +D ++ NPP+ E+ G    ++ +E A  
Sbjct: 81  NDSVWKNRIQLIQTDI------QHFLQTTAQTFDLIVANPPYFEQ-GIACKNEERELARY 133

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECAS 178
             + S   W+  A   +  +G++S +   ++   ++ + A  +  ++ T +  + G+   
Sbjct: 134 T-KQSHLNWLEWAATRLSENGRISFVLPYEAGKTLIKSTA--LFCIKQTNVITKIGKTPQ 190

Query: 179 RILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFV 212
           R+L+T  K  + Q+  +  +V++  + Q    F+
Sbjct: 191 RMLLTFAK--QPQVLMQDQLVIYDADNQYTEAFI 222


>gi|145640384|ref|ZP_01795968.1| predicted O-methyltransferase [Haemophilus influenzae R3021]
 gi|145274970|gb|EDK14832.1| predicted O-methyltransferase [Haemophilus influenzae 22.4-21]
          Length = 232

 Score = 44.3 bits (103), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 45/213 (21%), Positives = 96/213 (45%), Gaps = 16/213 (7%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHE-AQILLAERSPLMAHYARKTLALPA 59
           ++L +  +     ++ D+G+G G   L +A R  E  QI   E  P+ A  A+  +    
Sbjct: 25  ILLGAWADVKHCKNILDMGSGTGLLALMLAQRTEENCQIQAVELDPIAAKQAQDNI---N 81

Query: 60  NAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVM 119
           N+    RI LI+ D+      ++        +D ++ NPP+ E+ G    ++ +E A   
Sbjct: 82  NSVWKNRIQLIQTDI------QHFLQPTEQTFDLIVANPPYFEQ-GIACKNEERELARYT 134

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASR 179
            + S   W+  A   +  +G++S +    +   +  + A  +  ++ T +  + G+   R
Sbjct: 135 -KQSHLNWLEWAATRLSENGRISFVLPYDAGKTLTKSTA--LFCIKQTNVITKIGKTPQR 191

Query: 180 ILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFV 212
           +L+T  K  + Q+  +  +V++  + Q    F+
Sbjct: 192 MLLTFAK--QPQVLMQDQLVIYDAHNQYTEAFI 222


>gi|323699539|ref|ZP_08111451.1| methyltransferase small [Desulfovibrio sp. ND132]
 gi|323459471|gb|EGB15336.1| methyltransferase small [Desulfovibrio desulfuricans ND132]
          Length = 253

 Score = 44.3 bits (103), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 51/213 (23%), Positives = 91/213 (42%), Gaps = 23/213 (10%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+  N T      DLG G G   L +  R    ++   E +PL    A +     A+
Sbjct: 34  LLLAAFANVTRGQTGLDLGCGCGVVALGLLLRQPGLRLAGVELNPLSVRAAEENA---AS 90

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTP--DKIKEEAHV 118
              S ++S+I+ DV             +   D V+ NPP+  ++G   P  D+ +  A  
Sbjct: 91  LHFSDKLSIIQGDVA--------DWQPDGVVDFVVANPPYR-KLGKGRPSADEERRAARF 141

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITP-----LHPRE 173
               +F  + R A   +++ G+ + +  P+ L +++   A       +TP     +H + 
Sbjct: 142 EATGTFAAFARCAALALKTRGRFTFVHLPERLAELLADLA----GAGLTPKRMRLVHGKP 197

Query: 174 GECASRILVTGRKGMRGQLRFRYPIVLHKPNGQ 206
            + A  ILV   K     LR   P++LH+  G+
Sbjct: 198 DQEARMILVEAVKAAAQGLRVEPPLILHEGEGK 230


>gi|317473411|ref|ZP_07932705.1| methyltransferase type 11 [Anaerostipes sp. 3_2_56FAA]
 gi|316899061|gb|EFV21081.1| methyltransferase type 11 [Anaerostipes sp. 3_2_56FAA]
          Length = 240

 Score = 44.3 bits (103), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 48/210 (22%), Positives = 96/210 (45%), Gaps = 14/210 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++L+S V    + ++ DLG G G   + + ++         E    MA  A ++ AL   
Sbjct: 25  VLLSSFVKVKKNGNVLDLGTGTGILPILMEAKTPGRHFTGLEIQSEMAEMAARSAALNG- 83

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFN-ERIGTMTPDKIKEEAHVM 119
             + ++I ++E D+T     +  A   ++ +D +  NPP+     G    + +K  A   
Sbjct: 84  --LEEKIEIVEGDIT-----KASAIFSHDSFDVITSNPPYMVHDHGFRNSNDVKAIARHE 136

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE---ITPLHPREGEC 176
           +   F      A  +++ SG L L+ R   L +I+N C    G LE   I  ++P   + 
Sbjct: 137 ILCRFRDISGAARVLLKHSGSLFLVHRSYRLSEILN-CLSNDG-LEPKRIRFVYPYREKE 194

Query: 177 ASRILVTGRKGMRGQLRFRYPIVLHKPNGQ 206
           ++  L+   KG + +++   P+++++  GQ
Sbjct: 195 SNIFLLEAVKGGKSRMKVEPPLIIYEKPGQ 224


>gi|70727465|ref|YP_254381.1| hypothetical protein SH2466 [Staphylococcus haemolyticus JCSC1435]
 gi|68448191|dbj|BAE05775.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435]
          Length = 202

 Score = 44.3 bits (103), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 69/148 (46%), Gaps = 18/148 (12%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           +AD+G G G  GL +A      QI + + +       ++ L L   A+ +K+ +  ++D 
Sbjct: 64  IADVGCGYGPIGLMIAKVSPHHQITMVDVN-------KRALNL---AEKNKKAN--QIDN 111

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAI 134
            ++ E+  L+ LK++ +D+V+ NPP   R G     +I EEA+  L    E ++     I
Sbjct: 112 VIIKESDGLSQLKDSHFDYVLTNPPI--RAGKEVVHRIFEEAYQQLNSQGELYV----VI 165

Query: 135 MRSSGQLSLIARPQSLIQIVNACARRIG 162
            +  G  S   + + +   V    +  G
Sbjct: 166 QKKQGMPSAKKKMEEIFNNVEVVNKNKG 193


>gi|229488227|gb|ACQ73747.1| M.SdaI [Streptomyces diastaticus]
          Length = 486

 Score = 44.3 bits (103), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 72/155 (46%), Gaps = 21/155 (13%)

Query: 2   ILASLV---NATGSFHLADLGAGAGAAGLAVASRLHE------AQILLAERSPLMAHYAR 52
           ++AS++   + +GS  + D GAGAG+   A+  RLH         ++  E  P +  Y R
Sbjct: 38  LMASMLRVDDLSGSVRVLDPGAGAGSLSAALVDRLHTERPDVAVHVVAVETDPFITPYLR 97

Query: 53  KTLALPANAQISKRIS--LIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPD 110
            TL      Q +  IS  L+E D  L+ E   L G     +D VI NPP+  ++ + +P 
Sbjct: 98  ATL---EECQTAYGISYDLVEGDY-LLDEGAELDGP----FDFVIANPPYG-KLASDSPT 148

Query: 111 KIKEEAH-VMLEDSFEKWIRTACAIMRSSGQLSLI 144
           ++      V   + +  +   A A ++  GQ + I
Sbjct: 149 RLATATRAVDTPNVYVAFWARAVASLKKDGQGAFI 183


>gi|313885608|ref|ZP_07819358.1| methyltransferase small domain protein [Eremococcus coleocola
           ACS-139-V-Col8]
 gi|312619338|gb|EFR30777.1| methyltransferase small domain protein [Eremococcus coleocola
           ACS-139-V-Col8]
          Length = 251

 Score = 43.9 bits (102), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 52/203 (25%), Positives = 94/203 (46%), Gaps = 28/203 (13%)

Query: 1   MILASLVNATGS--FHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALP 58
           ++LA  +    S  FH  D  +G G   L +A + H     L  +S L+   AR+++AL 
Sbjct: 39  VLLADFIKLPHSRPFHYIDFCSGNGVIPLLLARKSHSPLTGLEIQSELVD-MARRSVAL- 96

Query: 59  ANAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF-----NERIGTMTPDKI- 112
               +  ++S IE D  L    R L G++   YD V  NPP+     ++ +   +   I 
Sbjct: 97  --NDLGDKVSFIEGD--LKDFTRPL-GIQ---YDIVSCNPPYFIVANSQEVHHQSSHAIA 148

Query: 113 KEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE-ITPLHP 171
           + E  + ++D    W+  A  +MR  G+L ++ RP  L  +     +   ++  +  ++P
Sbjct: 149 RHEILLTMDD----WVLKAKQVMRDRGKLYIVHRPDRLDDLFTTLLKYGFAVNRLRFVYP 204

Query: 172 REGECASRILVT-----GRKGMR 189
           + G  A+ IL+      GR G++
Sbjct: 205 KVGSQANIILIEAIYQGGRHGVK 227


>gi|71909334|ref|YP_286921.1| hypothetical protein Daro_3722 [Dechloromonas aromatica RCB]
 gi|71848955|gb|AAZ48451.1| Conserved hypothetical protein 95 [Dechloromonas aromatica RCB]
          Length = 184

 Score = 43.9 bits (102), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 62/127 (48%), Gaps = 20/127 (15%)

Query: 6   LVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLM---AHYARKTLALPANAQ 62
           L  A   +H  DL AG+GA G   ASR   A++++ E++P +    H   ++L  P+   
Sbjct: 39  LGQALDGWHCLDLFAGSGALGFEAASR-GAARVVMVEQAPKVLAALHENHESLHKPSA-- 95

Query: 63  ISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFN----ERIGTMTPDKIKEEAHV 118
               I +I  D       + LA  K  F D + ++PP+     +R+  + PD + E+A +
Sbjct: 96  ----IEIIRADAI-----QYLASTKAKF-DLIFLDPPYKKGWIDRLEPLLPDVLNEDAAI 145

Query: 119 MLEDSFE 125
            +E  +E
Sbjct: 146 YVEAEYE 152


>gi|161507692|ref|YP_001577648.1| hypothetical protein lhv_1357 [Lactobacillus helveticus DPC 4571]
 gi|160348681|gb|ABX27355.1| hypothetical protein lhv_1357 [Lactobacillus helveticus DPC 4571]
 gi|328465736|gb|EGF36940.1| hypothetical protein AAULH_07876 [Lactobacillus helveticus MTCC
           5463]
          Length = 343

 Score = 43.9 bits (102), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 94/199 (47%), Gaps = 19/199 (9%)

Query: 15  LADLGAGAGAAGLAVA--SRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEV 72
           +ADL AG  AA + +A  +R H   I + +       Y++   ++  N ++  RI++ + 
Sbjct: 50  VADLCAGNCAATIYMAYFNRAHYDAIEIQDEI-----YSQAKRSIELN-RMENRIAVHKD 103

Query: 73  DVTLVGENRNLAGLKNNFYDHVIMNPPFNE--RIGTMTPDKIKEEAHVMLEDSFEKWIRT 130
           +V    +      L+ + YD V +NPP+ +      + PD+ K  A   L  + E+ I  
Sbjct: 104 NVLNAAK-----FLRKDSYDVVTVNPPYFKVPEGHEVNPDRKKAIARHELLINLEQIIEV 158

Query: 131 ACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE-ITPLHPREGECASRILVTGRK--G 187
           A  +++  G++ ++ RP+ L +I   C +   S++ + P     G+ A+ I+V   K  G
Sbjct: 159 ASGLLKMKGKMFMVHRPERLGEICYYCMKHDLSVKLVQPFVSHRGDDANLIIVEAVKHTG 218

Query: 188 MRGQLRFRYPIVLHKPNGQ 206
             G    R  I +H  N +
Sbjct: 219 TDGT-ELRDAIEVHYKNDE 236


>gi|260101376|ref|ZP_05751613.1| conserved hypothetical protein [Lactobacillus helveticus DSM 20075]
 gi|260084828|gb|EEW68948.1| conserved hypothetical protein [Lactobacillus helveticus DSM 20075]
          Length = 343

 Score = 43.9 bits (102), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 94/199 (47%), Gaps = 19/199 (9%)

Query: 15  LADLGAGAGAAGLAVA--SRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEV 72
           +ADL AG  AA + +A  +R H   I + +       Y++   ++  N ++  RI++ + 
Sbjct: 50  VADLCAGNCAATIYMAYFNRAHYDAIEIQDEI-----YSQAKRSIELN-RMENRIAVHKD 103

Query: 73  DVTLVGENRNLAGLKNNFYDHVIMNPPFNE--RIGTMTPDKIKEEAHVMLEDSFEKWIRT 130
           +V    +      L+ + YD V +NPP+ +      + PD+ K  A   L  + E+ I  
Sbjct: 104 NVLNAAK-----FLRKDSYDVVTVNPPYFKVPEGHEVNPDRKKAIARHELLINLEQIIEV 158

Query: 131 ACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE-ITPLHPREGECASRILVTGRK--G 187
           A  +++  G++ ++ RP+ L +I   C +   S++ + P     G+ A+ I+V   K  G
Sbjct: 159 ASGLLKMKGKMFMVHRPERLGEICYYCMKHDLSVKLVQPFVSHRGDDANLIIVEAVKHTG 218

Query: 188 MRGQLRFRYPIVLHKPNGQ 206
             G    R  I +H  N +
Sbjct: 219 TDGT-ELRDAIEVHYKNDE 236


>gi|323466327|gb|ADX70014.1| O-methyltransferase [Lactobacillus helveticus H10]
          Length = 343

 Score = 43.9 bits (102), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 95/199 (47%), Gaps = 19/199 (9%)

Query: 15  LADLGAGAGAAGLAVA--SRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEV 72
           +ADL AG  AA + +A  +R H   I + +    +   A++++ L    ++  RI++ + 
Sbjct: 50  VADLCAGNCAATIYMAYFNRAHYDAIEIQDE---IYSQAKRSIEL---NRMENRIAVHKD 103

Query: 73  DVTLVGENRNLAGLKNNFYDHVIMNPPFNE--RIGTMTPDKIKEEAHVMLEDSFEKWIRT 130
           +V    +      L+ + YD V +NPP+ +      + PD+ K  A   L  + E+ I  
Sbjct: 104 NVLNAAK-----FLRKDSYDVVTVNPPYFKAPEGHEVNPDRKKAIARHELLINLEQIIEV 158

Query: 131 ACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE-ITPLHPREGECASRILVTGRK--G 187
           A  +++  G++ ++ RP+ L +I   C +   S++ + P     G+ A+ I+V   K  G
Sbjct: 159 ASGLLKMKGKMFMVHRPERLGEICYYCMKHDLSVKLVQPFVSHRGDDANLIIVEAVKHTG 218

Query: 188 MRGQLRFRYPIVLHKPNGQ 206
             G    R  I +H  N +
Sbjct: 219 TDGT-ELRDAIEVHYKNDE 236


>gi|325577156|ref|ZP_08147640.1| metallothionein SmtA [Haemophilus parainfluenzae ATCC 33392]
 gi|325160738|gb|EGC72859.1| metallothionein SmtA [Haemophilus parainfluenzae ATCC 33392]
          Length = 232

 Score = 43.9 bits (102), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 47/214 (21%), Positives = 94/214 (43%), Gaps = 18/214 (8%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHE-AQILLAERSPLMAHYARKTL-ALP 58
           ++L +  + +    + D+G G G   L +A R HE  QI   E  PL A  A++   A P
Sbjct: 25  ILLGAWADVSDCQRILDMGTGTGLVALMLAQRSHEYCQIEAIELDPLAAQQAQENFKASP 84

Query: 59  ANAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHV 118
            +     R+ L   DV    +         + YD ++ NPP+  +      D+     +V
Sbjct: 85  WH----NRLHLTHQDVQTYCQK------TAHQYDLIVANPPYFTQGVECKNDERALARYV 134

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECAS 178
             + S   W+  A + +   G++S +   ++   ++N+ A  +  ++ T +  + G+   
Sbjct: 135 --QQSHLDWLNWAASCLSEKGKISFVLPYEAGKTLINSTA--LYCIKQTDVITKIGKDPQ 190

Query: 179 RILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFV 212
           R+L+T  +    Q++    +V++  N Q    F+
Sbjct: 191 RMLLTFSRENLPQVKD--SLVIYDENNQYTEAFI 222


>gi|119775873|ref|YP_928613.1| hypothetical protein Sama_2741 [Shewanella amazonensis SB2B]
 gi|119768373|gb|ABM00944.1| conserved hypothetical protein [Shewanella amazonensis SB2B]
          Length = 247

 Score = 43.9 bits (102), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 47/102 (46%), Gaps = 10/102 (9%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++L +  N  G+  + DLGAG+G   L  A R  +A I   E  P+ A   R      + 
Sbjct: 38  VLLGAWANLDGADAVLDLGAGSGLLALMAAQRC-KAPITAIEIDPVAASACRSNF---SA 93

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNE 102
           +    RI+LIE D T      +   L    + H++ NPP+ E
Sbjct: 94  SPWPDRINLIEADAT------DAEALAGKVFTHILCNPPYFE 129


>gi|218895170|ref|YP_002443581.1| hypothetical protein BCG9842_B5277 [Bacillus cereus G9842]
 gi|218542779|gb|ACK95173.1| conserved hypothetical protein [Bacillus cereus G9842]
          Length = 246

 Score = 43.5 bits (101), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 36/162 (22%), Positives = 79/162 (48%), Gaps = 11/162 (6%)

Query: 63  ISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLED 122
           + +RI LI  D+  + E      L  + YD V  NPP+ +   T +   + E   +   +
Sbjct: 92  LEERIHLIHGDLKDMPEK-----LGRHQYDVVTCNPPYFQTPQT-SEKNMNEHLAIARHE 145

Query: 123 ---SFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECAS 178
              + E  +  +  +++  G+++ + RP  L+ IV    + RI    +  ++P+ G+ A+
Sbjct: 146 IMCTLEDVVSASSQLVKQGGKVAFVHRPGRLLDIVTLMRKYRIEPKRVRFVYPKVGKEAN 205

Query: 179 RILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKR 220
            +L+ G K     L+   P+V+++ N + Y++ +  ++ G+ 
Sbjct: 206 TLLIEGIKDGNADLKILPPLVVYENNNE-YTKEIRSILYGEE 246


>gi|289164839|ref|YP_003454977.1| hypothetical protein LLO_1505 [Legionella longbeachae NSW150]
 gi|288858012|emb|CBJ11872.1| hypothetical protein LLO_1505 [Legionella longbeachae NSW150]
          Length = 219

 Score = 43.5 bits (101), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 56/139 (40%), Gaps = 9/139 (6%)

Query: 11  GSFHLADLGAGAGAAGLAVASRLHEA-QILLAERSPLMAHYARKTLALPANAQISKRISL 69
           GS  + DL AG G  G+ ++  L    QI   E   +   Y  +  A  +  ++  R  L
Sbjct: 47  GSLRVLDLCAGCGVIGMELSWHLPAIRQIDFIEIQDIYTEYFYQNQANISRPELQFRWHL 106

Query: 70  IEVDVTLVGENRNLAGLKNNFYDHVIMNPP-FNERIGTMTPDKIKEEAHVMLEDSFEKWI 128
           +  D       +   G     +D  I NPP F    G ++P + K      L+ SF  +I
Sbjct: 107 LNYDAL---HEKKWEGK----FDMTISNPPYFQAGHGMLSPSQFKNRCRFYLDSSFHNYI 159

Query: 129 RTACAIMRSSGQLSLIARP 147
           R     + + G+   + RP
Sbjct: 160 RALENSLANKGKAYFLLRP 178


>gi|319775650|ref|YP_004138138.1| O-methyltransferase [Haemophilus influenzae F3047]
 gi|329122298|ref|ZP_08250886.1| metallothionein SmtA [Haemophilus aegyptius ATCC 11116]
 gi|317450241|emb|CBY86457.1| predicted O-methyltransferase [Haemophilus influenzae F3047]
 gi|327473859|gb|EGF19276.1| metallothionein SmtA [Haemophilus aegyptius ATCC 11116]
          Length = 232

 Score = 43.5 bits (101), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 43/213 (20%), Positives = 97/213 (45%), Gaps = 16/213 (7%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHE-AQILLAERSPLMAHYARKTLALPA 59
           ++L +  +     ++ D+G G G   L +A R  E  QI   E  P+ A  A++ +    
Sbjct: 25  ILLGAWADVKHCKNILDMGCGTGLLALMLAQRTEENCQIQAVELDPIAAKQAQENI---N 81

Query: 60  NAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVM 119
           N+    RI L + D+      ++        +D ++ NPP+ E+ G    ++ +E A   
Sbjct: 82  NSVWKNRIQLTQADI------QHFLQTTEQTFDLIVANPPYFEQ-GIACKNEERELARYT 134

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASR 179
            + S   W+  A   +  +G++S +   ++   ++ + A  +  ++ T +  + G+   R
Sbjct: 135 -KQSHLNWLEWAAIRLSENGRISFVLPYEAGKTLIKSTA--LFCIKQTNVITKIGKTPQR 191

Query: 180 ILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFV 212
           +L+T  K  + ++  +  +V++  + Q    F+
Sbjct: 192 MLLTFAK--QPEVLMQDQLVIYDADNQYTEAFI 222


>gi|237738115|ref|ZP_04568596.1| methyltransferase [Fusobacterium mortiferum ATCC 9817]
 gi|229419995|gb|EEO35042.1| methyltransferase [Fusobacterium mortiferum ATCC 9817]
          Length = 245

 Score = 43.5 bits (101), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 48/210 (22%), Positives = 92/210 (43%), Gaps = 20/210 (9%)

Query: 14  HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVD 73
           ++ DLG G G   L ++ +  +A+I   E   + +  A++ + L     + ++I +I  D
Sbjct: 48  NIIDLGTGNGVIPLFLSKKT-KAKITGIEIQSISSALAKRNIEL---NNLQEQIEIINDD 103

Query: 74  VTLVGENRNLAGLKNNFYDHVIMNPPF----NERIGTMTPDKIKEEAHVMLEDSFEKWIR 129
           +    +N N    +  ++D V+ NPPF     E       D++    H  +  +    I 
Sbjct: 104 M----KNWN-KYFRKGYFDLVVTNPPFFRFHGEEKQLNDLDQLSLARH-EISINLNSLIE 157

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE---ITPLHPREGECASRILVTGRK 186
           TA  +++  G   ++ R   LI I+    +   SLE   I   + +  +    +L+ G K
Sbjct: 158 TASNLLKDKGYFVMVHRVDRLIDIIETMKKY--SLEPKRIQFCYTKLEKEGKILLIEGVK 215

Query: 187 GMRGQLRFRYPIVLHKPNGQPYSRFVTDLI 216
                LR   P++ H  +G  YS+ V ++ 
Sbjct: 216 NGNSGLRVLSPLIAHDDDGN-YSKVVLEMF 244


>gi|262831256|sp|A1S987|TRMN6_SHEAM RecName: Full=tRNA (adenine-N(6)-)-methyltransferase; AltName:
           Full=tRNA m6A37 methyltransferase
          Length = 233

 Score = 43.5 bits (101), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 47/102 (46%), Gaps = 10/102 (9%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++L +  N  G+  + DLGAG+G   L  A R  +A I   E  P+ A   R      + 
Sbjct: 24  VLLGAWANLDGADAVLDLGAGSGLLALMAAQRC-KAPITAIEIDPVAASACRSNF---SA 79

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNE 102
           +    RI+LIE D T      +   L    + H++ NPP+ E
Sbjct: 80  SPWPDRINLIEADAT------DAEALAGKVFTHILCNPPYFE 115


>gi|312194935|ref|YP_004014996.1| methyltransferase [Frankia sp. EuI1c]
 gi|311226271|gb|ADP79126.1| methyltransferase [Frankia sp. EuI1c]
          Length = 185

 Score = 43.5 bits (101), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 46/98 (46%), Gaps = 11/98 (11%)

Query: 3   LASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQ 62
           LASLV+  G+  +ADL AG+GA GL   SR   A  LL ER P  A   R+  A      
Sbjct: 37  LASLVDLDGA-RVADLYAGSGAVGLEALSR-GAAHALLVERDPKAAQVVRRNAA------ 88

Query: 63  ISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF 100
               + L   ++ +    R +       YD V ++PP+
Sbjct: 89  ---ELGLAGAEIVVGAVERVVDATPGQAYDVVFLDPPY 123


>gi|332798043|ref|YP_004459542.1| methyltransferase small [Tepidanaerobacter sp. Re1]
 gi|332695778|gb|AEE90235.1| methyltransferase small [Tepidanaerobacter sp. Re1]
          Length = 251

 Score = 43.1 bits (100), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 45/228 (19%), Positives = 106/228 (46%), Gaps = 23/228 (10%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+ + A  +  + D+G G+G   L ++++    +I+  E   +   + R    +  N
Sbjct: 36  VLLANFIKADKNDRVIDIGTGSGVIALLLSAKTDAKEIVGIE--IVGEAFDRAVRNVKMN 93

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF---NERIGTMTPDKIKEEAH 117
            ++ +R+ ++  D+    E   + G ++  +  V+ NPP+   NE  G ++P+     A 
Sbjct: 94  -RLEERVKIVHGDLK---EAVKIFGRES--FSVVVTNPPYMMINE--GKISPNPSIAVAR 145

Query: 118 VMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITP-----LHPR 172
             +  + E   + +  ++   G   ++ R   L+ ++     ++ SL + P     +HP+
Sbjct: 146 HEVAATLEDVAKVSWQLLSFGGCFYMVYRTVRLVDVI----YKMRSLGLEPKILRFIHPK 201

Query: 173 EGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKR 220
                +  L+  +KG  G ++   P+V++  +G  Y+  +  +  GKR
Sbjct: 202 AQAGPNLFLMMAKKGASGGIKILPPLVVYNSDGS-YTDEIKQIYFGKR 248


>gi|310778320|ref|YP_003966653.1| methyltransferase small [Ilyobacter polytropus DSM 2926]
 gi|309747643|gb|ADO82305.1| methyltransferase small [Ilyobacter polytropus DSM 2926]
          Length = 224

 Score = 43.1 bits (100), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 46/205 (22%), Positives = 85/205 (41%), Gaps = 17/205 (8%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           +ILA          L ++G G G   + ++ R    +I   E    MA  A + +     
Sbjct: 32  VILADFFKGKKLGKLLEIGTGTGIISILLSDREEIEKITALEVQAEMAELAERNVK---R 88

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIG---TMTPDKIKEEAH 117
             + KRI ++  DV  +      AG   N YD+VI NPP+    G    +  +K      
Sbjct: 89  NSLEKRIEVVLGDVKEMK-----AG---NVYDYVISNPPYMPLDGKKINLHDNKALSRHE 140

Query: 118 VMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE-ITPLHPREGEC 176
           + L  + E+ I+ A  +++  GQ  ++ R     +I     R   S++ +  ++      
Sbjct: 141 INL--NLEELIKNAKRLLKPRGQFFMVHRTYRFAEISTVLEREGFSIKRVRFVYSDHKSS 198

Query: 177 ASRILVTGRKGMRGQLRFRYPIVLH 201
           ++ +L+   KG +  L    P+ L+
Sbjct: 199 SNLVLIEASKGRKEILEVEKPLYLN 223


>gi|47459066|ref|YP_015928.1| O-methyltransferase putative nucleic acid modification enzyme
           [Mycoplasma mobile 163K]
 gi|47458395|gb|AAT27717.1| O-methyltransferase putative nucleic acid modification enzyme
           [Mycoplasma mobile 163K]
          Length = 257

 Score = 43.1 bits (100), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 41/196 (20%), Positives = 79/196 (40%), Gaps = 10/196 (5%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + ++G    A  + V+ R    +I   E      H A   + + +  +   +IS+I  + 
Sbjct: 51  ILEIGTNNAALAIFVSERNKNIKIDAIELQKKAIHLANFNVIMNSKEE---QISIIHANF 107

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLED---SFEKWIRTA 131
               +  N    K   YD +I NPPF  +IG      + +E  +   D   +F++ I+ A
Sbjct: 108 NSFWKKHNKNQAKK--YDSIICNPPF-YQIGKRQLKNVSKEKLIATYDLKLNFDQLIKGA 164

Query: 132 CAIMRSSGQLSLIARPQSLIQIVNACARR-IGSLEITPLHPREGECASRILVTGRKGMRG 190
             I++  G  S++   +  I       +      ++  +HPR  + ++ +L+  R     
Sbjct: 165 SKIIKQKGYFSVVIPTERSIDFFTILRKYDFEPKKVQFIHPRINQKSNLVLIESRYKTGW 224

Query: 191 QLRFRYPIVLHKPNGQ 206
              F   I LH  + Q
Sbjct: 225 GTNFLENIYLHPEDEQ 240


>gi|326336150|ref|ZP_08202322.1| SAM-dependent methyltransferase [Capnocytophaga sp. oral taxon 338
           str. F0234]
 gi|325691659|gb|EGD33626.1| SAM-dependent methyltransferase [Capnocytophaga sp. oral taxon 338
           str. F0234]
          Length = 234

 Score = 43.1 bits (100), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 62/131 (47%), Gaps = 12/131 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + D+GAG G   L +A R   A I   E +P      R+ ++L   +    RIS+ + D+
Sbjct: 37  ILDIGAGTGILSLMMAQRFPTACIHAIEITPEATQECRENISL---SPWKDRISVYQEDI 93

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPP-FNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACA 133
                 R  + +  + YD +I NPP F E++  ++P+  +  +   LE  FE+ +     
Sbjct: 94  ------RIFSKVDKHKYDLIISNPPFFTEKV--LSPNFQRSLSRSNLELPFEELLYCVSQ 145

Query: 134 IMRSSGQLSLI 144
           ++   G  ++I
Sbjct: 146 LLSPIGTFAVI 156


>gi|309792621|ref|ZP_07687082.1| modification methylase, HemK family [Oscillochloris trichoides DG6]
 gi|308225343|gb|EFO79110.1| modification methylase, HemK family [Oscillochloris trichoides DG6]
          Length = 274

 Score = 43.1 bits (100), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 70/149 (46%), Gaps = 26/149 (17%)

Query: 3   LASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQ 62
           LA L +   ++ +ADLG G+GA  +A+  +L  AQI   + S      A       AN Q
Sbjct: 98  LAGLGDRQAAWRIADLGTGSGAIAVALGLQLPHAQIEAVDLS------ADALEVAAANVQ 151

Query: 63  ---ISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVM 119
              +S+R+ L++ D+        LAG     YD ++ NPP+   +  + P+ +  E H+ 
Sbjct: 152 RHALSERVRLMQGDLC-----APLAG----HYDLIVSNPPYT-ILAEVEPNVLAHEPHLA 201

Query: 120 LE-------DSFEKWIRTACAIMRSSGQL 141
           LE       D + +   TA   +R+ G +
Sbjct: 202 LEGGGADGADFYRRIFATAPQHLRAGGAI 230


>gi|83645219|ref|YP_433654.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Hahella chejuensis KCTC 2396]
 gi|83633262|gb|ABC29229.1| Methylase of polypeptide chain release factors [Hahella chejuensis
           KCTC 2396]
          Length = 301

 Score = 43.1 bits (100), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 52/102 (50%), Gaps = 18/102 (17%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV-- 74
           DL  G+G  G+A A    EA+++LA+ SPL    AR+ +   A   +  R  ++E D+  
Sbjct: 135 DLCCGSGCIGIAAAHVFPEAEVVLADISPLALDVARRNV---ARHHLGDRCKVVESDMFD 191

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNER--IGTMTPDKIKE 114
            L GE           +D ++ NPP+ ++  + ++ P+ + E
Sbjct: 192 ALQGE-----------FDVILTNPPYVDKPDMDSLPPEYLHE 222


>gi|291458687|ref|ZP_06598077.1| putative N-6 adenine-specific DNA methylase [Oribacterium sp. oral
           taxon 078 str. F0262]
 gi|291418604|gb|EFE92323.1| putative N-6 adenine-specific DNA methylase [Oribacterium sp. oral
           taxon 078 str. F0262]
          Length = 243

 Score = 43.1 bits (100), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 96/209 (45%), Gaps = 15/209 (7%)

Query: 14  HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVD 73
            L DLG G G   L ++++    ++   E     A  A ++ AL  N Q   RI ++  D
Sbjct: 44  QLLDLGTGTGVIPLLLSAKTKARRLYGLEIQKSAADLAERSAAL--NGQ-EGRIQILRGD 100

Query: 74  VTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACA 133
           +  +   R+     ++  D V+ NPP+  + G  +  + ++ A   +  SF      A  
Sbjct: 101 IRRI---RDFP--LSSRMDLVLSNPPYL-KSGIRSKGEGRQIARHEILCSFRDVAVAASY 154

Query: 134 IMRSSGQLSLIARPQSLIQIVNACARRIGSLE---ITPLHPREGECASRILVTGRKGMRG 190
           ++++SG+  L+ R + L  IV+    R   LE   +  +H R G  A  +L+   KG R 
Sbjct: 155 LLKASGRFFLVHRAERLTDIVSDL--RESGLEPKRLRMVHSRAGREAKLLLLEAVKGGRP 212

Query: 191 QLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
           QL    P+++++  G  Y+  +  L  G+
Sbjct: 213 QLHVEPPLIVYEEGG-VYTEELLSLYRGE 240


>gi|256828516|ref|YP_003157244.1| methyltransferase small [Desulfomicrobium baculatum DSM 4028]
 gi|256577692|gb|ACU88828.1| methyltransferase small [Desulfomicrobium baculatum DSM 4028]
          Length = 268

 Score = 43.1 bits (100), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 43/191 (22%), Positives = 80/191 (41%), Gaps = 11/191 (5%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DLG G G  GL +A    +   +  + +P M  +AR+          ++R +L+  D   
Sbjct: 48  DLGTGCGVVGLGLALDHPDFFGIGLDLNPDMLCHAREN---ACRLGFAERFALLRADAC- 103

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNE-RIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIM 135
                   G      D V+ NPP+ +   G + PD  +  A        + ++R A  ++
Sbjct: 104 -----GPWGFAPESMDLVLSNPPYRDPGRGRICPDAARTLARFERRAELKDFVRAAAYLL 158

Query: 136 RSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRF 194
           R+      I   + + ++++   A R+   E+  +H R+   A  +LV   K     L  
Sbjct: 159 RNRKSCVFIHLAERVDELLDLLRASRLQPKEVLFVHQRQDTTARLVLVRSLKNGGPGLTV 218

Query: 195 RYPIVLHKPNG 205
           + P++LH+  G
Sbjct: 219 QPPLILHEGRG 229


>gi|167856203|ref|ZP_02478939.1| hypothetical protein HPS_02890 [Haemophilus parasuis 29755]
 gi|167852658|gb|EDS23936.1| hypothetical protein HPS_02890 [Haemophilus parasuis 29755]
          Length = 235

 Score = 43.1 bits (100), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 34/147 (23%), Positives = 68/147 (46%), Gaps = 19/147 (12%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++L S+ + + + H+ DLG G G   + +A R   AQI   E      H A++      N
Sbjct: 25  ILLGSIADPSNARHILDLGTGTGLIAIMLAQRTASAQITALELEENAFHQAQE------N 78

Query: 61  AQ---ISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAH 117
           AQ    + RI +++ ++      +         +D ++ NPP+ E     + +K ++ A 
Sbjct: 79  AQHCPWNNRIDVLQANIMTWKSTKK--------FDLIVSNPPYFEH-SLASRNKQRDLAR 129

Query: 118 VMLEDSFEKWIRTACAIMRSSGQLSLI 144
            +    F+ W++ A   +  +G++S I
Sbjct: 130 AVTYSHFD-WLKRAQQWLTPNGRISFI 155


>gi|295425175|ref|ZP_06817878.1| conserved hypothetical protein [Lactobacillus amylolyticus DSM
           11664]
 gi|295064951|gb|EFG55856.1| conserved hypothetical protein [Lactobacillus amylolyticus DSM
           11664]
          Length = 343

 Score = 43.1 bits (100), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 63/126 (50%), Gaps = 6/126 (4%)

Query: 86  LKNNFYDHVIMNPPFNE--RIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSL 143
           L+ + YD V +NPP+ +  +   + PD+ K  A   +  + E+ I  A  +++  G++ +
Sbjct: 112 LRKDSYDVVTVNPPYFKVPKGHEVNPDRKKAIARHEILINLEQIIEVASGLLKMKGKMFM 171

Query: 144 IARPQSLIQIVNACARRIGSLE-ITPLHPREGECASRILVTGRK--GMRGQLRFRYPIVL 200
           + RP+ L +I   C +   S++ + P     GE A+ I+V   K     G +  +  I +
Sbjct: 172 VHRPERLGEICYYCMKHDMSVKMVQPFVSHRGEDANLIIVEAVKHTATDGTV-IKDAIEV 230

Query: 201 HKPNGQ 206
           H  NG+
Sbjct: 231 HDQNGE 236


>gi|270156714|ref|ZP_06185371.1| conserved hypothetical protein [Legionella longbeachae D-4968]
 gi|269988739|gb|EEZ94993.1| conserved hypothetical protein [Legionella longbeachae D-4968]
          Length = 248

 Score = 43.1 bits (100), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 56/139 (40%), Gaps = 9/139 (6%)

Query: 11  GSFHLADLGAGAGAAGLAVASRLHEA-QILLAERSPLMAHYARKTLALPANAQISKRISL 69
           GS  + DL AG G  G+ ++  L    QI   E   +   Y  +  A  +  ++  R  L
Sbjct: 47  GSLRVLDLCAGCGVIGMELSWHLPAIRQIDFIEIQDIYTEYFYQNQANISRPELQFRWHL 106

Query: 70  IEVDVTLVGENRNLAGLKNNFYDHVIMNPP-FNERIGTMTPDKIKEEAHVMLEDSFEKWI 128
           +  D       +   G     +D  I NPP F    G ++P + K      L+ SF  +I
Sbjct: 107 LNYDAL---HEKKWEGK----FDMTISNPPYFQAGHGMLSPSQFKNRCRFYLDSSFHNYI 159

Query: 129 RTACAIMRSSGQLSLIARP 147
           R     + + G+   + RP
Sbjct: 160 RALENSLANKGKAYFLLRP 178


>gi|150020231|ref|YP_001305585.1| O-methyltransferase-like protein [Thermosipho melanesiensis BI429]
 gi|149792752|gb|ABR30200.1| O-methyltransferase-like protein [Thermosipho melanesiensis BI429]
          Length = 217

 Score = 42.7 bits (99), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 41/196 (20%), Positives = 79/196 (40%), Gaps = 34/196 (17%)

Query: 16  ADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV- 74
            +LG G G     +  + +  +++  E    +   A+K + L      SK++S   +DV 
Sbjct: 46  CELGTGTGFVSFGL-EKYYSLEVVGVEVIKELYTNAKKAIELNN----SKKVSFFNIDVR 100

Query: 75  ----TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRT 130
                 V EN          +D V+ NPPF+    + +  KI+E +     +  E +++ 
Sbjct: 101 EIKKQFVAEN----------FDMVVFNPPFH--FSSSSNKKIREISRKASNELLESFVKA 148

Query: 131 ACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPRE-----GECASRILVTGR 185
           A  ++R+ G    I  P  L       ++         L+P++     G+    +L+ G+
Sbjct: 149 ASYLLRNKGTFVTIISPYILSVYFTILSK-------NKLNPQQMCIAYGKKGKLVLLRGK 201

Query: 186 KGMRGQLRFRYPIVLH 201
           K     L    P+ L+
Sbjct: 202 KNGGIHLEIDLPVFLY 217


>gi|77361168|ref|YP_340743.1| ribosomal RNA small subunit methyltransferase D [Pseudoalteromonas
           haloplanktis TAC125]
 gi|123588435|sp|Q3IHQ6|RLMG_PSEHT RecName: Full=Ribosomal RNA large subunit methyltransferase G;
           AltName: Full=23S rRNA m2G1835 methyltransferase;
           AltName: Full=rRNA (guanine-N(2)-)-methyltransferase
           rlmG
 gi|76876079|emb|CAI87301.1| Putative ribosomal RNA small subunit methyltransferase D (rRNA
           (guanine-N(2)-)-methyltransferase) (16S rRNA m2G966
           methyltransferase) [Pseudoalteromonas haloplanktis
           TAC125]
          Length = 382

 Score = 42.7 bits (99), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 40/86 (46%), Gaps = 9/86 (10%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DLG G G  GL   SR   A I   + S +    AR  + L   A+  ++ S +E D   
Sbjct: 238 DLGCGNGVVGLMALSRCPNANITFVDESYMAVESARLNVELNMEAKY-EQCSFVENDC-- 294

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNE 102
                 L+G + +  D V+ NPPF++
Sbjct: 295 ------LSGFERDSVDMVLCNPPFHQ 314


>gi|171920991|ref|ZP_02932113.1| DNA methylase [Ureaplasma urealyticum serovar 13 str. ATCC 33698]
 gi|185179168|ref|ZP_02964875.1| DNA methylase [Ureaplasma urealyticum serovar 5 str. ATCC 27817]
 gi|188024280|ref|ZP_02996973.1| DNA methylase [Ureaplasma urealyticum serovar 7 str. ATCC 27819]
 gi|188518633|ref|ZP_03004075.1| dna methylase [Ureaplasma urealyticum serovar 11 str. ATCC 33695]
 gi|188524483|ref|ZP_03004489.1| DNA methylase [Ureaplasma urealyticum serovar 12 str. ATCC 33696]
 gi|195867632|ref|ZP_03079634.1| DNA methylase [Ureaplasma urealyticum serovar 9 str. ATCC 33175]
 gi|198273616|ref|ZP_03206151.1| DNA methylase [Ureaplasma urealyticum serovar 4 str. ATCC 27816]
 gi|209554372|ref|YP_002284703.1| DNA methylase [Ureaplasma urealyticum serovar 10 str. ATCC 33699]
 gi|225551340|ref|ZP_03772286.1| methyltransferase family protein [Ureaplasma urealyticum serovar 8
           str. ATCC 27618]
 gi|171903022|gb|EDT49311.1| DNA methylase [Ureaplasma urealyticum serovar 13 str. ATCC 33698]
 gi|184208902|gb|EDU05945.1| DNA methylase [Ureaplasma urealyticum serovar 5 str. ATCC 27817]
 gi|188018950|gb|EDU56990.1| DNA methylase [Ureaplasma urealyticum serovar 7 str. ATCC 27819]
 gi|188997793|gb|EDU66890.1| dna methylase [Ureaplasma urealyticum serovar 11 str. ATCC 33695]
 gi|195659566|gb|EDX52946.1| DNA methylase [Ureaplasma urealyticum serovar 12 str. ATCC 33696]
 gi|195660689|gb|EDX53944.1| DNA methylase [Ureaplasma urealyticum serovar 9 str. ATCC 33175]
 gi|198249644|gb|EDY74425.1| DNA methylase [Ureaplasma urealyticum serovar 4 str. ATCC 27816]
 gi|209541873|gb|ACI60102.1| DNA methylase [Ureaplasma urealyticum serovar 10 str. ATCC 33699]
 gi|225379155|gb|EEH01520.1| methyltransferase family protein [Ureaplasma urealyticum serovar 8
           str. ATCC 27618]
          Length = 262

 Score = 42.7 bits (99), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 45/210 (21%), Positives = 93/210 (44%), Gaps = 9/210 (4%)

Query: 1   MILASLVN-ATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPA 59
           ++LA+ ++ ++ +  + ++G    A  + +ASR  +  I   E        A   L +  
Sbjct: 32  VLLANFISLSSKTKKVLEIGTNNAALSIFLASRKEDMNIDAIEIQSEAIDLA--LLNVKE 89

Query: 60  NAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF--NERIGTMTPDKIKEEAH 117
           N  + K+I++I  D       +    ++NN YD +I NPPF   ++I   T   +K  A 
Sbjct: 90  N-HLEKQINIIHADFNEYW--KTFDKIENNKYDAIICNPPFYKQDKIIPSTKKPLKTLAL 146

Query: 118 VMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGEC 176
             +  +FE+ ++    I++    L+++     L+ ++    + +     I  ++PR  E 
Sbjct: 147 YEIALNFEQIMQGCAKIIKQKANLAMVIPTTRLVDLLEMMRKYQFEPKRIKMIYPRIYEQ 206

Query: 177 ASRILVTGRKGMRGQLRFRYPIVLHKPNGQ 206
           ++ +LV  R        F   + LH  + Q
Sbjct: 207 SNLVLVEARYKTGWGTHFEPNLYLHYEDKQ 236


>gi|300770016|ref|ZP_07079895.1| methyltransferase [Sphingobacterium spiritivorum ATCC 33861]
 gi|300762492|gb|EFK59309.1| methyltransferase [Sphingobacterium spiritivorum ATCC 33861]
          Length = 236

 Score = 42.7 bits (99), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 49/212 (23%), Positives = 86/212 (40%), Gaps = 13/212 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+      + H+ D+G G G   L +A R   A +   E   L A  A++      N
Sbjct: 26  VLLAATTADIPAAHILDIGTGTGVIALMLAQRFENAILEAVEIDALAADRAKQNF---LN 82

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
           +  S+R+    V         +L  +    YD +I NPPF        PD  K+ A    
Sbjct: 83  SPFSERMYAQHVSF------EDLHPVSK--YDLIISNPPFYTD-SLHNPDNRKKTARHAD 133

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVN-ACARRIGSLEITPLHPREGECASR 179
              FE+    A   +   G L LI  P+   Q+ + A  + + +  +  +   +     R
Sbjct: 134 LPFFERLFDFAGRHLMEEGLLRLILPPELAGQLQDIATTQELIAEHVIAVQSYKDSPVFR 193

Query: 180 ILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRF 211
            ++T RKG +  L     +++++  G    R+
Sbjct: 194 KMITWRKGGKKDLMTEELLIIYECKGVYSDRY 225


>gi|13357865|ref|NP_078139.1| hypothetical protein UU305 [Ureaplasma parvum serovar 3 str. ATCC
           700970]
 gi|170762270|ref|YP_001752387.1| DNA methylase [Ureaplasma parvum serovar 3 str. ATCC 27815]
 gi|183508738|ref|ZP_02690176.2| DNA methylase [Ureaplasma parvum serovar 14 str. ATCC 33697]
 gi|186701777|ref|ZP_02554147.2| DNA methylase [Ureaplasma parvum serovar 6 str. ATCC 27818]
 gi|11356794|pir||H82906 conserved hypothetical UU305 [imported] - Ureaplasma urealyticum
 gi|6899281|gb|AAF30714.1|AE002128_2 conserved hypothetical [Ureaplasma parvum serovar 3 str. ATCC
           700970]
 gi|168827847|gb|ACA33109.1| dna methylase [Ureaplasma parvum serovar 3 str. ATCC 27815]
 gi|182675667|gb|EDT87572.1| DNA methylase [Ureaplasma parvum serovar 14 str. ATCC 33697]
 gi|186701053|gb|EDU19335.1| DNA methylase [Ureaplasma parvum serovar 6 str. ATCC 27818]
          Length = 255

 Score = 42.7 bits (99), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 45/228 (19%), Positives = 104/228 (45%), Gaps = 14/228 (6%)

Query: 1   MILASLVN-ATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPA 59
           ++LA+ ++ ++ +  + ++G    A  + +A R  + +I       +        LAL  
Sbjct: 32  ILLANFISLSSKTKKILEIGTNNAALSIFLALRKEDIKI-----DAIEIQIEAINLALLN 86

Query: 60  NAQ--ISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF--NERIGTMTPDKIKEE 115
            +Q    K+I++I  D       ++    +NN YD +I NPPF   ++I   T + +K  
Sbjct: 87  VSQNHFEKQINIIHADFNQYW--KDFDKSENNKYDAIICNPPFYKQDKIIPSTKNPLKTL 144

Query: 116 AHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREG 174
           A   +  +FE+ ++    I++  G L+++     L+ ++    + +     I  ++PR  
Sbjct: 145 ALYEITLNFEQIMQGCAKIIKQKGNLAMVIPTTRLVDLLEIMRKYQFEPKRIKMIYPRIY 204

Query: 175 ECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSL 222
           E ++ +L+  R        F   + LH  + Q + ++  +++N  + +
Sbjct: 205 EQSNLVLIEARYKSGWGTHFEPNLYLHYEDKQNH-QYTEEVLNWYKPI 251


>gi|160893394|ref|ZP_02074180.1| hypothetical protein CLOL250_00944 [Clostridium sp. L2-50]
 gi|156864969|gb|EDO58400.1| hypothetical protein CLOL250_00944 [Clostridium sp. L2-50]
          Length = 251

 Score = 42.7 bits (99), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 49/224 (21%), Positives = 94/224 (41%), Gaps = 14/224 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRL---HEAQILLAERSPLMAHYARKTLAL 57
           ++LA+ V         DLG G G   + +A++       Q +  E     A  A K++ L
Sbjct: 34  VLLANFVKHRRDGMYMDLGTGTGVIPILLAAKEPPDGTCQFVGLEIQDACAEMAGKSVRL 93

Query: 58  PANAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF-NERIGTMTPDKIKEEA 116
                + +++ +   D+  V  N   A      +D V  NPP+ +   G   PD+ K  A
Sbjct: 94  ---NDLEQKVRIDHGDIREVSCNYRKAS-----FDIVTSNPPYISGNHGLTNPDEPKNIA 145

Query: 117 HVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGE 175
              +  +    I  A  +++  G   +I +P  L +I     A  +    +  +HP   +
Sbjct: 146 RHEICVTLSDVIEAAAYLLKPGGSFYMIHKPFRLAEIFEGLLANGLEPKRMQLIHPYIDK 205

Query: 176 CASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
             + ++V G KG   +++   P++++K  G  Y+  + D   G+
Sbjct: 206 EPNMVIVEGVKGGNSRIKIEPPLIVYKEPGV-YTEQLLDTYEGE 248


>gi|260582312|ref|ZP_05850105.1| O-methyltransferase [Haemophilus influenzae NT127]
 gi|260094680|gb|EEW78575.1| O-methyltransferase [Haemophilus influenzae NT127]
          Length = 240

 Score = 42.7 bits (99), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 44/214 (20%), Positives = 98/214 (45%), Gaps = 18/214 (8%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHE-AQILLAERSPLMAHYARKTLALPA 59
           ++L +  +     ++ D+G+G G   L +A R  E  QI   E  P+    A++ +    
Sbjct: 33  ILLGAWADVKHCKNILDMGSGTGLLALMLAQRTEENCQIQAVELDPIAVKQAQENI---- 88

Query: 60  NAQISK-RISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHV 118
           N  + K RI LI+ D+      ++        +D ++ NPP+ E+ G    ++ +E A  
Sbjct: 89  NDSVWKNRIQLIQTDI------QHFLQTTAQTFDLIVANPPYFEQ-GIACKNEERELARY 141

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECAS 178
             + S   W+  A   +  +G++S +   ++   +  + A  +  ++ T +  + G+   
Sbjct: 142 T-KQSHLNWLEWAATHLSENGKISFVLPYEAGKTLTKSTA--LFCIKQTNVITKMGKTPQ 198

Query: 179 RILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFV 212
           R+L+T  K  + ++  +  +V++  + Q    F+
Sbjct: 199 RMLLTFAK--QPEVLMQDQLVIYDADNQYTEAFI 230


>gi|228950583|ref|ZP_04112718.1| hypothetical protein bthur0006_240 [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
 gi|228809058|gb|EEM55542.1| hypothetical protein bthur0006_240 [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
          Length = 246

 Score = 42.7 bits (99), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 35/162 (21%), Positives = 79/162 (48%), Gaps = 11/162 (6%)

Query: 63  ISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLED 122
           + +RI LI  D+  + E      L  + YD V  NPP+ +   T +   + E   +   +
Sbjct: 92  LEERIHLIHGDLKDMPEK-----LGRHQYDVVTCNPPYFQTPQT-SEKNMNEHLAIARHE 145

Query: 123 ---SFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECAS 178
              + E  +  +  +++  G+++ + RP  L+ IV    + +I    +  ++P+ G+ A+
Sbjct: 146 IMCTLEDVVSVSSQLVKQGGKVAFVHRPGRLLDIVTLMRKYKIEPKRVQFVYPKVGKEAN 205

Query: 179 RILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKR 220
            +L+ G K     L+   P+V+++ N + Y++ +  ++ G+ 
Sbjct: 206 TLLIEGIKDGNADLKILPPLVVYESNNE-YTKELRSILYGEE 246


>gi|119509583|ref|ZP_01628730.1| protoporphyrinogen oxidase [Nodularia spumigena CCY9414]
 gi|119465772|gb|EAW46662.1| protoporphyrinogen oxidase [Nodularia spumigena CCY9414]
          Length = 304

 Score = 42.4 bits (98), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 48/112 (42%), Gaps = 11/112 (9%)

Query: 12  SFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIE 71
           S H ADLG G+GA  L +A    +A I   + SP     AR       N     +I   +
Sbjct: 133 SGHWADLGTGSGAIALGLADAFPKATIHAVDYSPEALKIARDN---ARNLGFDNQIKFYQ 189

Query: 72  VDVTLVGENRNLAGLKNNFYDHVIMNPPF--NERIGTMTPDKIKEEAHVMLE 121
                      LA LK  F   ++ NPP+     + T+ P+ +K E H+ L+
Sbjct: 190 GSWW-----EPLAALKGEF-SGMVSNPPYIPTSTVATLQPEVVKHEPHLALD 235


>gi|145632668|ref|ZP_01788402.1| predicted O-methyltransferase [Haemophilus influenzae 3655]
 gi|229846509|ref|ZP_04466617.1| predicted O-methyltransferase [Haemophilus influenzae 7P49H1]
 gi|262831319|sp|Q4QNC1|TRMN6_HAEI8 RecName: Full=tRNA (adenine-N(6)-)-methyltransferase; AltName:
           Full=tRNA m6A37 methyltransferase
 gi|144986863|gb|EDJ93415.1| predicted O-methyltransferase [Haemophilus influenzae 3655]
 gi|229810602|gb|EEP46320.1| predicted O-methyltransferase [Haemophilus influenzae 7P49H1]
          Length = 232

 Score = 42.4 bits (98), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 33/145 (22%), Positives = 66/145 (45%), Gaps = 12/145 (8%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHE-AQILLAERSPLMAHYARKTLALPA 59
           ++L +  +     ++ D+G+G G   L +A R  E  QI   E  P+ A  A++ +    
Sbjct: 25  ILLGAWADVKHCKNILDMGSGTGLLTLMLAQRTEENCQIQAVELDPIAAKQAQENI---N 81

Query: 60  NAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVM 119
           N+    RI L + D+      ++        +D ++ NPP+ E+ G    ++ +E A   
Sbjct: 82  NSVWKNRIQLTQADI------QHFLQTTEQTFDLIVANPPYFEQ-GIACKNEERELARYT 134

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLI 144
            + S   W+  A   +  +G++S +
Sbjct: 135 -KQSHLNWLEWAATRLSENGKISFV 158


>gi|288574648|ref|ZP_06393005.1| methyltransferase small [Dethiosulfovibrio peptidovorans DSM 11002]
 gi|288570389|gb|EFC91946.1| methyltransferase small [Dethiosulfovibrio peptidovorans DSM 11002]
          Length = 248

 Score = 42.4 bits (98), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 50/223 (22%), Positives = 92/223 (41%), Gaps = 25/223 (11%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA          + +LG   GA  L +A R  E  ++  +    + H A K   L   
Sbjct: 33  VLLAGFSKVRRGERICELGCAHGAVSLILAKR-KEVSVVGLDIQENLVHMAEKNREL--- 88

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNE----RIGTMTPDKIKEEA 116
            ++S R+S I  D+  + +      L    +D V+ NPP+ +    R G  + + + +  
Sbjct: 89  NELSDRVSFIHGDLREIHKI-----LPPQGFDVVVANPPYGDPTRHRTGNRSENVLAKHG 143

Query: 117 HVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE---ITPLHPRE 173
            V    S E        ++   G+   +   + L+ ++  CA R   +E   +  +HPRE
Sbjct: 144 VVC---SVEDVAEACRYLLGDKGRAYFVFAAERLVDLL--CALRYRGVEPKALRAVHPRE 198

Query: 174 GECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLI 216
           G+ AS  LV   +     +R   P+ ++   G     +  DL+
Sbjct: 199 GKDASVFLVKALRSASPGIRLLPPLRINDDGGS----YTEDLL 237


>gi|312142773|ref|YP_003994219.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Halanaerobium sp. 'sapolanicus']
 gi|311903424|gb|ADQ13865.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Halanaerobium sp. 'sapolanicus']
          Length = 286

 Score = 42.4 bits (98), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 69/138 (50%), Gaps = 17/138 (12%)

Query: 14  HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVD 73
            + D+G G+GA  +++   L +A+++ ++ S      AR  L      ++ +R+S+++ D
Sbjct: 117 QIIDVGCGSGAISVSLGYYLEDARVVGSDISKAALKIARHNL---KKFELEERVSVVQSD 173

Query: 74  VTLVGENRNLAGLKNNFYDHVIMNPPF--NERIGTMTPDKIKEEAHVMLE------DSFE 125
           +      R++A +     D V+ NPP+   + +  + P+ +K+E    LE      D ++
Sbjct: 174 LLREFIKRDIAEI-----DIVVSNPPYISEKEMAELAPE-VKKEPRTALEAGKKGLDFYK 227

Query: 126 KWIRTACAIMRSSGQLSL 143
           K I  A  +++  G L L
Sbjct: 228 KLIPQAEKVLKKEGMLFL 245


>gi|326795497|ref|YP_004313317.1| protein-(glutamine-N5) methyltransferase, ribosomal protein
           L3-specific [Marinomonas mediterranea MMB-1]
 gi|326546261|gb|ADZ91481.1| protein-(glutamine-N5) methyltransferase, ribosomal protein
           L3-specific [Marinomonas mediterranea MMB-1]
          Length = 300

 Score = 42.4 bits (98), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 42/84 (50%), Gaps = 11/84 (13%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           D+  G+G  G+A A    +A++ L++ S      AR  +   ++  +  R+S+IE D+  
Sbjct: 136 DMCTGSGCIGIATALAFEDAEVDLSDISSAALDVARYNV---SDYDLDDRVSVIESDM-- 190

Query: 77  VGENRNLAGLKNNFYDHVIMNPPF 100
                   GL  N YD ++ NPP+
Sbjct: 191 ------FDGLAGNKYDLIVCNPPY 208


>gi|160933138|ref|ZP_02080527.1| hypothetical protein CLOLEP_01981 [Clostridium leptum DSM 753]
 gi|156868212|gb|EDO61584.1| hypothetical protein CLOLEP_01981 [Clostridium leptum DSM 753]
          Length = 206

 Score = 42.4 bits (98), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 42/84 (50%), Gaps = 9/84 (10%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DL AG GA GL VA  L +A+++  E SPL   Y  + L+         R+  ++ DV L
Sbjct: 39  DLCAGTGAVGLGVARELPDAKVICVELSPLALPYLERNLSRYGEG----RVRAVKGDV-L 93

Query: 77  VGENRNLAGLKNNFYDHVIMNPPF 100
            G +    GL     D V+ NPP+
Sbjct: 94  NGPD----GLSLPLVDAVVSNPPY 113


>gi|228905831|ref|ZP_04069729.1| hypothetical protein bthur0013_230 [Bacillus thuringiensis IBL 200]
 gi|228853771|gb|EEM98530.1| hypothetical protein bthur0013_230 [Bacillus thuringiensis IBL 200]
          Length = 246

 Score = 42.4 bits (98), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 35/162 (21%), Positives = 79/162 (48%), Gaps = 11/162 (6%)

Query: 63  ISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLED 122
           + +RI LI  D+  + E      L  + YD V  NPP+ +   T +   + E   +   +
Sbjct: 92  LEERIHLIHGDLKDMPEK-----LGRHQYDVVTCNPPYFQTPQT-SEKNMNEHLAIARHE 145

Query: 123 ---SFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECAS 178
              + E  +  +  +++  G+++ + RP  L+ IV    + +I    +  ++P+ G+ A+
Sbjct: 146 IMCTLEDVVSASSQLVKQGGKVAFVHRPGRLLDIVTLMRKYKIEPKRVRFVYPKIGKEAN 205

Query: 179 RILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKR 220
            +L+ G K     L+   P+V+++ N + Y++ +  ++ G+ 
Sbjct: 206 TLLIEGIKDGNADLKILPPLVVYEDNNE-YTKEIRSILYGEE 246


>gi|68249024|ref|YP_248136.1| O-methyltransferase [Haemophilus influenzae 86-028NP]
 gi|68057223|gb|AAX87476.1| predicted O-methyltransferase [Haemophilus influenzae 86-028NP]
          Length = 240

 Score = 42.4 bits (98), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 33/145 (22%), Positives = 66/145 (45%), Gaps = 12/145 (8%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHE-AQILLAERSPLMAHYARKTLALPA 59
           ++L +  +     ++ D+G+G G   L +A R  E  QI   E  P+ A  A++ +    
Sbjct: 33  ILLGAWADVKHCKNILDMGSGTGLLTLMLAQRTEENCQIQAVELDPIAAKQAQENI---N 89

Query: 60  NAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVM 119
           N+    RI L + D+      ++        +D ++ NPP+ E+ G    ++ +E A   
Sbjct: 90  NSVWKNRIQLTQADI------QHFLQTTEQTFDLIVANPPYFEQ-GIACKNEERELARYT 142

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLI 144
            + S   W+  A   +  +G++S +
Sbjct: 143 -KQSHLNWLEWAATRLSENGKISFV 166


>gi|228937337|ref|ZP_04099984.1| hypothetical protein bthur0008_230 [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|228963133|ref|ZP_04124303.1| hypothetical protein bthur0004_250 [Bacillus thuringiensis serovar
           sotto str. T04001]
 gi|228970223|ref|ZP_04130883.1| hypothetical protein bthur0003_220 [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228976793|ref|ZP_04137206.1| hypothetical protein bthur0002_220 [Bacillus thuringiensis Bt407]
 gi|228782889|gb|EEM31054.1| hypothetical protein bthur0002_220 [Bacillus thuringiensis Bt407]
 gi|228789458|gb|EEM37377.1| hypothetical protein bthur0003_220 [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228796518|gb|EEM43956.1| hypothetical protein bthur0004_250 [Bacillus thuringiensis serovar
           sotto str. T04001]
 gi|228822295|gb|EEM68276.1| hypothetical protein bthur0008_230 [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|326937826|gb|AEA13722.1| methyltransferase [Bacillus thuringiensis serovar chinensis CT-43]
          Length = 246

 Score = 42.4 bits (98), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 35/162 (21%), Positives = 79/162 (48%), Gaps = 11/162 (6%)

Query: 63  ISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLED 122
           + +RI LI  D+  + E      L  + YD V  NPP+ +   T +   + E   +   +
Sbjct: 92  LEERIHLIHGDLKDMPEK-----LGRHQYDVVTCNPPYFQTPQT-SEKNMNEHLAIARHE 145

Query: 123 ---SFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECAS 178
              + E  +  +  +++  G+++ + RP  L+ IV    + +I    +  ++P+ G+ A+
Sbjct: 146 IMCTLEDVVSASSQLVKQGGKVAFVHRPGRLLDIVTLMRKYKIEPKRVRFVYPKVGKEAN 205

Query: 179 RILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKR 220
            +L+ G K     L+   P+V+++ N + Y++ +  ++ G+ 
Sbjct: 206 TLLIEGIKDGNADLKILPPLVVYENNNE-YTKEIRSILYGEE 246


>gi|228898788|ref|ZP_04063071.1| hypothetical protein bthur0014_230 [Bacillus thuringiensis IBL
           4222]
 gi|228860813|gb|EEN05190.1| hypothetical protein bthur0014_230 [Bacillus thuringiensis IBL
           4222]
          Length = 246

 Score = 42.4 bits (98), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 35/162 (21%), Positives = 79/162 (48%), Gaps = 11/162 (6%)

Query: 63  ISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLED 122
           + +RI LI  D+  + E      L  + YD V  NPP+ +   T +   + E   +   +
Sbjct: 92  LKERIHLIHGDLKDMPEK-----LGRHQYDVVTCNPPYFQTPQT-SEKNMNEHLAIARHE 145

Query: 123 ---SFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECAS 178
              + E  +  +  +++  G+++ + RP  L+ IV    + +I    +  ++P+ G+ A+
Sbjct: 146 IMCTLEDVVSASSQLVKQGGKVAFVHRPGRLLDIVTLMRKYKIEPKRVRFVYPKVGKEAN 205

Query: 179 RILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKR 220
            +L+ G K     L+   P+V+++ N + Y++ +  ++ G+ 
Sbjct: 206 TLLIEGIKDGNADLKILPPLVVYENNNE-YTKEIRSILYGEE 246


>gi|302186443|ref|ZP_07263116.1| modification methylase HemK [Pseudomonas syringae pv. syringae 642]
          Length = 277

 Score = 42.4 bits (98), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 44/96 (45%), Gaps = 12/96 (12%)

Query: 5   SLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQIS 64
            LV A  S  L DLG G GA  LA+A+   + ++   +R P     A +           
Sbjct: 103 ELVPAFASAQLLDLGTGTGAIALALANERQQWKVTAVDRVPEAVALAERN---------R 153

Query: 65  KRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF 100
           KR+ L   +V    E+   +GL+   +D +I NPP+
Sbjct: 154 KRLQLNNAEVF---ESHWFSGLQGRQFDLIISNPPY 186


>gi|206972576|ref|ZP_03233519.1| conserved hypothetical protein [Bacillus cereus AH1134]
 gi|229067799|ref|ZP_04201117.1| hypothetical protein bcere0025_240 [Bacillus cereus F65185]
 gi|229176635|ref|ZP_04304040.1| hypothetical protein bcere0005_230 [Bacillus cereus 172560W]
 gi|206732478|gb|EDZ49657.1| conserved hypothetical protein [Bacillus cereus AH1134]
 gi|228606802|gb|EEK64218.1| hypothetical protein bcere0005_230 [Bacillus cereus 172560W]
 gi|228715283|gb|EEL67141.1| hypothetical protein bcere0025_240 [Bacillus cereus F65185]
          Length = 246

 Score = 42.0 bits (97), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 35/162 (21%), Positives = 79/162 (48%), Gaps = 11/162 (6%)

Query: 63  ISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLED 122
           + +RI LI  D+  + E      L  + YD V  NPP+ +   T +   + E   +   +
Sbjct: 92  LEERIHLIHGDLKDMPEK-----LGRHQYDVVTCNPPYFQTPQT-SEKNMNEHLAIARHE 145

Query: 123 ---SFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECAS 178
              + E  +  +  +++  G+++ + RP  L+ IV    + +I    +  ++P+ G+ A+
Sbjct: 146 IMCTLEDVVSVSSQLVKQGGKVAFVHRPGRLLDIVTLMRKYKIEPKRVQFVYPKVGKEAN 205

Query: 179 RILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKR 220
            +L+ G K     L+   P+V+++ N + Y++ +  ++ G+ 
Sbjct: 206 TLLIEGIKDGNADLKILPPLVVYENNNE-YTKELRSILYGEE 246


>gi|20094146|ref|NP_613993.1| 16S rRNA G1207 methylase [Methanopyrus kandleri AV19]
 gi|19887153|gb|AAM01923.1| 16S rRNA G1207 methylase [Methanopyrus kandleri AV19]
          Length = 199

 Score = 42.0 bits (97), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 37/158 (23%), Positives = 70/158 (44%), Gaps = 17/158 (10%)

Query: 2   ILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANA 61
           +LA  ++  G   + DLG G G  G+  A  L E  ++       M    R+ + L   A
Sbjct: 48  LLAENMDLEGVHSVLDLGCGYGVLGIVAAKELGEGHVV-------MTDVNRRAIWL---A 97

Query: 62  QISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLE 121
             ++R++ +E D+T V E      +++  +D ++ NPP  E +  +   +I  EA   L 
Sbjct: 98  NENRRLNDVE-DITEVREGSLYDPVEDEEFDRIVSNPPIREGLDLVL--RIVREAPNHLT 154

Query: 122 DSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR 159
           +  E W+     + R  G   +++  +++       AR
Sbjct: 155 EDGELWL----VVRRKMGSKRILSEMRTVFGSAEVAAR 188


>gi|228918985|ref|ZP_04082365.1| hypothetical protein bthur0011_220 [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228840634|gb|EEM85895.1| hypothetical protein bthur0011_220 [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
          Length = 246

 Score = 42.0 bits (97), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 35/162 (21%), Positives = 79/162 (48%), Gaps = 11/162 (6%)

Query: 63  ISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLED 122
           + +RI LI  D+  + E      L  + YD V  NPP+ +   T +   + E   +   +
Sbjct: 92  LEERIHLIHGDLKDMPEK-----LGRHQYDVVTCNPPYFQTPQT-SEKNMNEHLAIARHE 145

Query: 123 ---SFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECAS 178
              + E  +  +  +++  G+++ + RP  L+ IV    + +I    +  ++P+ G+ A+
Sbjct: 146 IMCTLEDVVSASSQLVKQGGKVAFVHRPGRLLDIVTLMRKYKIEPKRVQFVYPKVGKEAN 205

Query: 179 RILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKR 220
            +L+ G K     L+   P+V+++ N + Y++ +  ++ G+ 
Sbjct: 206 TLLIEGIKDGNADLKILPPLVVYENNNE-YTKELRSILYGEE 246


>gi|30018306|ref|NP_829937.1| methyltransferase [Bacillus cereus ATCC 14579]
 gi|218232737|ref|YP_002364884.1| hypothetical protein BCB4264_A0039 [Bacillus cereus B4264]
 gi|228956476|ref|ZP_04118273.1| hypothetical protein bthur0005_230 [Bacillus thuringiensis serovar
           pakistani str. T13001]
 gi|229039939|ref|ZP_04189704.1| hypothetical protein bcere0027_220 [Bacillus cereus AH676]
 gi|229107721|ref|ZP_04237358.1| hypothetical protein bcere0018_230 [Bacillus cereus Rock1-15]
 gi|229125552|ref|ZP_04254585.1| hypothetical protein bcere0015_230 [Bacillus cereus BDRD-Cer4]
 gi|229142840|ref|ZP_04271283.1| hypothetical protein bcere0012_220 [Bacillus cereus BDRD-ST24]
 gi|229148444|ref|ZP_04276701.1| hypothetical protein bcere0011_230 [Bacillus cereus m1550]
 gi|229188320|ref|ZP_04315369.1| hypothetical protein bcere0002_230 [Bacillus cereus ATCC 10876]
 gi|296500867|ref|YP_003662567.1| methyltransferase [Bacillus thuringiensis BMB171]
 gi|29893846|gb|AAP07138.1| Methyltransferase [Bacillus cereus ATCC 14579]
 gi|218160694|gb|ACK60686.1| conserved hypothetical protein [Bacillus cereus B4264]
 gi|228595119|gb|EEK52889.1| hypothetical protein bcere0002_230 [Bacillus cereus ATCC 10876]
 gi|228634986|gb|EEK91558.1| hypothetical protein bcere0011_230 [Bacillus cereus m1550]
 gi|228640603|gb|EEK96990.1| hypothetical protein bcere0012_220 [Bacillus cereus BDRD-ST24]
 gi|228657869|gb|EEL13674.1| hypothetical protein bcere0015_230 [Bacillus cereus BDRD-Cer4]
 gi|228675694|gb|EEL30901.1| hypothetical protein bcere0018_230 [Bacillus cereus Rock1-15]
 gi|228727398|gb|EEL78590.1| hypothetical protein bcere0027_220 [Bacillus cereus AH676]
 gi|228803166|gb|EEM49987.1| hypothetical protein bthur0005_230 [Bacillus thuringiensis serovar
           pakistani str. T13001]
 gi|296321919|gb|ADH04847.1| methyltransferase [Bacillus thuringiensis BMB171]
          Length = 246

 Score = 42.0 bits (97), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 35/162 (21%), Positives = 79/162 (48%), Gaps = 11/162 (6%)

Query: 63  ISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLED 122
           + +RI LI  D+  + E      L  + YD V  NPP+ +   T +   + E   +   +
Sbjct: 92  LEERIHLIHGDLKDMPEK-----LGRHQYDVVTCNPPYFQTPQT-SEKNMNEHLAIARHE 145

Query: 123 ---SFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECAS 178
              + E  +  +  +++  G+++ + RP  L+ IV    + +I    +  ++P+ G+ A+
Sbjct: 146 IMCTLEDVVSASSQLVKQGGKVAFVHRPGRLLDIVTLMRKYKIEPKRVQFVYPKVGKEAN 205

Query: 179 RILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKR 220
            +L+ G K     L+   P+V+++ N + Y++ +  ++ G+ 
Sbjct: 206 TLLIEGIKDGNADLKILPPLVVYENNNE-YTKELRSILYGEE 246


>gi|237739012|ref|ZP_04569493.1| ribosomal RNA small subunit methyltransferase C [Fusobacterium sp.
           2_1_31]
 gi|229423612|gb|EEO38659.1| ribosomal RNA small subunit methyltransferase C [Fusobacterium sp.
           2_1_31]
          Length = 222

 Score = 42.0 bits (97), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 44/187 (23%), Positives = 80/187 (42%), Gaps = 20/187 (10%)

Query: 12  SFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIE 71
           +  L D+G G G   + ++      +I+  +        A K L L    +I K I+   
Sbjct: 45  NIKLLDIGTGNGILPILLSDNDMIEEIVGIDIQNENIERANKALEL---NKIEKNINFTC 101

Query: 72  VDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLED-----SFEK 126
           +DV    E +N      N++D VI NPP+ E  G     KI E  H  L       + ++
Sbjct: 102 LDVK---EYKNA-----NYFDVVISNPPYMEDNGK----KINENEHRALSRHEIKLNLDE 149

Query: 127 WIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRILVTGRK 186
           +I+ A  +++  G L  + R   LI+I+    +   S++       +   +S +++   K
Sbjct: 150 FIQNAKRLLKPIGTLYFVHRTHRLIEIIKTLDKNKFSIKKIIFVFSKNNTSSMMIIEALK 209

Query: 187 GMRGQLR 193
           G + +L 
Sbjct: 210 GKKIKLE 216


>gi|303243574|ref|ZP_07329916.1| methyltransferase small [Methanothermococcus okinawensis IH1]
 gi|302486135|gb|EFL49057.1| methyltransferase small [Methanothermococcus okinawensis IH1]
          Length = 201

 Score = 42.0 bits (97), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 60/127 (47%), Gaps = 13/127 (10%)

Query: 2   ILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANA 61
           IL   +    ++ + D+G G G  G+A+A  ++   I + + +      A++ + L   +
Sbjct: 46  ILVEALKLNKNYDVLDIGCGYGVVGIAIADEVN--SITMTDINKRAVRLAKENIKLNDTS 103

Query: 62  QISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLE 121
           +  K I +++ D+           +K+  YD +I NPP   + G  T  +I +E   +L+
Sbjct: 104 K-DKNIRVVQGDL--------YENVKDKNYDMIISNPPI--KAGKETIHRIIKEGKELLK 152

Query: 122 DSFEKWI 128
           D+   W+
Sbjct: 153 DNGSIWL 159


>gi|298530382|ref|ZP_07017784.1| Methyltransferase type 11 [Desulfonatronospira thiodismutans
           ASO3-1]
 gi|298509756|gb|EFI33660.1| Methyltransferase type 11 [Desulfonatronospira thiodismutans
           ASO3-1]
          Length = 249

 Score = 42.0 bits (97), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 77/171 (45%), Gaps = 11/171 (6%)

Query: 34  HEAQILLAERSPLMAHYARK-TLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFYD 92
            E Q+   +  P M   AR+ + AL    + S R+    +DVT +        L    +D
Sbjct: 63  KEIQVTGVDNDPEMIECARQNSRALCLEEKSSYRL----LDVTSLDSQ----SLAPESFD 114

Query: 93  HVIMNPPF-NERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLI 151
            V+ NPP+ +ER G    +  K+ A  + ++S   + + A   +++      +     L 
Sbjct: 115 LVLANPPYRDERSGRTPENPGKKSAQFVTKNSQLDFFQAAFFALKNRAAAGFVYPASRLD 174

Query: 152 QIV-NACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLH 201
           Q++ N    R+    I P++ R G+ AS +LV  RK    +L    P++L+
Sbjct: 175 QLLLNLDRSRLRPKTILPVYGRAGKQASLVLVKARKNSGPELSMLPPLILY 225


>gi|298252616|ref|ZP_06976410.1| methylase of polypeptide chain release factors [Gardnerella
           vaginalis 5-1]
 gi|297532980|gb|EFH71864.1| methylase of polypeptide chain release factors [Gardnerella
           vaginalis 5-1]
          Length = 304

 Score = 42.0 bits (97), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 45/96 (46%), Gaps = 14/96 (14%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPA----NAQISKRISLI 70
           + DL AG+GA GL++A+ + +AQ+   E+SP    Y +K     A    N QI  R   +
Sbjct: 123 VVDLCAGSGAIGLSIAAEVADAQVWAVEKSPEAFQYLQKNFEETAKKWENIQIFSRYHAV 182

Query: 71  EVDVTLVGENRNLAGLKNNFY------DHVIMNPPF 100
             D T      +++      +      D VI NPP+
Sbjct: 183 LADAT----KSHISDCTPELHAICGKVDLVITNPPY 214


>gi|283783534|ref|YP_003374288.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Gardnerella vaginalis 409-05]
 gi|283441994|gb|ADB14460.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Gardnerella vaginalis 409-05]
          Length = 304

 Score = 42.0 bits (97), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 45/96 (46%), Gaps = 14/96 (14%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPA----NAQISKRISLI 70
           + DL AG+GA GL++A+ + +AQ+   E+SP    Y +K     A    N QI  R   +
Sbjct: 123 VVDLCAGSGAIGLSIAAEVADAQVWAVEKSPEAFQYLQKNFEETAKKWENIQIFSRYHAV 182

Query: 71  EVDVTLVGENRNLAGLKNNFY------DHVIMNPPF 100
             D T      +++      +      D VI NPP+
Sbjct: 183 LADAT----KSHISDCTPELHAICGKVDLVITNPPY 214


>gi|227824453|ref|ZP_03989285.1| methyltransferase [Acidaminococcus sp. D21]
 gi|226904952|gb|EEH90870.1| methyltransferase [Acidaminococcus sp. D21]
          Length = 242

 Score = 42.0 bits (97), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 51/211 (24%), Positives = 93/211 (44%), Gaps = 23/211 (10%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           + LA+  +      + +LG G GA  L  A+R  ++ +L  +++P +    ++++     
Sbjct: 31  VFLAAFPHMVKKACVLELGCGTGAISLLAANRGAQS-VLAVDKNPHVIELLKRSV---RE 86

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAH--- 117
             + +++     D+    E      LK +  D V MNPP+  RIG      + E  H   
Sbjct: 87  NGLEQQVMPFVGDILAYREY-----LKPDTMDLVYMNPPY--RIGGRRRQLMTEACHEVG 139

Query: 118 VMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPL---HPREG 174
           V LED    +I+ A   +++ G+L+++  P      +    R    LEI  L   H    
Sbjct: 140 VTLED----FIKAAAFALKTRGRLAMVQLPDRFTDALRLADRY--HLEIKRLQWVHSYID 193

Query: 175 ECASRILVTGRKGMRGQLRFRYPIVLHKPNG 205
             A   L   +KG RG L    P+++++ +G
Sbjct: 194 RGAWIFLAEFQKGGRGGLTVLPPLIMYRHDG 224


>gi|154506312|ref|ZP_02043050.1| hypothetical protein RUMGNA_03860 [Ruminococcus gnavus ATCC 29149]
 gi|153793401|gb|EDN75821.1| hypothetical protein RUMGNA_03860 [Ruminococcus gnavus ATCC 29149]
          Length = 232

 Score = 41.6 bits (96), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 39/205 (19%), Positives = 90/205 (43%), Gaps = 13/205 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++L+          + DLG G G   + ++++      +  E     A  AR+++     
Sbjct: 35  VMLSDFAKVKPGEKVLDLGTGTGILPILLSAKTRGEHFIGLEIQKESADMARRSIEW--- 91

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF--NERIGTMTPDKIKEEAHV 118
             + ++I +++ D+         A  K  F+D ++ NPP+  N+  G   P   K  A  
Sbjct: 92  NHLQEKIEIVQGDI-----KEAAALFKPTFFDVIVTNPPYMLNQH-GLQNPGDAKAIARH 145

Query: 119 MLEDSFEKWIRTACAIM-RSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGEC 176
            +  + +  +R +  ++    G+  +I +P  L +I+   +  +I    I  +HP   + 
Sbjct: 146 EILCTLDDILRESKQLLADGKGRFYMIHKPFRLAEILTKMSEYKIEPKRIRFVHPYIDKE 205

Query: 177 ASRILVTGRKGMRGQLRFRYPIVLH 201
            + +L+ G +G + ++    PI+++
Sbjct: 206 PTMVLIEGLRGGKPRVTIEPPIIMY 230


>gi|242372759|ref|ZP_04818333.1| 16S rRNA methyltransferase [Staphylococcus epidermidis M23864:W1]
 gi|242349532|gb|EES41133.1| 16S rRNA methyltransferase [Staphylococcus epidermidis M23864:W1]
          Length = 208

 Score = 41.6 bits (96), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 64/153 (41%), Gaps = 22/153 (14%)

Query: 12  SFHLADLGAGAGAAGLAVA--SRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISL 69
           S H+AD+G G G  GL +A  S  H+  +L      L      KT     NA+I      
Sbjct: 67  SKHIADVGCGYGPIGLTIAKISPHHQLSLLDVNNRALALAEINKTKNQIENAEI------ 120

Query: 70  IEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIR 129
           IE D         L+ + N  +D+V+ NPP   R G     +I EEA+  L+   E ++ 
Sbjct: 121 IESDC--------LSAVDNQRFDYVLTNPPI--RAGKDIVHRIFEEAYEKLKAQGELYV- 169

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNACARRIG 162
               I +  G  S   + ++L   V    +  G
Sbjct: 170 ---VIQKKQGMPSAKKKMEALFNNVEVVNKSKG 199


>gi|296393117|ref|YP_003658001.1| HemK family modification methylase [Segniliparus rotundus DSM
           44985]
 gi|296180264|gb|ADG97170.1| modification methylase, HemK family [Segniliparus rotundus DSM
           44985]
          Length = 286

 Score = 41.6 bits (96), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 48/98 (48%), Gaps = 10/98 (10%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DL +G+G+ GL++A  + EA++ L E  P    + R+    P        + ++  DVT 
Sbjct: 122 DLCSGSGSLGLSIARSVPEAKVALVENDPEALVWTRRNANTP-----DADVDVVGGDVTD 176

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKE 114
           V     L   +N   D ++ NPP+    GT TP ++ +
Sbjct: 177 VA----LLAERNGAVDVIVANPPYVP-AGTPTPPEVAD 209


>gi|212703874|ref|ZP_03312002.1| hypothetical protein DESPIG_01926 [Desulfovibrio piger ATCC 29098]
 gi|212672691|gb|EEB33174.1| hypothetical protein DESPIG_01926 [Desulfovibrio piger ATCC 29098]
          Length = 325

 Score = 41.6 bits (96), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 51/112 (45%), Gaps = 5/112 (4%)

Query: 99  PFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACA 158
           P   R GT  P ++ ++    + +    +   A  ++R  G    I     L ++++   
Sbjct: 200 PVPLRDGTPAPRRVGKQP--GMPNPLAVFCHAARRLLRHHGLFCCIFPAAELSRLLSTLE 257

Query: 159 R-RIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYS 209
           R R+G   I PL PR GE A R+LV  RK    Q     P+ LH  +GQ +S
Sbjct: 258 RERLGCRRILPLCPRAGEPAKRVLVLARKDAAAQCLLEAPLPLH--HGQGWS 307


>gi|212711978|ref|ZP_03320106.1| hypothetical protein PROVALCAL_03054 [Providencia alcalifaciens DSM
           30120]
 gi|212685500|gb|EEB45028.1| hypothetical protein PROVALCAL_03054 [Providencia alcalifaciens DSM
           30120]
          Length = 277

 Score = 41.6 bits (96), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 43/87 (49%), Gaps = 18/87 (20%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSP---LMAHYARKTLALPANAQISKRISLIEVD 73
           DLG G GA GLA+AS L  + ++  + +P    +A   ++ LALP N Q S+        
Sbjct: 115 DLGTGTGAIGLALASELPNSCVVGVDFNPEAVALAQRNQQRLALP-NIQFSQ-------- 165

Query: 74  VTLVGENRNLAGLKNNFYDHVIMNPPF 100
                 +   A L N  +D ++ NPP+
Sbjct: 166 ------SDWFASLPNELFDMIVSNPPY 186


>gi|223043052|ref|ZP_03613100.1| methyltransferase small domain superfamily [Staphylococcus capitis
           SK14]
 gi|222443906|gb|EEE50003.1| methyltransferase small domain superfamily [Staphylococcus capitis
           SK14]
          Length = 202

 Score = 41.6 bits (96), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 37/151 (24%), Positives = 65/151 (43%), Gaps = 18/151 (11%)

Query: 12  SFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIE 71
           S ++AD+G G G  GL +A      Q+ + + +        + LAL    +I  +I   E
Sbjct: 61  SKYIADVGCGYGPIGLTIAKVSPHHQLYMLDVN-------NRALALTGMNKIKNQIENAE 113

Query: 72  VDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTA 131
                + E+  L+G+ +  +D+++ NPP   R G     +I EEA+  L+D    ++   
Sbjct: 114 -----IIESDCLSGVSDQQFDYILTNPPI--RAGKDVVHRIFEEAYCKLKDQGALYV--- 163

Query: 132 CAIMRSSGQLSLIARPQSLIQIVNACARRIG 162
             I +  G  S   + Q     V    +  G
Sbjct: 164 -VIQKKQGMPSAKKKMQECFNHVEVVNKSKG 193


>gi|319936707|ref|ZP_08011120.1| methyltransferase [Coprobacillus sp. 29_1]
 gi|319808264|gb|EFW04829.1| methyltransferase [Coprobacillus sp. 29_1]
          Length = 244

 Score = 41.6 bits (96), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 45/213 (21%), Positives = 97/213 (45%), Gaps = 23/213 (10%)

Query: 1   MILASLVNATGSFH-LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPA 59
           ++L+S        H + D G    A  L ++ R  + +I+  E        A K + L  
Sbjct: 31  VLLSSFCTINKDLHKIIDFGTNNAAIPLLLSRRT-DKEIIGIEIQKDAVDLAIKNVKL-- 87

Query: 60  NAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVM 119
              +  +I++I  D+    +      L       ++ NPPF  ++G  +   I E  ++ 
Sbjct: 88  -NHLENQITIIHNDIKDYVQTSEKFKL-------IVCNPPFF-KVGERS--HINENEYLQ 136

Query: 120 L-----EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPRE 173
           +     + + ++ I++A  I+ + G+ +++ RP  +I+I+N   +  I    I  ++P+ 
Sbjct: 137 IARHEIKINLDEIIQSAARILDNKGRFAMVHRPDRMIEIINIMQKYDIEPKRIRFVYPKF 196

Query: 174 GECASRILVTG-RKGMRGQLRFRYPIVLHKPNG 205
           G+ +   L+ G  KG +G ++   P+  H+ +G
Sbjct: 197 GKESHIFLIEGMYKGNKG-VKIESPLYAHEEDG 228


>gi|238809990|dbj|BAH69780.1| hypothetical protein [Mycoplasma fermentans PG18]
          Length = 263

 Score = 41.6 bits (96), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 48/210 (22%), Positives = 85/210 (40%), Gaps = 17/210 (8%)

Query: 14  HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVD 73
           +L ++GA  GA  + +A R    +I   E        A+  + L  N Q   +I +I  D
Sbjct: 50  NLLEIGANNGALSIFIAERNPNLKIDAVEIQTKACKLAQDNIEL-NNKQ--NQIKIINQD 106

Query: 74  VTLVGENRNLAGLKN--NFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLED---SFEKWI 128
                    L  +KN  + YD ++ NPPF           I EE  +   +   + E+ I
Sbjct: 107 FNEFY----LEKIKNAASKYDSIVCNPPFYTMQTNKVSKNISEELLIATHEYKINLEQII 162

Query: 129 RTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE---ITPLHPREGECASRILVTGR 185
             +  ++   G L+L+   + L+     C  R  + E   +  + PR  +    +LV GR
Sbjct: 163 LGSSKLIEQKGYLTLVIPVERLVDCF--CLMRKYNFEPKRVQFIIPRMQDKPKLVLVEGR 220

Query: 186 KGMRGQLRFRYPIVLHKPNGQPYSRFVTDL 215
                 + F   + LH PN +    ++ ++
Sbjct: 221 YQAGWGVHFLPNLYLHDPNDKQQHEYLENI 250


>gi|228475259|ref|ZP_04059984.1| methyltransferase small domain protein [Staphylococcus hominis
           SK119]
 gi|314937154|ref|ZP_07844501.1| YbxB protein [Staphylococcus hominis subsp. hominis C80]
 gi|228270724|gb|EEK12133.1| methyltransferase small domain protein [Staphylococcus hominis
           SK119]
 gi|313655773|gb|EFS19518.1| YbxB protein [Staphylococcus hominis subsp. hominis C80]
          Length = 202

 Score = 41.6 bits (96), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 66/148 (44%), Gaps = 18/148 (12%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + D+G G G  GL +A      Q+ + + +    H A K          +K+ +  ++D 
Sbjct: 64  IIDVGCGYGPIGLMIAKVSPHHQMTMVDVNHRALHLAEK----------NKKQN--QIDN 111

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAI 134
            ++ E+  L+ ++N ++D V+ NPP   R G     +I EEA+  L++  E ++     I
Sbjct: 112 VIITESDGLSQVENEYFDFVLTNPPI--RAGKNVVHRIFEEAYQKLKNQGELYV----VI 165

Query: 135 MRSSGQLSLIARPQSLIQIVNACARRIG 162
            +  G  S   + + +   V    +  G
Sbjct: 166 QKKQGMPSAKKKMEEIFNNVETVNKSKG 193


>gi|308190252|ref|YP_003923183.1| O-methyltransferase [Mycoplasma fermentans JER]
 gi|319777620|ref|YP_004137271.1| DNA methylase [Mycoplasma fermentans M64]
 gi|307624994|gb|ADN69299.1| predicted O-methyltransferase [Mycoplasma fermentans JER]
 gi|318038695|gb|ADV34894.1| DNA methylase [Mycoplasma fermentans M64]
          Length = 261

 Score = 41.6 bits (96), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 48/210 (22%), Positives = 85/210 (40%), Gaps = 17/210 (8%)

Query: 14  HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVD 73
           +L ++GA  GA  + +A R    +I   E        A+  + L  N Q   +I +I  D
Sbjct: 48  NLLEIGANNGALSIFIAERNPNLKIDAVEIQTKACKLAQDNIEL-NNKQ--NQIKIINQD 104

Query: 74  VTLVGENRNLAGLKN--NFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLED---SFEKWI 128
                    L  +KN  + YD ++ NPPF           I EE  +   +   + E+ I
Sbjct: 105 FNEFY----LEKIKNAASKYDSIVCNPPFYTMQTNKVSKNISEELLIATHEYKINLEQII 160

Query: 129 RTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE---ITPLHPREGECASRILVTGR 185
             +  ++   G L+L+   + L+     C  R  + E   +  + PR  +    +LV GR
Sbjct: 161 LGSSKLIEQKGYLTLVIPVERLVDCF--CLMRKYNFEPKRVQFIIPRMQDKPKLVLVEGR 218

Query: 186 KGMRGQLRFRYPIVLHKPNGQPYSRFVTDL 215
                 + F   + LH PN +    ++ ++
Sbjct: 219 YQAGWGVHFLPNLYLHDPNDKQQHEYLENI 248


>gi|110798817|ref|YP_696881.1| HemK family methyltransferase [Clostridium perfringens ATCC 13124]
 gi|168210132|ref|ZP_02635757.1| methyltransferase, HemK family [Clostridium perfringens B str. ATCC
           3626]
 gi|110673464|gb|ABG82451.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Clostridium perfringens ATCC 13124]
 gi|170711816|gb|EDT23998.1| methyltransferase, HemK family [Clostridium perfringens B str. ATCC
           3626]
          Length = 587

 Score = 41.6 bits (96), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 66/145 (45%), Gaps = 17/145 (11%)

Query: 7   VNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKR 66
           ++     ++ DL  G+GA GL++A+      + L +   +     RK +      ++SKR
Sbjct: 409 IDEDAEINVCDLCCGSGAIGLSLANYRKNIIVDLVDIDDIPEKVTRKNI---RELELSKR 465

Query: 67  ISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF--NERIGTMTPDKIKEEAHVML---E 121
              I+ D  L+ E       K N YD ++ NPP+   E I T+  D    E H+ L   E
Sbjct: 466 CGFIKSD--LLSEVIK----KGNKYDILVSNPPYIRTEVINTLMEDVKDYEPHLALDGGE 519

Query: 122 DS---FEKWIRTACAIMRSSGQLSL 143
           D    + + I  +  I++ +G L+ 
Sbjct: 520 DGLIFYRRIIDESLEILKENGILAF 544


>gi|218530637|ref|YP_002421453.1| methyltransferase small [Methylobacterium chloromethanicum CM4]
 gi|218522940|gb|ACK83525.1| methyltransferase small [Methylobacterium chloromethanicum CM4]
          Length = 341

 Score = 41.6 bits (96), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 51/85 (60%), Gaps = 13/85 (15%)

Query: 16  ADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVT 75
           AD+G G+GAAG+ VA RL EA+++L + +P     AR          I+ R+++++ +V 
Sbjct: 163 ADIGCGSGAAGILVAKRLPEAEVVLVDINPAALRAAR----------INARLAVVD-NVR 211

Query: 76  LVGENRNLAGLKNNFYDHVIMNPPF 100
            V  +  L+ ++ +F D ++ NPPF
Sbjct: 212 PVHSDM-LSNVEGSF-DLIVSNPPF 234


>gi|251793532|ref|YP_003008261.1| phosphatidylserine synthase [Aggregatibacter aphrophilus NJ8700]
 gi|262827860|sp|C6AQR4|TRMN6_AGGAN RecName: Full=tRNA (adenine-N(6)-)-methyltransferase; AltName:
           Full=tRNA m6A37 methyltransferase
 gi|247534928|gb|ACS98174.1| phosphatidylserine synthase [Aggregatibacter aphrophilus NJ8700]
          Length = 234

 Score = 41.6 bits (96), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 50/219 (22%), Positives = 93/219 (42%), Gaps = 26/219 (11%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLH-EAQILLAERSPLMAHYARKT-LALP 58
           ++L +  +   +  + DLG+G+G   L +A R   E++I   E  P  A  AR+  LA P
Sbjct: 27  ILLGAWADVMQAKQILDLGSGSGLIALMLAQRSSAESRICAVEIDPAAAQQARENALASP 86

Query: 59  ANAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHV 118
              +I      I+   T   +           +D ++ NPP+ E  G    D  +  A  
Sbjct: 87  WKEKIQVYQQDIDSFCTQTAQR----------FDLIVANPPYFE-AGIACRDDERNTARY 135

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLI---ARPQSLIQIVN-ACARRIGSLEITPLHPREG 174
             + S   W++TA   +  +G++S +   A  ++L++     C  R        +  + G
Sbjct: 136 FTQ-SHLHWLQTAQRCLAPNGKISFVLPLAAGETLLKTTALYCIARCD------VRTKAG 188

Query: 175 ECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVT 213
           +   R+L+T    M+ Q      ++++    Q +  FVT
Sbjct: 189 KAPQRVLLTF--AMQPQPLKHSELIIYDAQNQYHEDFVT 225


>gi|225550392|ref|ZP_03771341.1| methyltransferase family protein [Ureaplasma urealyticum serovar 2
           str. ATCC 27814]
 gi|225379546|gb|EEH01908.1| methyltransferase family protein [Ureaplasma urealyticum serovar 2
           str. ATCC 27814]
          Length = 262

 Score = 41.2 bits (95), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 44/210 (20%), Positives = 93/210 (44%), Gaps = 9/210 (4%)

Query: 1   MILASLVN-ATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPA 59
           ++LA+ ++ ++ +  + ++G    A  + +ASR  +  I   E        A   L +  
Sbjct: 32  VLLANFISLSSKTKKVLEIGTNNAALSIFLASRKEDMNIDAIEIQSEAIDLA--LLNVKE 89

Query: 60  NAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF--NERIGTMTPDKIKEEAH 117
           N  + K+I++I  D       +    ++NN YD +I NPPF   ++I   T   ++  A 
Sbjct: 90  N-HLEKQINIIHADFNEYW--KTFDKIENNKYDAIICNPPFYKQDKIIPSTKKPLQTLAL 146

Query: 118 VMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGEC 176
             +  +FE+ ++    I++    L+++     L+ ++    + +     I  ++PR  E 
Sbjct: 147 YEIALNFEQIMQGCAKIIKQKANLAMVIPTTRLVDLLEMMRKYQFEPKRIKMIYPRIYEQ 206

Query: 177 ASRILVTGRKGMRGQLRFRYPIVLHKPNGQ 206
           ++ +LV  R        F   + LH  + Q
Sbjct: 207 SNLVLVEARYKTGWGTHFEPNLYLHYEDKQ 236


>gi|224541620|ref|ZP_03682159.1| hypothetical protein CATMIT_00791 [Catenibacterium mitsuokai DSM
           15897]
 gi|224525458|gb|EEF94563.1| hypothetical protein CATMIT_00791 [Catenibacterium mitsuokai DSM
           15897]
          Length = 243

 Score = 41.2 bits (95), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 32/135 (23%), Positives = 60/135 (44%), Gaps = 22/135 (16%)

Query: 94  VIMNPPFNERIGTMTPDKIKEEAHV-----------MLEDSFEKWIRTACAIMRSSGQLS 142
           ++ NPPF          K+ E++H+            ++   E  I +A  I+  +G+ S
Sbjct: 113 IVCNPPFF---------KLGEKSHINESPYMTIARHEIKIDLEGIIASAAKILDQNGRFS 163

Query: 143 LIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLH 201
           ++ RP   I+ +    + RI    I  ++P+EG+  +  L+ G    +  L+   P+  H
Sbjct: 164 MVYRPDRFIETIELFKKYRIEPKRIRFVYPKEGKECNTFLIEGAFLGKTGLKIEPPLYTH 223

Query: 202 KPNGQPYSRFVTDLI 216
             +G  YS  V  L+
Sbjct: 224 NEDGS-YSDEVKQLV 237


>gi|261403492|ref|YP_003247716.1| methyltransferase small [Methanocaldococcus vulcanius M7]
 gi|261370485|gb|ACX73234.1| methyltransferase small [Methanocaldococcus vulcanius M7]
          Length = 196

 Score = 41.2 bits (95), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 57/128 (44%), Gaps = 16/128 (12%)

Query: 2   ILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLAL-PAN 60
           IL   V       + DLG G G  G+A+A  +         +S  MA   R+ + L   N
Sbjct: 46  ILVENVVVDKDDDILDLGCGYGVIGIALADEV---------KSVTMADINRRAIKLAKEN 96

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
            +++   +L   D+ +V  +     +K+  YD +I NPP   R G     +I EE   +L
Sbjct: 97  IKLN---NLENYDIRVVHSDL-YENVKDRKYDKIITNPPI--RAGKEVLHRIIEEGKELL 150

Query: 121 EDSFEKWI 128
           +D  E W+
Sbjct: 151 KDGGEIWV 158


>gi|54294351|ref|YP_126766.1| hypothetical protein lpl1419 [Legionella pneumophila str. Lens]
 gi|53754183|emb|CAH15659.1| hypothetical protein lpl1419 [Legionella pneumophila str. Lens]
          Length = 219

 Score = 41.2 bits (95), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 58/139 (41%), Gaps = 9/139 (6%)

Query: 11  GSFHLADLGAGAGAAGLAVASRLHEA-QILLAERSPLMAHYARKTLALPANAQISKRISL 69
           GS  + DL AG G  G+ ++  L    QI   E   +      + +A     ++  R  L
Sbjct: 47  GSLRVLDLCAGCGVIGIELSWYLQAIRQIDFIEIQDIYTECFYQNIANVNRPELQFRWHL 106

Query: 70  IEVDVTLVGENRNLAGLKNNFYDHVIMNPP-FNERIGTMTPDKIKEEAHVMLEDSFEKWI 128
           +  D        +    ++ F D +I NPP F    G ++P K K      L+ SF+ +I
Sbjct: 107 LNYD------ELHKKKWEDKF-DLIISNPPYFQPGHGMLSPSKFKNRCRFYLDSSFQSYI 159

Query: 129 RTACAIMRSSGQLSLIARP 147
           +     + + G+   + RP
Sbjct: 160 QALGNALANRGKAYFLLRP 178


>gi|297197714|ref|ZP_06915111.1| ribosomal RNA small subunit methyltransferase [Streptomyces sviceus
           ATCC 29083]
 gi|297146838|gb|EFH28371.1| ribosomal RNA small subunit methyltransferase [Streptomyces sviceus
           ATCC 29083]
          Length = 384

 Score = 41.2 bits (95), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 56/133 (42%), Gaps = 19/133 (14%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTL---AL 57
             L  L ++ GS  + DLG G G  G AVA    EA++L  + S      A  T     +
Sbjct: 227 FFLQHLPDSRGSQRVVDLGCGNGIVGTAVALANREAEVLFVDESFQAVASAEGTYKANGV 286

Query: 58  PANAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTM--TPDKIKEE 115
           P +A+              VG+   LAG+  +  D V+ NPPF+    T   T  ++  +
Sbjct: 287 PGHAEFR------------VGD--GLAGVPKDSVDLVLNNPPFHSHQATTDATAWRMFAD 332

Query: 116 AHVMLEDSFEKWI 128
           A   L    E W+
Sbjct: 333 ARRTLRPGGELWV 345


>gi|150015293|ref|YP_001307547.1| HemK family modification methylase [Clostridium beijerinckii NCIMB
           8052]
 gi|149901758|gb|ABR32591.1| modification methylase, HemK family [Clostridium beijerinckii NCIMB
           8052]
          Length = 586

 Score = 41.2 bits (95), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 66/147 (44%), Gaps = 19/147 (12%)

Query: 6   LVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISK 65
           ++       + DL +G+GA G+++A      ++ L +  P+     + +L      ++  
Sbjct: 410 IIEENQEMQICDLCSGSGAVGISLAHFRQNIKVDLIDYYPIPE---KVSLINIEKNKLED 466

Query: 66  RISLIEVDVTLVGENRNLAGLKNN-FYDHVIMNPPFNE--RIGTMTPDKIKEEAHVMLE- 121
           R+  I+ D  L+ E+     +KNN  YD ++ NPP+ E   IG +  D    E H  L  
Sbjct: 467 RVFFIKSD--LLEES-----IKNNKIYDIIVSNPPYIEECEIGKLMEDVKNYEPHTALNG 519

Query: 122 -----DSFEKWIRTACAIMRSSGQLSL 143
                D + K I  +   +R SG L+ 
Sbjct: 520 GNDGLDFYRKIIDQSQYTLRESGILAF 546


>gi|294673578|ref|YP_003574194.1| hypothetical protein PRU_0841 [Prevotella ruminicola 23]
 gi|294471995|gb|ADE81384.1| conserved hypothetical protein [Prevotella ruminicola 23]
          Length = 236

 Score = 41.2 bits (95), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 83/194 (42%), Gaps = 25/194 (12%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           D+G G G   L +A R  EAQ+   +     A  A++ +     +  S RI +   D T 
Sbjct: 44  DIGTGTGLVALMMAQRFPEAQVTGIDIDEDAAQQAQENV---VGSPFSDRIMINREDATK 100

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNERIGTMT-PDKIKEEAHVMLEDSFEKWIRTACAIM 135
           + +    AG     YD ++ NPP+   + ++T P   +  A   +  ++E  +  A  ++
Sbjct: 101 IDDK---AG-----YDAIVCNPPY--FVDSLTCPQDQRTLARHAVSLTYESLMHAASKLL 150

Query: 136 RSSGQLSLIARPQSLIQIVNACA------RRIGSLEITPLHPREGECASRILVTGRKGMR 189
           + +G LSL+    +   + +A A       RI  ++ TP      +   R LV  RK   
Sbjct: 151 KPNGILSLVIPADNQDNVESAAAFEGLFLTRICLIKTTP-----NKLPKRHLVEFRKHPV 205

Query: 190 GQLRFRYPIVLHKP 203
            Q+ F   ++   P
Sbjct: 206 EQVNFEEQVLESCP 219


>gi|326802972|ref|YP_004320790.1| methyltransferase small domain protein [Aerococcus urinae
           ACS-120-V-Col10a]
 gi|326651547|gb|AEA01730.1| methyltransferase small domain protein [Aerococcus urinae
           ACS-120-V-Col10a]
          Length = 247

 Score = 41.2 bits (95), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 94/201 (46%), Gaps = 17/201 (8%)

Query: 7   VNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALP-ANAQISK 65
           V  T    + D  +G GA  L + S + +A I   E  P +A  AR+++AL     QI+ 
Sbjct: 41  VRKTKKQKIVDFCSGNGAIPL-ILSAMTDAPIEAIEIQPELADMARRSVALNHLEEQITI 99

Query: 66  RISLIEVDVTLVG-ENRNLAGLKNNFYDHVIMNPPFNERI--GTMTPDKIKEEAHVMLED 122
               I+   +LV  E+ N+          +  NPP+ +      + P+  K  A   +  
Sbjct: 100 HTGNIKSATSLVKPESVNM----------ITCNPPYFKVYPDSWINPNDKKALARHEIAM 149

Query: 123 SFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRIL 181
           + E   + + A+++  G+L L+ RP+ L +++ A  + R+    +  +HP+  + A+ +L
Sbjct: 150 TLEDIFKQSQALLKERGRLVLVHRPERLTEMIQAGLKYRLIPKRLRFVHPKPDKPANTLL 209

Query: 182 VTG-RKGMRGQLRFRYPIVLH 201
           +   ++G    L+   P+ ++
Sbjct: 210 IDFMKQGQEKGLQVLPPLYVY 230


>gi|296131640|ref|YP_003638887.1| Methyltransferase type 11 [Thermincola sp. JR]
 gi|296030218|gb|ADG80986.1| Methyltransferase type 11 [Thermincola potens JR]
          Length = 253

 Score = 41.2 bits (95), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 46/208 (22%), Positives = 93/208 (44%), Gaps = 12/208 (5%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA+  +      + DLG G+G   + + +R     I+  +   + A    + +   A 
Sbjct: 41  VLLANFASVKKGDLIVDLGTGSGVIPILLTTRQQVDHIIGID---IQAEAVDRAVRSVAG 97

Query: 61  AQISKRISLIEVDVTLVGENRNL-AGLKNNFYDHVIMNPPF-NERIGTMTPDKIKEEAHV 118
             +   I++ E D+      RN  A L    +D V  NPP+     G ++P+K    A  
Sbjct: 98  NGLQGLITIREGDI------RNASAELGLGKFDLVTANPPYLPAGQGKISPNKEIALARH 151

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARR-IGSLEITPLHPREGECA 177
            L  S E  +R    ++ S+G+L+++ RP+ ++ I+    R  +    +  ++P  G+  
Sbjct: 152 ELCCSMEDVLREGARLLNSNGRLAMVHRPERMVDIIFTMKRYGLEPKRLQLVYPALGKKP 211

Query: 178 SRILVTGRKGMRGQLRFRYPIVLHKPNG 205
           + +L+   KG    L    P++++   G
Sbjct: 212 NILLIEAIKGAMPGLEALEPLLVYDEQG 239


>gi|327405947|ref|YP_004346785.1| methyltransferase small [Fluviicola taffensis DSM 16823]
 gi|327321455|gb|AEA45947.1| methyltransferase small [Fluviicola taffensis DSM 16823]
          Length = 233

 Score = 41.2 bits (95), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 70/167 (41%), Gaps = 15/167 (8%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           MIL SL        L D+G G G   L  A R    +I+  E S               +
Sbjct: 25  MILGSLCGWENPKRLLDIGTGTGVLALMCAQRFPFQEIIGLEISEEAI----------ID 74

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
           AQI+ + +  +  +T+V +       K  F D +I NPPF E   +  P+  K  A    
Sbjct: 75  AQINAQNNPFDTKITIVNQAIQDYKPKEKF-DAIISNPPFFEN-SSKNPNDQKSLARHTE 132

Query: 121 EDSFEKWIRTACAIMRSSGQLSLI---ARPQSLIQIVNACARRIGSL 164
             SF + +++   ++ + G+  +I      +++IQ+ NA    I  L
Sbjct: 133 SLSFSELLQSITRLLTAEGKAWIIIPFESTENIIQLANANELFIADL 179


>gi|145636784|ref|ZP_01792450.1| 16S ribosomal RNA m2G1207 methyltransferase [Haemophilus influenzae
           PittHH]
 gi|148825706|ref|YP_001290459.1| 16S ribosomal RNA m2G1207 methyltransferase [Haemophilus influenzae
           PittEE]
 gi|229846931|ref|ZP_04467037.1| 16S ribosomal RNA m2G1207 methyltransferase [Haemophilus influenzae
           7P49H1]
 gi|226712955|sp|A5UBC5|RSMC_HAEIE RecName: Full=Ribosomal RNA small subunit methyltransferase C;
           AltName: Full=16S rRNA m2G1207 methyltransferase;
           AltName: Full=rRNA (guanine-N(2)-)-methyltransferase
           rsmC
 gi|145270082|gb|EDK10019.1| 16S ribosomal RNA m2G1207 methyltransferase [Haemophilus influenzae
           PittHH]
 gi|148715866|gb|ABQ98076.1| 16S ribosomal RNA m2G1207 methyltransferase [Haemophilus influenzae
           PittEE]
 gi|229810015|gb|EEP45735.1| 16S ribosomal RNA m2G1207 methyltransferase [Haemophilus influenzae
           7P49H1]
          Length = 330

 Score = 41.2 bits (95), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 43/90 (47%), Gaps = 14/90 (15%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DLG GAG  G  +  R+  AQI + +   +    ARKTL   +  Q+  ++   +V   +
Sbjct: 196 DLGCGAGVIGSMIKKRVPNAQITMTDIHAMALESARKTL---SENQLQGKVYASDVFSDI 252

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNERIGT 106
            G+           +D +I NPPF++ I T
Sbjct: 253 EGK-----------FDLIISNPPFHDGIDT 271


>gi|145630402|ref|ZP_01786183.1| phosphatidylserine synthase [Haemophilus influenzae R3021]
 gi|144984137|gb|EDJ91574.1| phosphatidylserine synthase [Haemophilus influenzae R3021]
          Length = 232

 Score = 40.8 bits (94), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 42/213 (19%), Positives = 96/213 (45%), Gaps = 16/213 (7%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHE-AQILLAERSPLMAHYARKTLALPA 59
           ++L +  +     ++ D+G+G G   L +A R  E  QI   E  P+ A  A++ +    
Sbjct: 25  ILLGAWADVKHCKNILDMGSGTGLLALMLAQRTEENCQIQAVELDPIAAKQAQENI---N 81

Query: 60  NAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVM 119
           N+    RI L + D+      ++        +D ++ NPP+ E+ G    ++ +  A   
Sbjct: 82  NSVWKNRIQLTQADI------QHFLQTTEQTFDLIVANPPYFEQ-GIACKNEERALARYT 134

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASR 179
            + S   W+  A   +  +G++S +   ++   +  + A  +  ++ T +  + G+   R
Sbjct: 135 -KQSHLNWLEWAATRLSENGKISFVLPYEAGKTLTKSTA--LFCIKQTNVITKIGKTPQR 191

Query: 180 ILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFV 212
           +L+T  K  + ++  +  +V++  + Q    F+
Sbjct: 192 MLLTFAK--QPEVLMQDQLVIYDADNQYTEAFI 222


>gi|319425287|gb|ADV53361.1| methyltransferase small [Shewanella putrefaciens 200]
          Length = 238

 Score = 40.8 bits (94), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 81/183 (44%), Gaps = 10/183 (5%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++L +    T +  + D+GAG+G  GL  A R  +A I   E     A   +  +   A 
Sbjct: 24  VVLGAWAPLTNAKQILDIGAGSGILGLMAAQR-SQANITCIELDDTAAIACQHNI---AQ 79

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
           +  + RI L++  +  + +     G    ++DH+I NPP+ E  G       +  A    
Sbjct: 80  SPWASRIRLVQGSIQQLSQAEEYQG----YFDHIICNPPYFEH-GPQAQLSQRAMARHTD 134

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASR 179
           + SF + +      +  +G  SLI   QSL    +  ++ R+  +E   +   EG+ A+R
Sbjct: 135 QLSFNELLAAIEQCLSPNGLASLILPIQSLHNFNHLLSQSRLEWVERVDIKSVEGKRANR 194

Query: 180 ILV 182
           +L 
Sbjct: 195 VLC 197


>gi|308177223|ref|YP_003916629.1| site-specific DNA-methyltransferase (adenine specific)
           [Arthrobacter arilaitensis Re117]
 gi|307744686|emb|CBT75658.1| putative site-specific DNA-methyltransferase (adenine specific)
           [Arthrobacter arilaitensis Re117]
          Length = 194

 Score = 40.8 bits (94), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 59/115 (51%), Gaps = 9/115 (7%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLI--EVDV 74
           DL AG+G+ G+  ASR    Q++L E++P      +   AL      +  +++    VD 
Sbjct: 50  DLFAGSGSLGIETASR-GARQVVLVEKAPKAVAVCQHNAALVNKVLKTNTVTVQRGNVDS 108

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPF--NERIGTMTPDKIK----EEAHVMLEDS 123
            L G    ++G+ +  +D V+M+PP+   E    +T +KI     E+A V++E S
Sbjct: 109 VLDGYYNAISGVPSKTFDVVLMDPPYPLAEEELAITLEKISKILAEDATVIIERS 163


>gi|227486733|ref|ZP_03917049.1| possible methyltransferase [Anaerococcus lactolyticus ATCC 51172]
 gi|227235321|gb|EEI85336.1| possible methyltransferase [Anaerococcus lactolyticus ATCC 51172]
          Length = 236

 Score = 40.8 bits (94), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 45/210 (21%), Positives = 95/210 (45%), Gaps = 27/210 (12%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA       +  L D+G+G G   + +A+ L++ + + A     +     KT  L  N
Sbjct: 28  ILLADFAKMKKNKILLDIGSGNGILAM-MANSLYDLEKVYA-----VEIQGAKTKILKEN 81

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF---NERIGTMTPDKI--KEE 115
             ++   ++  ++  L     N    K N  D++I NPP+   ++ I     + +  ++E
Sbjct: 82  LDLNGINNIEIINEDL-----NKVDFKENSLDYIITNPPYYKIDQNIKNKDEEYLISRQE 136

Query: 116 AHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGE 175
            ++ L+D F      A   ++  G+L +I +P+ +++I N      G+L+   +      
Sbjct: 137 LYLNLDDIFA----FANKSLKDKGKLFMIHKPERMVEIFNKS----GNLKPKRIRFVSST 188

Query: 176 CASR---ILVTGRKGMRGQLRFRYPIVLHK 202
             +R   IL+   K  +  L+   PI+++K
Sbjct: 189 YDTRPQFILIEFVKNAKDGLKIENPIIIYK 218


>gi|229077311|ref|ZP_04209992.1| hypothetical protein bcere0023_360 [Bacillus cereus Rock4-2]
 gi|228706002|gb|EEL58309.1| hypothetical protein bcere0023_360 [Bacillus cereus Rock4-2]
          Length = 338

 Score = 40.8 bits (94), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 33/148 (22%), Positives = 71/148 (47%), Gaps = 10/148 (6%)

Query: 63  ISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLED 122
           + +RI LI  D+  + E      L  + YD V  NPP+ +   T +   + E   +   +
Sbjct: 92  LEERIHLIHGDLKDMPEK-----LGRHQYDVVTCNPPYFQTPQT-SEKNMNEHLAIARHE 145

Query: 123 ---SFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECAS 178
              + E  +  +  +++  G+++ + RP  L+ IV    + +I    +  ++P+ G+ A+
Sbjct: 146 IMCTLEDVVSVSSQLVKQGGKVAFVHRPGRLLDIVTLMRKYKIEPKRVQFVYPKVGKEAN 205

Query: 179 RILVTGRKGMRGQLRFRYPIVLHKPNGQ 206
            +L+ G K     L+   P+V+++ N +
Sbjct: 206 TLLIEGIKDGNADLKILPPLVVYENNNE 233


>gi|52841834|ref|YP_095633.1| hypothetical protein lpg1606 [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|52628945|gb|AAU27686.1| hypothetical protein lpg1606 [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
          Length = 219

 Score = 40.8 bits (94), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 58/139 (41%), Gaps = 9/139 (6%)

Query: 11  GSFHLADLGAGAGAAGLAVASRLHEA-QILLAERSPLMAHYARKTLALPANAQISKRISL 69
           GS  + DL AG G  G+ ++  L    QI   E   +      + +A     ++  R  L
Sbjct: 47  GSLRVLDLCAGCGVIGIELSWYLQAIRQIDFIEIQDIYTECFYQNIANVNRPELQFRWHL 106

Query: 70  IEVDVTLVGENRNLAGLKNNFYDHVIMNPP-FNERIGTMTPDKIKEEAHVMLEDSFEKWI 128
           +  D        +    ++ F D +I NPP F    G ++P K K      L+ SF+ +I
Sbjct: 107 LNYD------ELHKKKWEDKF-DLIISNPPYFQPGHGMLSPSKFKNRCRFYLDSSFQSYI 159

Query: 129 RTACAIMRSSGQLSLIARP 147
           +     + + G+   + RP
Sbjct: 160 QALGNSLANRGKAYFLLRP 178


>gi|18311185|ref|NP_563119.1| hypothetical protein CPE2203 [Clostridium perfringens str. 13]
 gi|18145868|dbj|BAB81909.1| conserved hypothetical protein [Clostridium perfringens str. 13]
          Length = 569

 Score = 40.8 bits (94), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 66/145 (45%), Gaps = 17/145 (11%)

Query: 7   VNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKR 66
           ++     ++ DL  G+GA GL++A+      + L +   +     RK +      ++SKR
Sbjct: 391 IDEDAEINVCDLCCGSGAIGLSLANYRKNIIVDLVDIDDIPEKVTRKNI---RELELSKR 447

Query: 67  ISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF--NERIGTMTPDKIKEEAHVML---E 121
              I+ D  L+ E       K N YD ++ NPP+   E I T+  D    E H+ L   E
Sbjct: 448 CGFIKSD--LLSEVIK----KGNKYDILVSNPPYIRTEVINTLMEDVKDYEPHLALDGGE 501

Query: 122 DS---FEKWIRTACAIMRSSGQLSL 143
           D    + + I  +  +++ +G L+ 
Sbjct: 502 DGLIFYRRIIDESLEVLKENGILAF 526


>gi|296474810|gb|DAA16925.1| HemK methyltransferase family member 1 [Bos taurus]
          Length = 321

 Score = 40.8 bits (94), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 72/154 (46%), Gaps = 19/154 (12%)

Query: 6   LVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSP---LMAHYARKTLALPANAQ 62
           +V A G   + ++G G+GA  L++ SRL ++++   ++      + H   + L L A   
Sbjct: 147 VVGAEGGPLILEVGCGSGAISLSLLSRLPQSRVTAVDKGEAAICLTHENAQRLRLQA--- 203

Query: 63  ISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPP--FNERIGTMTPDKIKEEAHVML 120
              RI ++  DVTLV    +L  L     D V+ NPP  F+  +  + P+ ++ E  V L
Sbjct: 204 ---RIQIVTFDVTLVESWAHL--LPWGPVDLVVSNPPYVFHRDMENLAPEILRYEDPVAL 258

Query: 121 E------DSFEKWIRTACAIMRSSGQLSLIARPQ 148
           +      D     +  A  +++ SG + L   P+
Sbjct: 259 DGGEEGMDIITHILALAPQLLKDSGSIFLEVDPR 292


>gi|222100868|ref|YP_002535436.1| Methyltransferase type 11 [Thermotoga neapolitana DSM 4359]
 gi|221573258|gb|ACM24070.1| Methyltransferase type 11 [Thermotoga neapolitana DSM 4359]
          Length = 216

 Score = 40.8 bits (94), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 36/193 (18%), Positives = 84/193 (43%), Gaps = 14/193 (7%)

Query: 9   ATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRIS 68
           + G   + +LG+G G  G A+A RL+  +++  E+   +   A + ++L           
Sbjct: 36  SKGVKRVLELGSGVGTVGFALA-RLYGVEVVGVEKEKELYEKAVQGISLNG--------- 85

Query: 69  LIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWI 128
            +E  V+ V  +          +D V+ NPP   ++ +  P  ++     + +   E ++
Sbjct: 86  -LEGKVSFVNASVEDCSFPPESFDMVVSNPPHYTKVKSPYP--LRSSTRSLEKSDIESFV 142

Query: 129 RTACAIMRSSGQLSLIARPQSLIQIVN-ACARRIGSLEITPLHPREGECASRILVTGRKG 187
           +T    +++ G    +  P++L+  +    + R+    +  +H +    A+ +L+  +K 
Sbjct: 143 KTTFRFLKNGGMAVYVLSPENLMDWLERFISYRLEPKRMCFVHGKIDRTATLVLLRLKKN 202

Query: 188 MRGQLRFRYPIVL 200
            +  L    P+VL
Sbjct: 203 GKRGLVVDPPVVL 215


>gi|120600079|ref|YP_964653.1| type 12 methyltransferase [Shewanella sp. W3-18-1]
 gi|262828731|sp|A1RN54|TRMN6_SHESW RecName: Full=tRNA (adenine-N(6)-)-methyltransferase; AltName:
           Full=tRNA m6A37 methyltransferase
 gi|120560172|gb|ABM26099.1| Methyltransferase type 12 [Shewanella sp. W3-18-1]
          Length = 238

 Score = 40.8 bits (94), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 81/183 (44%), Gaps = 10/183 (5%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++L +    T +  + D+GAG+G  GL  A R  +A I   E     A   +  +   A 
Sbjct: 24  VVLGAWAPLTNAKQILDIGAGSGILGLMAAQR-SQANITCIELDDTAAIACQHNI---AQ 79

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
           +  + RI L++  +  + +     G    ++DH+I NPP+ E  G       +  A    
Sbjct: 80  SPWASRIRLVQGSIQQLSQAEEYQG----YFDHIICNPPYFEH-GPQAQLSQRAMARHTD 134

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASR 179
           + SF + +      +  +G  SLI   QSL    +  ++ R+  +E   +   EG+ A+R
Sbjct: 135 QLSFNELLAAIEQCLSPNGLASLILPIQSLHNFNHLLSQSRLEWVERVDIKSVEGKRANR 194

Query: 180 ILV 182
           +L 
Sbjct: 195 VLC 197


>gi|168213693|ref|ZP_02639318.1| protein- methyltransferase, release factor-specific [Clostridium
           perfringens CPE str. F4969]
 gi|170714843|gb|EDT27025.1| protein- methyltransferase, release factor-specific [Clostridium
           perfringens CPE str. F4969]
          Length = 587

 Score = 40.8 bits (94), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 66/145 (45%), Gaps = 17/145 (11%)

Query: 7   VNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKR 66
           ++     ++ DL  G+GA GL++A+      + L +   +     RK +      ++SKR
Sbjct: 409 IDEDAEINVCDLCCGSGAIGLSLANYRKNIIVDLVDIDDIPEKVTRKNI---RELELSKR 465

Query: 67  ISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF--NERIGTMTPDKIKEEAHVML---E 121
              I+ D  L+ E       K N YD ++ NPP+   E I T+  D    E H+ L   E
Sbjct: 466 CGFIKSD--LLSEVIK----KGNKYDILVSNPPYIRTEVINTLMEDVKDYEPHLALDGGE 519

Query: 122 DS---FEKWIRTACAIMRSSGQLSL 143
           D    + + I  +  +++ +G L+ 
Sbjct: 520 DGLIFYRRIIDESLEVLKENGILAF 544


>gi|110803251|ref|YP_699477.1| HemK family modification methylase [Clostridium perfringens SM101]
 gi|110683752|gb|ABG87122.1| modification methylase, HemK family [Clostridium perfringens SM101]
          Length = 587

 Score = 40.8 bits (94), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 66/145 (45%), Gaps = 17/145 (11%)

Query: 7   VNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKR 66
           ++     ++ DL  G+GA GL++A+      + L +   +     RK +      ++SKR
Sbjct: 409 IDEDAEINVCDLCCGSGAIGLSLANYRKNIIVDLVDIDDIPEKVTRKNI---RELELSKR 465

Query: 67  ISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF--NERIGTMTPDKIKEEAHVML---E 121
              I+ D  L+ E       K N YD ++ NPP+   E I T+  D    E H+ L   E
Sbjct: 466 CGFIKSD--LLSEVIK----KGNKYDILVSNPPYIRTEVINTLMKDVKDYEPHLALDGGE 519

Query: 122 DS---FEKWIRTACAIMRSSGQLSL 143
           D    + + I  +  +++ +G L+ 
Sbjct: 520 DGLIFYRRIIDESLEVLKENGILAF 544


>gi|15828943|ref|NP_326303.1| DNA methylase [Mycoplasma pulmonis UAB CTIP]
 gi|14089886|emb|CAC13645.1| DNA METHYLASE [Mycoplasma pulmonis]
          Length = 267

 Score = 40.8 bits (94), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 48/213 (22%), Positives = 90/213 (42%), Gaps = 9/213 (4%)

Query: 1   MILASLVNATGSFHLA-DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPA 59
           ++L + ++ T S   A ++GA  GA  + VASR  + +I   E     +  A+K + L  
Sbjct: 45  ILLGNFIHLTTSIKYALEIGANNGALSIFVASRKKDLKIDAVEIQKEPSELAQKNVEL-- 102

Query: 60  NAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFN--ERIGTMTPDKIKEEAH 117
              +  +I +I  D     +N     LK   Y  + +NPP+   ++  T   +K K  A 
Sbjct: 103 -NNLESQIKIINQDFNDFYKNHQKNTLKK--YQSIFVNPPYYQLDKNKTKKIEKSKLIAT 159

Query: 118 VMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGEC 176
             +  + E+ I+ +  I+   G L+ +   + L+ +     +       +  ++PR  E 
Sbjct: 160 HEVSINLEQIIKGSRGIIEQKGYLNFVIPIERLVDLFYLLRKYNFEPKRVQLVYPRIYEK 219

Query: 177 ASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYS 209
           A   LV  R      + F   + LH  +   +S
Sbjct: 220 AKFALVESRFNSGWGVHFLKNLYLHPEDKNDHS 252


>gi|78369416|ref|NP_001030385.1| hemK methyltransferase family member 1 [Bos taurus]
 gi|74354715|gb|AAI02829.1| HemK methyltransferase family member 1 [Bos taurus]
          Length = 321

 Score = 40.8 bits (94), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 71/154 (46%), Gaps = 19/154 (12%)

Query: 6   LVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQ--- 62
           +V A G   + ++G G+GA  L++ SRL ++++   ++         +      NAQ   
Sbjct: 147 VVGAEGGPLILEVGCGSGAISLSLLSRLPQSRVTAVDKGEAAICLTHE------NAQRLR 200

Query: 63  ISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPP--FNERIGTMTPDKIKEEAHVML 120
           +  RI ++  DVTLV    +L  L     D V+ NPP  F+  +  + P+ ++ E  V L
Sbjct: 201 LQDRIQIVPFDVTLVESWAHL--LPWGPVDLVVSNPPYVFHRDMENLAPEILRYEDPVAL 258

Query: 121 E------DSFEKWIRTACAIMRSSGQLSLIARPQ 148
           +      D     +  A  +++ SG + L   P+
Sbjct: 259 DGGEEGMDIITHILALAPQLLKDSGSIFLEVDPR 292


>gi|227546610|ref|ZP_03976659.1| HemK family modification methylase [Bifidobacterium longum subsp.
           infantis ATCC 55813]
 gi|227212927|gb|EEI80806.1| HemK family modification methylase [Bifidobacterium longum subsp.
           infantis ATCC 55813]
          Length = 302

 Score = 40.8 bits (94), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 41/88 (46%), Gaps = 6/88 (6%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN--AQISKRISLIEV 72
           + DL AG+GA GL+V S +  +Q+   E SP  A + R+ L+  A     I+    L   
Sbjct: 129 VVDLCAGSGAIGLSVVSEVPGSQVWAVELSPNTAEWTRRNLSETAKKYPSIASNYHLEIA 188

Query: 73  DVTLVGENRNLAGLKNNFYDHVIMNPPF 100
           D T       L G      D VI NPP+
Sbjct: 189 DATSFATLAQLDGT----VDIVITNPPY 212


>gi|330723257|gb|AEC45627.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Mycoplasma hyorhinis MCLD]
          Length = 243

 Score = 40.8 bits (94), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 60/128 (46%), Gaps = 24/128 (18%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           +IL +     G   + DLG G+G  GLA+A      Q++L++        ++  L    N
Sbjct: 72  LILQAYKYINGQSTVLDLGCGSGFIGLAIAKNTKAKQVVLSDID------SQAILQSKIN 125

Query: 61  AQISK-RISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVM 119
           A+++K ++ +I+ D+           LK   +D +I NPP+      +  +K K ++ V+
Sbjct: 126 AKLNKLKVKIIQSDL--------FDNLKKYKFDVIICNPPY------LDFEKSKLDSSVL 171

Query: 120 LEDSFEKW 127
               +E W
Sbjct: 172 ---DYEPW 176


>gi|239621641|ref|ZP_04664672.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           infantis CCUG 52486]
 gi|239515516|gb|EEQ55383.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           infantis CCUG 52486]
          Length = 302

 Score = 40.8 bits (94), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 41/88 (46%), Gaps = 6/88 (6%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN--AQISKRISLIEV 72
           + DL AG+GA GL+V S +  +Q+   E SP  A + R+ L+  A     I+    L   
Sbjct: 129 VVDLCAGSGAIGLSVVSEVPGSQVWAVELSPNTAEWTRRNLSETAKKYPSIASNYHLEIA 188

Query: 73  DVTLVGENRNLAGLKNNFYDHVIMNPPF 100
           D T       L G      D VI NPP+
Sbjct: 189 DATSFATLAQLDGT----VDIVITNPPY 212


>gi|182623922|ref|ZP_02951710.1| methyltransferase, HemK family [Clostridium perfringens D str.
           JGS1721]
 gi|177910815|gb|EDT73169.1| methyltransferase, HemK family [Clostridium perfringens D str.
           JGS1721]
          Length = 587

 Score = 40.8 bits (94), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 66/145 (45%), Gaps = 17/145 (11%)

Query: 7   VNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKR 66
           ++     ++ DL  G+GA GL++A+      + L +   +     RK +      ++SKR
Sbjct: 409 IDEDAEINVCDLCCGSGAIGLSLANYRKNIIVDLVDIDDIPEKVTRKNI---RELELSKR 465

Query: 67  ISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF--NERIGTMTPDKIKEEAHVML---E 121
              I+ D  L+ E       K N YD ++ NPP+   E I T+  D    E H+ L   E
Sbjct: 466 CGFIKSD--LLSEVIK----KGNKYDILVSNPPYIRTEVINTLMEDVKDYEPHLALDGGE 519

Query: 122 DS---FEKWIRTACAIMRSSGQLSL 143
           D    + + I  +  +++ +G L+ 
Sbjct: 520 DGLIFYRRIIDESLEVLKENGILAF 544


>gi|119945956|ref|YP_943636.1| rRNA (guanine-N(2)-)-methyltransferase [Psychromonas ingrahamii 37]
 gi|229564338|sp|A1SX22|RLMG_PSYIN RecName: Full=Ribosomal RNA large subunit methyltransferase G;
           AltName: Full=23S rRNA m2G1835 methyltransferase;
           AltName: Full=rRNA (guanine-N(2)-)-methyltransferase
           rlmG
 gi|119864560|gb|ABM04037.1| rRNA (guanine-N(2)-)-methyltransferase [Psychromonas ingrahamii 37]
          Length = 382

 Score = 40.8 bits (94), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 56/122 (45%), Gaps = 19/122 (15%)

Query: 11  GSF-HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLA--LPANAQISKRI 67
           G F  + DLG G G  G+A ++   +AQI   + S +    AR  +   LP     + R 
Sbjct: 233 GDFSKVVDLGCGNGIIGMAASAAYPKAQITFIDESYMSIDSARINMQKNLPEEQAENARF 292

Query: 68  SLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIK----EEAHVMLEDS 123
            +          N  L G K   YD ++ NPPF+++  T+T D+I      +AH  L D+
Sbjct: 293 VV----------NNGLVGFKPRSYDLILCNPPFHQQ-QTIT-DQIAWSMFNDAHFCLVDN 340

Query: 124 FE 125
            E
Sbjct: 341 GE 342


>gi|304373117|ref|YP_003856326.1| Protein-(Glutamine-N5) methyltransferase, release factor-specific
           [Mycoplasma hyorhinis HUB-1]
 gi|304309308|gb|ADM21788.1| Protein-(Glutamine-N5) methyltransferase, release factor-specific
           [Mycoplasma hyorhinis HUB-1]
          Length = 243

 Score = 40.8 bits (94), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 60/128 (46%), Gaps = 24/128 (18%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           +IL +     G   + DLG G+G  GLA+A      Q++L++        ++  L    N
Sbjct: 72  LILQAYKYINGQSTVLDLGCGSGFIGLAIAKNTKAKQVVLSDID------SQAILQSKIN 125

Query: 61  AQISK-RISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVM 119
           A+++K ++ +I+ D+           LK   +D +I NPP+      +  +K K ++ V+
Sbjct: 126 AKLNKLKVKIIQSDL--------FDNLKKYKFDVIICNPPY------LDFEKSKLDSSVL 171

Query: 120 LEDSFEKW 127
               +E W
Sbjct: 172 ---DYEPW 176


>gi|182420442|ref|ZP_02641457.2| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Clostridium perfringens NCTC 8239]
 gi|182382208|gb|EDT79687.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Clostridium perfringens NCTC 8239]
          Length = 572

 Score = 40.8 bits (94), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 66/145 (45%), Gaps = 17/145 (11%)

Query: 7   VNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKR 66
           ++     ++ DL  G+GA GL++A+      + L +   +     RK +      ++SKR
Sbjct: 394 IDEDAEINVCDLCCGSGAIGLSLANYRKNIIVDLVDIDDIPEKVTRKNI---RELELSKR 450

Query: 67  ISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF--NERIGTMTPDKIKEEAHVML---E 121
              I+ D  L+ E       K N YD ++ NPP+   E I T+  D    E H+ L   E
Sbjct: 451 CGFIKSD--LLSEVIK----KGNKYDILVSNPPYIRTEVINTLMEDVKDYEPHLALDGGE 504

Query: 122 DS---FEKWIRTACAIMRSSGQLSL 143
           D    + + I  +  +++ +G L+ 
Sbjct: 505 DGLIFYRRIIDESLEVLKENGILAF 529


>gi|322691738|ref|YP_004221308.1| methylase [Bifidobacterium longum subsp. longum JCM 1217]
 gi|320456594|dbj|BAJ67216.1| putative methylase [Bifidobacterium longum subsp. longum JCM 1217]
          Length = 294

 Score = 40.8 bits (94), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 41/88 (46%), Gaps = 6/88 (6%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN--AQISKRISLIEV 72
           + DL AG+GA GL+V S +  +Q+   E SP  A + R+ L+  A     I+    L   
Sbjct: 121 VVDLCAGSGAIGLSVVSEVPGSQVWAVELSPNTAEWTRRNLSETAKKYPSIASNYHLEIA 180

Query: 73  DVTLVGENRNLAGLKNNFYDHVIMNPPF 100
           D T       L G      D VI NPP+
Sbjct: 181 DATSFATLAQLDGT----VDIVITNPPY 204


>gi|320353479|ref|YP_004194818.1| methyltransferase small [Desulfobulbus propionicus DSM 2032]
 gi|320121981|gb|ADW17527.1| methyltransferase small [Desulfobulbus propionicus DSM 2032]
          Length = 261

 Score = 40.8 bits (94), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 46/200 (23%), Positives = 81/200 (40%), Gaps = 15/200 (7%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           L DLG G G  GL +A R     ++  E    +A    +   L        R+ ++  DV
Sbjct: 57  LLDLGCGCGVIGLILAHRHAHIAVVSLELQEELAALTEENSRLNG---FGDRLRVVRGDV 113

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNE-RIGTMTPDKIKEEAHVMLEDSFEKWIRTACA 133
             VGE      L     D V+ NPP+     G +  D+    A   +  +   ++R A  
Sbjct: 114 RTVGEV-----LPPESVDWVVCNPPYGRPDSGRVNQDRQAARARHEVSGTLADFVRAAAF 168

Query: 134 IMRSSGQLSLIA---RPQSLIQIVNACARRIGSLEITPLHPREGECASR-ILVTGRKGMR 189
            +R+ G++  +    R  +L+Q ++    R+    + P++   G   +R +LV   K   
Sbjct: 169 CVRNRGRVVFVYPARRCNTLLQALH--THRLTPKRLQPVYSYPGTDNARLVLVEAMKNGG 226

Query: 190 GQLRFRYPIVLHKPNGQPYS 209
            Q+    P  L++     Y+
Sbjct: 227 EQIDILSPFYLYERKNGEYT 246


>gi|23466258|ref|NP_696861.1| methylase protein [Bifidobacterium longum NCC2705]
 gi|46190986|ref|ZP_00120803.2| COG2890: Methylase of polypeptide chain release factors
           [Bifidobacterium longum DJO10A]
 gi|189440752|ref|YP_001955833.1| methylase of polypeptide chain release factor [Bifidobacterium
           longum DJO10A]
 gi|312134005|ref|YP_004001344.1| hemk [Bifidobacterium longum subsp. longum BBMN68]
 gi|317482078|ref|ZP_07941102.1| protein-(glutamine-N5) methyltransferase [Bifidobacterium sp.
           12_1_47BFAA]
 gi|23327006|gb|AAN25497.1| possible methylase protein [Bifidobacterium longum NCC2705]
 gi|189429187|gb|ACD99335.1| Methylase of polypeptide chain release factor [Bifidobacterium
           longum DJO10A]
 gi|311773308|gb|ADQ02796.1| HemK [Bifidobacterium longum subsp. longum BBMN68]
 gi|316916437|gb|EFV37835.1| protein-(glutamine-N5) methyltransferase [Bifidobacterium sp.
           12_1_47BFAA]
          Length = 294

 Score = 40.8 bits (94), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 41/88 (46%), Gaps = 6/88 (6%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANA--QISKRISLIEV 72
           + DL AG+GA GL+V S +  +Q+   E SP  A + R+ L+  A     I+    L   
Sbjct: 121 VVDLCAGSGAIGLSVVSEVPGSQVWAVELSPNTAEWTRRNLSETAKKYPSIASNYHLEIA 180

Query: 73  DVTLVGENRNLAGLKNNFYDHVIMNPPF 100
           D T       L G      D VI NPP+
Sbjct: 181 DATSFATLAQLDGT----VDIVITNPPY 204


>gi|322689792|ref|YP_004209526.1| methylase [Bifidobacterium longum subsp. infantis 157F]
 gi|320461128|dbj|BAJ71748.1| putative methylase [Bifidobacterium longum subsp. infantis 157F]
          Length = 294

 Score = 40.8 bits (94), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 41/88 (46%), Gaps = 6/88 (6%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN--AQISKRISLIEV 72
           + DL AG+GA GL+V S +  +Q+   E SP  A + R+ L+  A     I+    L   
Sbjct: 121 VVDLCAGSGAIGLSVVSEVPGSQVWAVELSPNTAEWTRRNLSETAKKYPSIASNYHLEIA 180

Query: 73  DVTLVGENRNLAGLKNNFYDHVIMNPPF 100
           D T       L G      D VI NPP+
Sbjct: 181 DATSFATLAQLDGT----VDIVITNPPY 204


>gi|83591212|ref|YP_431221.1| HemK family modification methylase [Moorella thermoacetica ATCC
           39073]
 gi|83574126|gb|ABC20678.1| [protein release factor]-glutamine N5-methyltransferase [Moorella
           thermoacetica ATCC 39073]
          Length = 283

 Score = 40.4 bits (93), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 44/166 (26%), Positives = 77/166 (46%), Gaps = 33/166 (19%)

Query: 12  SFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQ---ISKRIS 68
           S+ +AD G G+GA  L++A  L  A++   + SP     A++      NA+   ++ R++
Sbjct: 113 SYTIADCGTGSGAIALSLAHYLPRARVYATDISPAALTVAQE------NARKLGLAARVT 166

Query: 69  LIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMT----PDKIKEEAHVMLE--- 121
           L++ D         LA L+    D ++ NPP+   I T      P  ++ E  + L+   
Sbjct: 167 LLQGDF--------LAPLRGLKLDALVANPPY---IPTAALPGLPADVRSEPRLALDGGP 215

Query: 122 ---DSFEKWIRTACAIMRSSGQLSL-IARPQSLIQIVNACARRIGS 163
              D++   +  A  ++R  G L+L I   Q   Q V   AR +G+
Sbjct: 216 DGLDAYRFLLPGAAGLLRPGGLLALEIGSDQG--QAVKDLARAVGA 259


>gi|256811406|ref|YP_003128775.1| methyltransferase small [Methanocaldococcus fervens AG86]
 gi|256794606|gb|ACV25275.1| methyltransferase small [Methanocaldococcus fervens AG86]
          Length = 196

 Score = 40.4 bits (93), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 57/128 (44%), Gaps = 16/128 (12%)

Query: 2   ILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLAL-PAN 60
           IL   V       + DLG G G  G+A+A  +         +S  MA   R+ + L   N
Sbjct: 46  ILVENVVVNEDEDILDLGCGYGVIGIALADEV---------KSVTMADINRRAIKLAKEN 96

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
            +++   +L   D+ +V  +     +K+  YD +I NPP   R G     KI +E   +L
Sbjct: 97  IKLN---NLENYDIRVVHSDL-YENVKDKKYDKIITNPPI--RAGKEVLHKIIKEGKEIL 150

Query: 121 EDSFEKWI 128
           +D  E W+
Sbjct: 151 KDGGEIWV 158


>gi|210617097|ref|ZP_03291407.1| hypothetical protein CLONEX_03629 [Clostridium nexile DSM 1787]
 gi|210149486|gb|EEA80495.1| hypothetical protein CLONEX_03629 [Clostridium nexile DSM 1787]
          Length = 246

 Score = 40.4 bits (93), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 43/195 (22%), Positives = 89/195 (45%), Gaps = 18/195 (9%)

Query: 17  DLGAGAGAAGLAVASR---LHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVD 73
           DLG G G   + + ++   +H   + + E S   A  AR+++A   +  + +++ ++  D
Sbjct: 51  DLGTGTGIIPILLTAKTEGMHFTGLEIQEES---ADMARRSVA---HNHLEEKVDIVTGD 104

Query: 74  VTLVGENRNLAGLKNNFYDHVIMNPPFN-ERIGTMTPDKIKEEA-HVMLEDSFEKWIRTA 131
           +    E    A      +D +  NPP+     G   P   K  A H +L D     +R +
Sbjct: 105 IKEAAELFGPAS-----FDVITTNPPYMIGHHGIENPSDAKAIARHEVLCD-LNDILRES 158

Query: 132 CAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRKGMRG 190
             I++  G+  ++ RP  L +I++   +  I    +  +HP   +  + +L+ G +G   
Sbjct: 159 ARILKPRGRFYMVHRPFRLAEILSKMIQVGIEPKRMRMVHPFVHKEPNMVLIEGMRGANS 218

Query: 191 QLRFRYPIVLHKPNG 205
           ++R   P++++K  G
Sbjct: 219 RMRVEPPLIVYKEQG 233


>gi|146291992|ref|YP_001182416.1| type 12 methyltransferase [Shewanella putrefaciens CN-32]
 gi|262829161|sp|A4Y3T4|TRMN6_SHEPC RecName: Full=tRNA (adenine-N(6)-)-methyltransferase; AltName:
           Full=tRNA m6A37 methyltransferase
 gi|145563682|gb|ABP74617.1| Methyltransferase type 12 [Shewanella putrefaciens CN-32]
          Length = 238

 Score = 40.4 bits (93), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 81/183 (44%), Gaps = 10/183 (5%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++L +    T +  + D+GAG+G  GL  A R  +A I   E     A   +  +   A 
Sbjct: 24  VVLGAWAPLTNAKQILDIGAGSGILGLMAAQR-SQANITCIELDNTAAIACQHNI---AQ 79

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
           +  + RI L++  +  + +     G    ++DH+I NPP+ E  G       +  A    
Sbjct: 80  SPWASRIRLVQGSIQQLSQAEEYQG----YFDHIICNPPYFEH-GPQAQLSQRAMARHTD 134

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASR 179
           + SF + +      +  +G  SLI   QSL    +  ++ R+  +E   +   EG+ A+R
Sbjct: 135 QLSFNELLAAIEQCLSPNGLASLILPIQSLHNFNHLLSQSRLEWVERVDIKSVEGKRANR 194

Query: 180 ILV 182
           +L 
Sbjct: 195 VLC 197


>gi|258648434|ref|ZP_05735903.1| SAM-dependent methyltransferase [Prevotella tannerae ATCC 51259]
 gi|260851184|gb|EEX71053.1| SAM-dependent methyltransferase [Prevotella tannerae ATCC 51259]
          Length = 232

 Score = 40.4 bits (93), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 81/189 (42%), Gaps = 18/189 (9%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++L +  N  G   + D+G G+G   L +A R  +A I   E  P  A  A++ +A    
Sbjct: 26  VLLGAWANVKGKRRILDIGTGSGLIALMLAQRT-DAMITGIEIDPASAAQAQENVAASPW 84

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKN-NFYDHVIMNPP-FNERIGTMTPDKIKEEAHV 118
           A    R+ ++  D+         AG  +   +D ++ NPP FNE +  + PD  + +A  
Sbjct: 85  AD---RLQIVATDI---------AGYTSYQAFDLIVSNPPFFNEML--LPPDAARSQARH 130

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVN-ACARRIGSLEITPLHPREGECA 177
               +FE  +     ++   G    I    +L    + A A+ +  +  T +H    +  
Sbjct: 131 TQALTFEALLFHVGRLLSPEGSFCAILPATALTHFSSAAAAQALFVVHTTFVHTTMQKAP 190

Query: 178 SRILVTGRK 186
            R+LV  RK
Sbjct: 191 KRVLVELRK 199


>gi|315500227|ref|YP_004089030.1| protein-(glutamine-n5) methyltransferase, release factor-specific
           [Asticcacaulis excentricus CB 48]
 gi|315418239|gb|ADU14879.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Asticcacaulis excentricus CB 48]
          Length = 289

 Score = 40.4 bits (93), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 64/136 (47%), Gaps = 19/136 (13%)

Query: 12  SFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIE 71
           +F LADLG G+GA  L+V S    A+ L  + S      AR      AN  +  R + + 
Sbjct: 118 AFTLADLGVGSGAILLSVLSERPAAKGLGTDVSEEALAVARDN---AANLGLDGRAAFLR 174

Query: 72  VDVTLVGENRNLAGLKNNFYDHVIMNPPF--NERIGTMTPDKIKEEAHVMLE------DS 123
              T  G     AGL +  +D V  NPP+  +E I T+ P+    + H+ L+      D+
Sbjct: 175 ---TSWG-----AGLADASFDFVASNPPYIRSEVIPTLDPEVRDHDPHLALDGGESGLDA 226

Query: 124 FEKWIRTACAIMRSSG 139
           + + I  A  I+++ G
Sbjct: 227 YIEMIPEAFRILKAGG 242


>gi|197334549|ref|YP_002155201.1| methyltransferase [Vibrio fischeri MJ11]
 gi|262828790|sp|B5F9T8|TRMN6_VIBFM RecName: Full=tRNA (adenine-N(6)-)-methyltransferase; AltName:
           Full=tRNA m6A37 methyltransferase
 gi|197316039|gb|ACH65486.1| methyltransferase [Vibrio fischeri MJ11]
          Length = 234

 Score = 40.4 bits (93), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 76/185 (41%), Gaps = 17/185 (9%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++L +  N +    + D+GAG G   L  A R   A I   E  P+ A  AR      + 
Sbjct: 26  VLLGAWTNISECSQILDIGAGTGLLSLMSAQRNSNAHIDAIELMPIAAEVARLNF---SQ 82

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
           +   +R+ LI  D         L+      YD +I NPP+    G  +    +  A    
Sbjct: 83  SPWKERLVLIHQDF--------LSYQTAYEYDAIICNPPYFNN-GEQSLKGERSTARHTD 133

Query: 121 EDSFEKWIRTACAIMRSSGQLSLI---ARPQSLIQIVNACARRIGSLEITPLHPREGECA 177
              F+K ++    ++ S+G+ S I      +  I+I   C   +   +IT +   E +  
Sbjct: 134 SLPFDKLLQHCKTLISSTGRASFILPVFEGEIFIKIAKGCDFHL--TKITKVKTTEKKSP 191

Query: 178 SRILV 182
           +R+L+
Sbjct: 192 TRLLI 196


>gi|314932765|ref|ZP_07840134.1| methyltransferase domain protein [Staphylococcus caprae C87]
 gi|313654446|gb|EFS18199.1| methyltransferase domain protein [Staphylococcus caprae C87]
          Length = 186

 Score = 40.4 bits (93), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 53/113 (46%), Gaps = 18/113 (15%)

Query: 12  SFHLADLGAGAGAAGLAVA--SRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISL 69
           S ++AD+G G G  GL +A  S  H+  +L      L+     KT     NA+I      
Sbjct: 63  SKYIADVGCGYGPIGLTIAKVSPHHQLYMLDVNNRALVLTEMNKTKNQIENAEI------ 116

Query: 70  IEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLED 122
           IE D         L+G+ +  +D+++ NPP   R G     +I EEA+  L+D
Sbjct: 117 IESDC--------LSGVSDQQFDYILTNPPI--RAGKDVVHRIFEEAYGKLKD 159


>gi|254561604|ref|YP_003068699.1| hypothetical protein METDI3191 [Methylobacterium extorquens DM4]
 gi|254268882|emb|CAX24843.1| conserved hypothetical protein [Methylobacterium extorquens DM4]
          Length = 341

 Score = 40.4 bits (93), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 47/86 (54%), Gaps = 13/86 (15%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           +AD+G G+GAAG+ VA RL EA+++L + +P     AR          I+ R  L  VD 
Sbjct: 162 VADIGCGSGAAGILVAKRLPEAEVVLVDINPAALRAAR----------INAR--LAGVDN 209

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPF 100
                +  L+ ++ +F D ++ NPPF
Sbjct: 210 VRPVHSDMLSSVEGSF-DLIVSNPPF 234


>gi|238927560|ref|ZP_04659320.1| methyltransferase [Selenomonas flueggei ATCC 43531]
 gi|238884485|gb|EEQ48123.1| methyltransferase [Selenomonas flueggei ATCC 43531]
          Length = 245

 Score = 40.4 bits (93), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 83/189 (43%), Gaps = 13/189 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA     TG   + DLG G G   L +A R   A +   E  P+ A  A +  AL   
Sbjct: 35  VLLAHFPTLTGRECVLDLGTGTGIIPLLIADR--TAAVTAVELDPVQAELAVRNAALNG- 91

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKN-NFYDHVIMNPPFNERIGTMTPDKIKEEAHVM 119
             ++++I++ E      G+ R+ + L +   YD V  NPP+            +  A   
Sbjct: 92  --LTEKITVRE------GDYRDPSALFSCGAYDLVFANPPYRPVGRGALSMGGRAAARHE 143

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNAC-ARRIGSLEITPLHPREGECAS 178
           +  +    +R A   +R  G+L+++  P+ L +I+ A  A  +    +  + PR  +  +
Sbjct: 144 ITATLADVVRAAAYALRHGGRLAMVHLPERLGEIIPALHAAGLAMKRLRMVQPRMDKAPN 203

Query: 179 RILVTGRKG 187
            +L+   KG
Sbjct: 204 LMLIEAVKG 212


>gi|254448386|ref|ZP_05061847.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [gamma proteobacterium HTCC5015]
 gi|198261999|gb|EDY86283.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [gamma proteobacterium HTCC5015]
          Length = 275

 Score = 40.4 bits (93), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 43/95 (45%), Gaps = 12/95 (12%)

Query: 6   LVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISK 65
           L     +  +ADLGAG+G  GL +A  L +A +L  ERS       R  LA+     I K
Sbjct: 104 LFGPDSTIDIADLGAGSGCIGLTLAHCLPKANVLCVERS-------RDALAM-----IEK 151

Query: 66  RISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF 100
               + ++     E+     L    +D +I NPP+
Sbjct: 152 NRQQLNINNAKAIESNWCQDLGEQHFDLIISNPPY 186


>gi|312880402|ref|ZP_07740202.1| Methyltransferase type 12 [Aminomonas paucivorans DSM 12260]
 gi|310783693|gb|EFQ24091.1| Methyltransferase type 12 [Aminomonas paucivorans DSM 12260]
          Length = 254

 Score = 40.4 bits (93), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 56/117 (47%), Gaps = 2/117 (1%)

Query: 91  YDHVIMNPPFNE-RIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQS 149
           YD V+ NPP+ + +    +P +    A   L  S E  +RTA   +RS G+L L+ R + 
Sbjct: 120 YDAVVANPPYEDPKRSRPSPREGVALAVHGLACSLEDLVRTARGCLRSRGRLFLVMRAKR 179

Query: 150 LIQIVNAC-ARRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNG 205
           L ++ +     R+    +  +HP+    AS +L+   +     L    P+ +H+ +G
Sbjct: 180 LGELTSLLREHRLEPKRLRAVHPKPDRAASVVLLEALRDGGPGLTVEPPLFIHRGDG 236


>gi|29827985|ref|NP_822619.1| ribosomal RNA small subunit methyltransferase [Streptomyces
           avermitilis MA-4680]
 gi|81720927|sp|Q82N59|RLMG_STRAW RecName: Full=Ribosomal RNA large subunit methyltransferase G;
           AltName: Full=23S rRNA m2G1835 methyltransferase;
           AltName: Full=rRNA (guanine-N(2)-)-methyltransferase
           rlmG
 gi|29605086|dbj|BAC69154.1| putative ribosomal RNA small subunit methyltransferase
           [Streptomyces avermitilis MA-4680]
          Length = 380

 Score = 40.4 bits (93), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 55/130 (42%), Gaps = 14/130 (10%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
             L  L   +G+  + DLG G G  G AVA    EA++L  + S      AR+T    AN
Sbjct: 227 FFLRHLPRVSGAERVVDLGCGNGVVGTAVALTEPEAEVLFVDESYQAVASARETFR--AN 284

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTM--TPDKIKEEAHV 118
           A  +           LVG+   L+G+     D V+ NPPF+    T   T  ++   A  
Sbjct: 285 ADGTAEF--------LVGD--GLSGVPAASVDVVLNNPPFHSHQATTDATAWRMFTGAKR 334

Query: 119 MLEDSFEKWI 128
            L    E W+
Sbjct: 335 ALRPGGELWV 344


>gi|237741752|ref|ZP_04572233.1| methyltransferase [Fusobacterium sp. 4_1_13]
 gi|256845080|ref|ZP_05550538.1| methyltransferase [Fusobacterium sp. 3_1_36A2]
 gi|294785634|ref|ZP_06750922.1| DNA methylase [Fusobacterium sp. 3_1_27]
 gi|229429400|gb|EEO39612.1| methyltransferase [Fusobacterium sp. 4_1_13]
 gi|256718639|gb|EEU32194.1| methyltransferase [Fusobacterium sp. 3_1_36A2]
 gi|294487348|gb|EFG34710.1| DNA methylase [Fusobacterium sp. 3_1_27]
          Length = 243

 Score = 40.4 bits (93), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 27/121 (22%), Positives = 58/121 (47%), Gaps = 4/121 (3%)

Query: 90  FYDHVIMNPPF---NERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIAR 146
           F+D +I NPPF   NE +  +   +    A   +E   ++ I+ +  +++  G   L+ R
Sbjct: 113 FFDIIISNPPFFKINENVNFLNNLEQLSIARHEVEIDLDELIKISSELVKDRGYFYLVHR 172

Query: 147 PQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNG 205
              L +I+N   + +  + +I   +  + + A  +L+   K  +  L    P++++K NG
Sbjct: 173 ADRLSEILNILQKYKFEAKKIKFCYTTKYKNAKIVLIEAIKNGKSGLTILPPLIINKENG 232

Query: 206 Q 206
           +
Sbjct: 233 E 233


>gi|319956549|ref|YP_004167812.1| methyltransferase small [Nitratifractor salsuginis DSM 16511]
 gi|319418953|gb|ADV46063.1| methyltransferase small [Nitratifractor salsuginis DSM 16511]
          Length = 232

 Score = 40.4 bits (93), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 51/222 (22%), Positives = 90/222 (40%), Gaps = 36/222 (16%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           L D+G G G   L +  R +  ++ LAE+ P M  YA     L      +     +E  +
Sbjct: 32  LLDVGCGVGIISLLLG-RDYPVEVYLAEKQPKMLEYALHNFTLNGIEAHAYPGDFLEAQI 90

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDK---IKEEAHVMLEDSFEKWIRTA 131
               E R         +D ++ NPPF +   T + ++   I   AH +  + F + +R  
Sbjct: 91  ----EER---------FDLIVSNPPFYDPRVTQSEEESLNIARYAHHLPLEPFVERVRR- 136

Query: 132 CAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITP-----LHPREGECASRILVTGRK 186
             ++R  G+  L    +   +++ A    +   ++TP     +HP+    A  ++V  R 
Sbjct: 137 --LLRPRGRFILCYDAKQSDRLLAA----LREAKLTPETLRFVHPKLDREAKIVMVQARA 190

Query: 187 GMRGQLRFRYPIVLHKPNG-------QPYSRFVTDLINGKRS 221
           G +   R   P+V+   +G       Q + R  T  I G R 
Sbjct: 191 GSKSLCRVLPPLVVFDASGSYTPEAAQAFERAATHSIKGLRE 232


>gi|119468454|ref|ZP_01611545.1| Putative ribosomal RNA small subunit methyltransferase D
           [Alteromonadales bacterium TW-7]
 gi|119447962|gb|EAW29227.1| Putative ribosomal RNA small subunit methyltransferase D
           [Alteromonadales bacterium TW-7]
          Length = 380

 Score = 40.4 bits (93), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 39/86 (45%), Gaps = 9/86 (10%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DLG G G  G+   +R  +A +   + S +    AR    L     +++R      D   
Sbjct: 236 DLGCGNGVVGVMTLARCPKASVTFVDESYMAVESAR----LNVEQNMAERFD----DCEF 287

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNE 102
           + EN  L G + N  D V+ NPPF++
Sbjct: 288 I-ENDCLTGFEKNSVDMVLCNPPFHQ 312


>gi|15669072|ref|NP_247877.1| hypothetical protein MJ_0882 [Methanocaldococcus jannaschii DSM
           2661]
 gi|2842581|sp|Q58292|Y882_METJA RecName: Full=Putative protein methyltransferase MJ0882
 gi|1499712|gb|AAB98886.1| conserved hypothetical protein [Methanocaldococcus jannaschii DSM
           2661]
          Length = 197

 Score = 40.4 bits (93), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 58/128 (45%), Gaps = 16/128 (12%)

Query: 2   ILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLAL-PAN 60
           IL   V       + DLG G G  G+A+A  +         +S  MA   R+ + L   N
Sbjct: 46  ILVENVVVDKDDDILDLGCGYGVIGIALADEV---------KSTTMADINRRAIKLAKEN 96

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
            +++   +L   D+ +V  +     +K+  Y+ +I NPP   R G     +I EE   +L
Sbjct: 97  IKLN---NLDNYDIRVVHSDL-YENVKDRKYNKIITNPPI--RAGKEVLHRIIEEGKELL 150

Query: 121 EDSFEKWI 128
           +D+ E W+
Sbjct: 151 KDNGEIWV 158


>gi|251799654|ref|YP_003014385.1| methyltransferase small [Paenibacillus sp. JDR-2]
 gi|247547280|gb|ACT04299.1| methyltransferase small [Paenibacillus sp. JDR-2]
          Length = 201

 Score = 40.4 bits (93), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 38/162 (23%), Positives = 69/162 (42%), Gaps = 19/162 (11%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++L +LV A  S  + D+G G G  GL  A    E  + + + +      +++   L   
Sbjct: 48  VLLDALVLAP-SAQVLDVGCGYGPIGLTAAKLAPEGHVTMIDINERAVELSKENAKLNGV 106

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
           + ++    +++ D+           +KNN YD ++ NPP   R G     +I EE + +L
Sbjct: 107 SNVT----IVQSDI--------YESVKNNRYDVILTNPPI--RAGKQVVHRIFEEGYNLL 152

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIG 162
               + W+     I +  G  S  A+ +SL   V    +  G
Sbjct: 153 NPGGKMWV----VIQKKQGAPSAEAKLESLFGDVEEVTKDKG 190


>gi|16125128|ref|NP_419692.1| hemK family protein [Caulobacter crescentus CB15]
 gi|13422136|gb|AAK22860.1| hemK family protein [Caulobacter crescentus CB15]
          Length = 317

 Score = 40.4 bits (93), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 45/162 (27%), Positives = 70/162 (43%), Gaps = 18/162 (11%)

Query: 12  SFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIE 71
           +F + DLG G+G   LAV +    A+ L  + S      AR+     AN  ++ R +L+ 
Sbjct: 143 AFSMLDLGVGSGTILLAVLAERPAAKGLGIDASSEALAVARENA---ANLDLNTRAALLH 199

Query: 72  VDVTLVGENRNLAGLKNNFYDHVIMNPPF--NERIGTMTPDKIKEEAHVMLE---DSFEK 126
            D T         GL ++ +D V+ NPP+   E I T+ P+    E  + L+   D    
Sbjct: 200 GDWT--------TGLGSDSFDLVVSNPPYIPTEVIDTLEPEVRIHEPRLALDGGPDGLAA 251

Query: 127 WIRTACAIMR--SSGQLSLIARPQSLIQIVNACARRIGSLEI 166
           +   A  I+R    G L  +       Q V A  R  G+ E+
Sbjct: 252 YRELAPEILRVLKPGGLFAVEIGYDQSQAVEALFRAAGATEV 293


>gi|257095542|ref|YP_003169183.1| methyltransferase [Candidatus Accumulibacter phosphatis clade IIA
           str. UW-1]
 gi|257048066|gb|ACV37254.1| methyltransferase [Candidatus Accumulibacter phosphatis clade IIA
           str. UW-1]
          Length = 181

 Score = 40.4 bits (93), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 59/128 (46%), Gaps = 17/128 (13%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DL AG+GA G   ASR     +++   + ++A  A    AL     + KR+ ++  D   
Sbjct: 47  DLFAGSGALGFEAASRGAARVVMVDTSAKVLAALADNATAL----GVGKRVEIVRSDAVR 102

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFN----ERIGTMTPDKIKEEAHVMLEDSFEKWIRTAC 132
              +   AGL+   +D + ++PPF+    +R+  +T D + E+  +  E         +C
Sbjct: 103 FASS---AGLR---FDVLFLDPPFHQGWMDRLAPLTADVLAEDGVIYAEAEM---CLESC 153

Query: 133 AIMRSSGQ 140
            + R+  Q
Sbjct: 154 GVWRTVRQ 161


>gi|296391432|ref|ZP_06880907.1| hypothetical protein PaerPAb_24899 [Pseudomonas aeruginosa PAb1]
          Length = 374

 Score = 40.4 bits (93), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 55/129 (42%), Gaps = 13/129 (10%)

Query: 2   ILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANA 61
            L  L  + G+   ADLG G G  G+A A    +A++ L + S +    AR+       A
Sbjct: 222 FLPHLPRSLGALRAADLGCGNGVLGIAYALLNPQAELTLVDESYMAVQSARENW----QA 277

Query: 62  QISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNER--IGTMTPDKIKEEAHVM 119
            + +R +    D         LAG      D V+ NPPF+++  +G     ++  +A   
Sbjct: 278 ALGERPATFRAD-------DGLAGQAAGSLDLVLCNPPFHQQQVVGDFLAWRMFLQARDA 330

Query: 120 LEDSFEKWI 128
           L    E WI
Sbjct: 331 LAAGGELWI 339


>gi|213691479|ref|YP_002322065.1| modification methylase, HemK family [Bifidobacterium longum subsp.
           infantis ATCC 15697]
 gi|213522940|gb|ACJ51687.1| modification methylase, HemK family [Bifidobacterium longum subsp.
           infantis ATCC 15697]
 gi|320457552|dbj|BAJ68173.1| putative methylase [Bifidobacterium longum subsp. infantis ATCC
           15697]
          Length = 294

 Score = 40.4 bits (93), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 55/132 (41%), Gaps = 29/132 (21%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANA--QISKRISLIEV 72
           + DL AG+GA GL+V S +  +Q+   E SP  A + R+ L+  A     I+    L   
Sbjct: 121 VVDLCAGSGAIGLSVVSEVPGSQVWAVELSPNTAEWTRRNLSETAKKYPSIASNYHLEIA 180

Query: 73  DVTLVGENRNLAGLKNNFYDHVIMNPPFNERI-----------------------GTMTP 109
           D T       L G      D VI NPP+  +                        GT+ P
Sbjct: 181 DATSFATLAQLDGT----VDIVITNPPYVPQTDIPEQPEVRDWDPELALYGGSADGTLIP 236

Query: 110 DKIKEEAHVMLE 121
           ++I E A+ +L+
Sbjct: 237 ERIIERAYRLLK 248


>gi|291457339|ref|ZP_06596729.1| protein-(glutamine-N5) methyltransferase [Bifidobacterium breve DSM
           20213]
 gi|291381174|gb|EFE88692.1| protein-(glutamine-N5) methyltransferase [Bifidobacterium breve DSM
           20213]
          Length = 305

 Score = 40.0 bits (92), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 41/88 (46%), Gaps = 6/88 (6%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN--AQISKRISLIEV 72
           + DL AG+GA GL+V S +  +Q+   E SP  A + R+ L+  A     I+    L   
Sbjct: 132 VVDLCAGSGAIGLSVVSEVPGSQVWAVELSPNTAEWTRRNLSETAKKYPSIASNYHLEIA 191

Query: 73  DVTLVGENRNLAGLKNNFYDHVIMNPPF 100
           D T       L G      D VI NPP+
Sbjct: 192 DATSFATLAQLDGT----VDIVITNPPY 215


>gi|183984068|ref|YP_001852359.1| modification methylase HemK [Mycobacterium marinum M]
 gi|183177394|gb|ACC42504.1| modification methylase HemK [Mycobacterium marinum M]
          Length = 282

 Score = 40.0 bits (92), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 46/103 (44%), Gaps = 11/103 (10%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL  G+GA  +A+A R   A+IL  + S     YA++         +  ++ L+  DV
Sbjct: 115 IVDLCTGSGALAIALADRWPAARILGVDDSGAALEYAQRN-------SVGTKVELVRADV 167

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAH 117
           T  G    L G      D V+ NPP+      + P+  + + H
Sbjct: 168 TTPGLMPELDGQ----VDLVVTNPPYIPDGAVLEPEVAQHDPH 206


>gi|308273829|emb|CBX30430.1| hypothetical protein N47_Q17530 [uncultured Desulfobacterium sp.]
          Length = 248

 Score = 40.0 bits (92), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 45/209 (21%), Positives = 91/209 (43%), Gaps = 14/209 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LAS V +     + D+G G G   L +A R    +I   E    +A  A   +    N
Sbjct: 38  VLLASYVKSAAGDKVLDIGTGCGIISLILAYRNPGIEIYGIEVQKSLADLAALNV---KN 94

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNE-RIGTMTPDKIKEEAHVM 119
             + ++I ++  DV  + ++  L+G      D ++ NPP+ +   G + PD  +  A   
Sbjct: 95  NCMEEQIKIVYTDVKNLKKSM-LSGSP----DIIVCNPPYRKANSGRVNPDNQRALARHE 149

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE---ITPLHPREGEC 176
           +  S  +   +A  +M  S +  +I   + +  I+     R+  +E      ++ +    
Sbjct: 150 IMISLPEIFESASRLMDISSKFIMIYPSERIADII--AYMRLSGIEPKCFKFIYSKNNSE 207

Query: 177 ASRILVTGRKGMRGQLRFRYPIVLHKPNG 205
           +  ++  G KG R   +   P+V++K +G
Sbjct: 208 SKLVIAEGVKGGRAGAKVTAPLVIYKDDG 236


>gi|116052759|ref|YP_793076.1| hypothetical protein PA14_61090 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|122257230|sp|Q02G60|RLMG_PSEAB RecName: Full=Ribosomal RNA large subunit methyltransferase G;
           AltName: Full=23S rRNA m2G1835 methyltransferase;
           AltName: Full=rRNA (guanine-N(2)-)-methyltransferase
           rlmG
 gi|115587980|gb|ABJ13995.1| putative nucleotide methyltransferase [Pseudomonas aeruginosa
           UCBPP-PA14]
          Length = 374

 Score = 40.0 bits (92), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 56/129 (43%), Gaps = 13/129 (10%)

Query: 2   ILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANA 61
            L  L  + G+   ADLG G G  G+A A    +A++ L + S +    AR+        
Sbjct: 222 FLPHLPRSLGALRAADLGCGNGVLGIAYALLNPQAELTLVDESYMAVQSARENW------ 275

Query: 62  QISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNER--IGTMTPDKIKEEAHVM 119
               R +L E   T   ++  LAG      D V+ NPPF+++  +G     ++  +A   
Sbjct: 276 ----RAALGERPATFRADD-GLAGQAAGSLDLVLCNPPFHQQQVVGDFLAWRMFLQARDA 330

Query: 120 LEDSFEKWI 128
           L    E WI
Sbjct: 331 LAAGGELWI 339


>gi|313107271|ref|ZP_07793467.1| putative nucleotide methyltransferase [Pseudomonas aeruginosa
           39016]
 gi|310879969|gb|EFQ38563.1| putative nucleotide methyltransferase [Pseudomonas aeruginosa
           39016]
          Length = 374

 Score = 40.0 bits (92), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 55/129 (42%), Gaps = 13/129 (10%)

Query: 2   ILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANA 61
            L  L  + G+   ADLG G G  G+A A    +A++ L + S +    AR+       A
Sbjct: 222 FLPHLPRSLGALRAADLGCGNGVLGIAYALLNPQAELTLVDESYMAVQSARENW----QA 277

Query: 62  QISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNER--IGTMTPDKIKEEAHVM 119
            + +R +    D         LAG      D V+ NPPF+++  +G     ++  +A   
Sbjct: 278 ALGERPATFRAD-------DGLAGQAAGSLDLVLCNPPFHQQQVVGDFLAWRMFLQARDA 330

Query: 120 LEDSFEKWI 128
           L    E WI
Sbjct: 331 LAAGGELWI 339


>gi|254244490|ref|ZP_04937812.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|126197868|gb|EAZ61931.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
          Length = 374

 Score = 40.0 bits (92), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 55/129 (42%), Gaps = 13/129 (10%)

Query: 2   ILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANA 61
            L  L  + G+   ADLG G G  G+A A    +A++ L + S +    AR+       A
Sbjct: 222 FLPHLPRSLGALRAADLGCGNGVLGIAYALLNPQAELTLVDESYMAVQSARENW----QA 277

Query: 62  QISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNER--IGTMTPDKIKEEAHVM 119
            + +R +    D         LAG      D V+ NPPF+++  +G     ++  +A   
Sbjct: 278 ALGERPATFRAD-------DGLAGQAAGSLDLVLCNPPFHQQQVVGDFLAWRMFLQARDA 330

Query: 120 LEDSFEKWI 128
           L    E WI
Sbjct: 331 LAAGGELWI 339


>gi|221233855|ref|YP_002516291.1| peptide release factor-glutamine N5-methyltransferase [Caulobacter
           crescentus NA1000]
 gi|220963027|gb|ACL94383.1| peptide release factor-glutamine N5-methyltransferase [Caulobacter
           crescentus NA1000]
          Length = 289

 Score = 40.0 bits (92), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 45/162 (27%), Positives = 70/162 (43%), Gaps = 18/162 (11%)

Query: 12  SFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIE 71
           +F + DLG G+G   LAV +    A+ L  + S      AR+     AN  ++ R +L+ 
Sbjct: 115 AFSMLDLGVGSGTILLAVLAERPAAKGLGIDASSEALAVAREN---AANLDLNTRAALLH 171

Query: 72  VDVTLVGENRNLAGLKNNFYDHVIMNPPF--NERIGTMTPDKIKEEAHVMLE---DSFEK 126
            D T         GL ++ +D V+ NPP+   E I T+ P+    E  + L+   D    
Sbjct: 172 GDWT--------TGLGSDSFDLVVSNPPYIPTEVIDTLEPEVRIHEPRLALDGGPDGLAA 223

Query: 127 WIRTACAIMR--SSGQLSLIARPQSLIQIVNACARRIGSLEI 166
           +   A  I+R    G L  +       Q V A  R  G+ E+
Sbjct: 224 YRELAPEILRVLKPGGLFAVEIGYDQSQAVEALFRAAGATEV 265


>gi|288554716|ref|YP_003426651.1| ribosomal RNA methyltransferase [Bacillus pseudofirmus OF4]
 gi|288545876|gb|ADC49759.1| ribosomal RNA methyltransferase [Bacillus pseudofirmus OF4]
          Length = 201

 Score = 40.0 bits (92), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 64/148 (43%), Gaps = 18/148 (12%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           L D+G G G  GLAVAS   E ++ + + +      ARK      N  IS       VD+
Sbjct: 62  LLDVGCGYGPIGLAVASIDKEREVHMVDVNVRALDLARKN---AMNNGISN------VDI 112

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAI 134
               E+  L  +K + Y  ++ NPP   R G     +I E+AH  L++    W+     I
Sbjct: 113 Y---ESDTLGQVKGDQYAAILTNPPI--RAGKKVVHEIFEQAHGRLKNGGCLWV----VI 163

Query: 135 MRSSGQLSLIARPQSLIQIVNACARRIG 162
            +  G  S + + + L   V    ++ G
Sbjct: 164 QKKQGAPSAMEKIEGLFGNVEVVEKKKG 191


>gi|325297717|ref|YP_004257634.1| tRNA (adenine-N(6)-)-methyltransferase [Bacteroides salanitronis
           DSM 18170]
 gi|324317270|gb|ADY35161.1| tRNA (adenine-N(6)-)-methyltransferase [Bacteroides salanitronis
           DSM 18170]
          Length = 252

 Score = 40.0 bits (92), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 41/184 (22%), Positives = 72/184 (39%), Gaps = 17/184 (9%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++L + V+   + ++ D+G G+G   L +A R       +   S  +       LA P  
Sbjct: 44  VLLGAWVSLRQARNVLDIGTGSGLIALMIAQRCQAQVTGIDIDSDAIGQAGENALASP-- 101

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPP-FNERIGTMTPDKIKEEAHVM 119
              S RI   + D             +   YD ++ NPP F ER+    PD  +  A   
Sbjct: 102 --WSGRIRFCQADA---------GAFQGGVYDTIVSNPPYFRERV--HCPDGQRNAARHT 148

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVN-ACARRIGSLEITPLHPREGECAS 178
              +FE  +     +M   G  S+I   ++  + +  A  R +  L  T +H +      
Sbjct: 149 ESLTFECLLDAVARLMSEDGSFSVILPAEAGERFITLAAERHLYLLRRTYVHTKPSASPK 208

Query: 179 RILV 182
           R+L+
Sbjct: 209 RVLM 212


>gi|282883334|ref|ZP_06291928.1| methyltransferase domain superfamily [Peptoniphilus lacrimalis
           315-B]
 gi|281296838|gb|EFA89340.1| methyltransferase domain superfamily [Peptoniphilus lacrimalis
           315-B]
          Length = 229

 Score = 40.0 bits (92), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 68/167 (40%), Gaps = 20/167 (11%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           +IL+S V   G   L DLG G G   L +  R  E   +   +  L        +AL  N
Sbjct: 27  LILSSFV-KMGQRAL-DLGCGNGIISLRIVDRFKELYAIDYNKESLELF----KIALKEN 80

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
             +  +I LI+ D+  +G         NN++D ++ NPP+        P    E+A    
Sbjct: 81  Y-LEDKIRLIQDDILNLGN-----YFPNNYFDQILFNPPY---FNCFEPKSNMEKARHST 131

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIA---RPQSLIQIVNACARRIGSL 164
           +     +I     ++++ G  ++I    R   LI  +N    ++  +
Sbjct: 132 D--IRNFIEIVSKLLKARGDFTIIFPSNRISELIYYLNLYKLKVKDM 176


>gi|224373243|ref|YP_002607615.1| methyltransferase small [Nautilia profundicola AmH]
 gi|223588743|gb|ACM92479.1| methyltransferase small [Nautilia profundicola AmH]
          Length = 227

 Score = 40.0 bits (92), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 33/152 (21%), Positives = 72/152 (47%), Gaps = 14/152 (9%)

Query: 63  ISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDK-----IKEEAH 117
           I K I+   +D  +V ++      +  F D++I NPPF +  GT+  D       + E  
Sbjct: 68  ILKNINENALDAEVVNDDFLTYKFEKKF-DYIISNPPFYQ--GTLKSDNEIIKTARYEEF 124

Query: 118 VMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECA 177
           + + + FEK  R    I++  G+       + +  I++   + + +++I  +HPR  + A
Sbjct: 125 LPMREFFEKVNR----ILKERGEFVFCYDAKRIDDIISNMPKPLKTVDIRFMHPRVAKKA 180

Query: 178 SRILVTGRKGMRGQLRFRYPIVLHKPNGQPYS 209
           + ++V  ++  +  +    P++  +  G+ YS
Sbjct: 181 TLVMVRAKRHAKSMVTVHPPLIGFE--GENYS 210


>gi|320530691|ref|ZP_08031735.1| methyltransferase small domain protein [Selenomonas artemidis
           F0399]
 gi|320136978|gb|EFW28916.1| methyltransferase small domain protein [Selenomonas artemidis
           F0399]
          Length = 215

 Score = 40.0 bits (92), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 48/210 (22%), Positives = 95/210 (45%), Gaps = 15/210 (7%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA     TG   + DLG GAG   L +   + E  +L  E +   A  A +  AL   
Sbjct: 4   VLLAHFPRLTGRERVLDLGTGAGVIPLLIVDEVRE--VLAVELNSAQAALAVRNAALNG- 60

Query: 61  AQISKRISLIEVDVTLVGENRNLAGL-KNNFYDHVIMNPPFNE-RIGTMTPDKIKEEAHV 118
             +S++I++ E      G+ R+   L     +D V  NPP+     G ++    +  A  
Sbjct: 61  --VSEKITVRE------GDYRDPPALFVFESFDLVFANPPYYPVGCGAVSTCAGRAAARH 112

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE-ITPLHPREGECA 177
            +  +    +R +   +R  G+L+++  P+ L +I+ A  R   +++ +  + PR  +  
Sbjct: 113 EITATLADTVRASAYALRFGGRLAMVHIPERLGEIICALHRECFAVKRMRLVQPRPDKAP 172

Query: 178 SRILVTGRKGMR-GQLRFRYPIVLHKPNGQ 206
           + +L+   KG     +R   P+++   +G+
Sbjct: 173 NLVLLEAVKGASLTGMRHLPPLIVRTADGR 202


>gi|78067607|ref|YP_370376.1| hypothetical protein Bcep18194_A6138 [Burkholderia sp. 383]
 gi|77968352|gb|ABB09732.1| conserved hypothetical protein [Burkholderia sp. 383]
          Length = 204

 Score = 40.0 bits (92), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 39/86 (45%), Gaps = 10/86 (11%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DL AG GA G   ASR   A +++ ER P  A   R          I  ++    V+V  
Sbjct: 67  DLFAGTGALGFEAASR-GAASVVMVERHPRAAQQLRA---------IKDKLGARAVEVAE 116

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNE 102
               R  AGL    +D V ++PPF+E
Sbjct: 117 ADALRLAAGLTPGAFDVVFLDPPFDE 142


>gi|218893714|ref|YP_002442583.1| putative nucleotide methyltransferase [Pseudomonas aeruginosa
           LESB58]
 gi|218773942|emb|CAW29756.1| putative nucleotide methyltransferase [Pseudomonas aeruginosa
           LESB58]
          Length = 374

 Score = 40.0 bits (92), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 56/129 (43%), Gaps = 13/129 (10%)

Query: 2   ILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANA 61
            L  L  + G+   ADLG G G  G+A A    +A++ L + S +    AR+        
Sbjct: 222 FLPHLPRSLGALRAADLGCGNGVLGIAYALLNPQAELALVDESYMAVQSARENW------ 275

Query: 62  QISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNER--IGTMTPDKIKEEAHVM 119
               R +L E   T   ++  LAG      D V+ NPPF+++  +G     ++  +A   
Sbjct: 276 ----RAALGERPATFRADD-GLAGQAAGSLDLVLCNPPFHQQQVVGDFLAWRMFLQARDA 330

Query: 120 LEDSFEKWI 128
           L    E WI
Sbjct: 331 LAAGGELWI 339


>gi|289450522|ref|YP_003475311.1| hypothetical protein HMPREF0868_1010 [Clostridiales genomosp. BVAB3
           str. UPII9-5]
 gi|289185069|gb|ADC91494.1| conserved hypothetical protein [Clostridiales genomosp. BVAB3 str.
           UPII9-5]
          Length = 295

 Score = 40.0 bits (92), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 70/155 (45%), Gaps = 21/155 (13%)

Query: 7   VNATGSFHL--ADLGAGAGAAGLAVASRLHEAQILL--AERSPLMAHYARKTLA------ 56
           +N T S +L  ADL AG+G  GL  A+R  +  +L    E  P M     +         
Sbjct: 49  INTTASKNLKVADLCAGSGVIGLLYAARCRQVPVLTVAVEHDPEMFSVLERNACLNARYN 108

Query: 57  -LPANAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEE 115
            LP +A +++ +   +VD     +++   G   + +  V++NPP++     +  +K  E 
Sbjct: 109 ILPVHANLAEDVESWQVD----QKHKVTPGDFKHSFQVVLVNPPYSH----INKNKFIEN 160

Query: 116 --AHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQ 148
             A   +      +++ A  ++R  GQL +  RP+
Sbjct: 161 DMARHEITGDLHAYLKAAVNLLRPLGQLFICFRPE 195


>gi|297539751|ref|YP_003675520.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Methylotenera sp. 301]
 gi|297259098|gb|ADI30943.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Methylotenera sp. 301]
          Length = 320

 Score = 40.0 bits (92), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 42/87 (48%), Gaps = 12/87 (13%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DLG G GA  LA+A    +A I   + S      A+         Q S+++S+I V+ TL
Sbjct: 151 DLGTGTGAIALAIAKNRPKASITAVDASDAALEIAK---------QNSQQLSIINVEFTL 201

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNER 103
                NL+   N  +D ++ NPP+ E 
Sbjct: 202 SNWFENLS---NQRFDVIVSNPPYIEE 225


>gi|114561846|ref|YP_749359.1| methyltransferase small [Shewanella frigidimarina NCIMB 400]
 gi|122300753|sp|Q087P4|TRMN6_SHEFN RecName: Full=tRNA (adenine-N(6)-)-methyltransferase; AltName:
           Full=tRNA m6A37 methyltransferase
 gi|114333139|gb|ABI70521.1| methyltransferase small [Shewanella frigidimarina NCIMB 400]
          Length = 251

 Score = 40.0 bits (92), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 49/190 (25%), Positives = 82/190 (43%), Gaps = 20/190 (10%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRL-HEAQILLAERSPLMAHYARKTLALPA 59
           ++L +    T S H+ D+GAG+G   L  A R  H   I+  E     A   +  +    
Sbjct: 24  VLLGAWAELTQSSHILDIGAGSGLLSLMAAQRSPHHTSIIAVEIDNAAAKACQFNI---K 80

Query: 60  NAQISKRISLIEVDVTLVGENRNLAGLKNN---FYDHVIMNPPFNERIGTMTPDKIKEEA 116
            +  S+ + L    +    +  N     NN    +DH+I NPP+ E+ GT   +  + +A
Sbjct: 81  QSPWSETVQLFHGAIQDFQQRHN-----NNDEPLFDHIICNPPYFEQ-GTQAKNSARADA 134

Query: 117 HVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSL---IQIVNACARRIG-SLEITPLHPR 172
                 SF +       ++   G  S+I   QSL   IQ +NA    +   L+I  +   
Sbjct: 135 RHTNTLSFAELQNVISQLLAPQGTASVILPLQSLASFIQQLNAYGLFVAKQLDIISI--- 191

Query: 173 EGECASRILV 182
           EG+ A+R ++
Sbjct: 192 EGKVANRSIL 201


>gi|311268958|ref|XP_003132283.1| PREDICTED: hemK methyltransferase family member 1-like [Sus scrofa]
          Length = 264

 Score = 40.0 bits (92), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 59/124 (47%), Gaps = 13/124 (10%)

Query: 7   VNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSP---LMAHYARKTLALPANAQI 63
           V A G   + ++G G+GA  L++ S+L E+Q++  ++      + H   + L      Q+
Sbjct: 48  VGAHGGPLILEVGCGSGAISLSLLSKLPESQVIAVDKGEAAICLTHENAQRL------QL 101

Query: 64  SKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPP--FNERIGTMTPDKIKEEAHVMLE 121
             RI +I +DVTL     +L  L     D VI NPP  F+  +  + P+ +  E    L+
Sbjct: 102 QDRIRIIPLDVTLEQNWAHL--LPWGPVDLVISNPPYVFHRDMEQLAPEILSYEDPTALD 159

Query: 122 DSFE 125
              E
Sbjct: 160 GGEE 163


>gi|15599813|ref|NP_253307.1| hypothetical protein PA4617 [Pseudomonas aeruginosa PAO1]
 gi|107099719|ref|ZP_01363637.1| hypothetical protein PaerPA_01000737 [Pseudomonas aeruginosa PACS2]
 gi|254238641|ref|ZP_04931964.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|81856977|sp|Q9HVH4|RLMG_PSEAE RecName: Full=Ribosomal RNA large subunit methyltransferase G;
           AltName: Full=23S rRNA m2G1835 methyltransferase;
           AltName: Full=rRNA (guanine-N(2)-)-methyltransferase
           rlmG
 gi|9950868|gb|AAG08005.1|AE004875_11 conserved hypothetical protein [Pseudomonas aeruginosa PAO1]
 gi|126170572|gb|EAZ56083.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
          Length = 374

 Score = 40.0 bits (92), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 56/129 (43%), Gaps = 13/129 (10%)

Query: 2   ILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANA 61
            L  L  + G+   ADLG G G  G+A A    +A++ L + S +    AR+        
Sbjct: 222 FLPHLPRSLGALRAADLGCGNGVLGIAYALLNPQAELALVDESYMAVQSARENW------ 275

Query: 62  QISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNER--IGTMTPDKIKEEAHVM 119
               R +L E   T   ++  LAG      D V+ NPPF+++  +G     ++  +A   
Sbjct: 276 ----RAALGERPATFRADD-GLAGQAAGSLDLVLCNPPFHQQQVVGDFLAWRMFLQARDA 330

Query: 120 LEDSFEKWI 128
           L    E WI
Sbjct: 331 LAAGGELWI 339


>gi|49088732|gb|AAT51600.1| PA4617 [synthetic construct]
          Length = 375

 Score = 40.0 bits (92), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 56/129 (43%), Gaps = 13/129 (10%)

Query: 2   ILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANA 61
            L  L  + G+   ADLG G G  G+A A    +A++ L + S +    AR+        
Sbjct: 222 FLPHLPRSLGALRAADLGCGNGVLGIAYALLNPQAELALVDESYMAVQSARENW------ 275

Query: 62  QISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNER--IGTMTPDKIKEEAHVM 119
               R +L E   T   ++  LAG      D V+ NPPF+++  +G     ++  +A   
Sbjct: 276 ----RAALGERPATFRADD-GLAGQAAGSLDLVLCNPPFHQQQVVGDFLAWRMFLQARDA 330

Query: 120 LEDSFEKWI 128
           L    E WI
Sbjct: 331 LAAGGELWI 339


>gi|118619168|ref|YP_907500.1| modification methylase HemK [Mycobacterium ulcerans Agy99]
 gi|118571278|gb|ABL06029.1| modification methylase HemK [Mycobacterium ulcerans Agy99]
          Length = 282

 Score = 40.0 bits (92), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 46/103 (44%), Gaps = 11/103 (10%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL  G+GA  +A+A+R   A+IL  + S     YA +         +  ++ L+  DV
Sbjct: 115 IVDLCTGSGALAVALANRWPTARILGVDDSAAALEYAHRN-------SVGTKVELVRADV 167

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAH 117
           T  G    L G      D V+ NPP+      + P+  + + H
Sbjct: 168 TTPGLMPELDGQ----VDLVVTNPPYIPDGAVLEPEVAQHDPH 206


>gi|225378659|ref|ZP_03755880.1| hypothetical protein ROSEINA2194_04328 [Roseburia inulinivorans DSM
           16841]
 gi|225209496|gb|EEG91850.1| hypothetical protein ROSEINA2194_04328 [Roseburia inulinivorans DSM
           16841]
          Length = 247

 Score = 40.0 bits (92), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 46/220 (20%), Positives = 99/220 (45%), Gaps = 17/220 (7%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++L+    A     + DLG G G   + + ++   A     E     A  AR+++A    
Sbjct: 37  VLLSGFAKAKAGEKVLDLGTGTGIIPILMEAKTDAADFTALEIQEESADMARRSVAY--- 93

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVI-MNPPFNERIGTM---TPDKIKEEA 116
             +  +I ++  D+    +  N+ G  ++F  HVI  NPP+   IGT    +P   K  A
Sbjct: 94  NHLEDKIKVVTGDIR---DASNIFG-ASSF--HVITTNPPY--MIGTHGENSPSTAKAIA 145

Query: 117 HVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGE 175
              +  +    +R +  ++   G+  ++ RP  L +I++     +I    +  ++P   +
Sbjct: 146 RHEVLCTLNDILRESAKMLMPGGRFYMVHRPFRLAEIMSKMVEYKIEPKRMRLVYPYIDK 205

Query: 176 CASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDL 215
             + +L+ G +G + ++    P++++K  G  Y+  + D+
Sbjct: 206 EPNMVLIEGLRGGKSRVTVEKPLIVYKEQGV-YTDEIYDI 244


>gi|167644952|ref|YP_001682615.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Caulobacter sp. K31]
 gi|167347382|gb|ABZ70117.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Caulobacter sp. K31]
          Length = 285

 Score = 40.0 bits (92), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 61/130 (46%), Gaps = 16/130 (12%)

Query: 12  SFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIE 71
           SF++ DLG G+G   LAV +    A+ L  + S      AR+     A+  +S R++L+ 
Sbjct: 115 SFNMLDLGVGSGTILLAVLAERPAAKGLGIDVSEDALAVAREN---AASLDLSGRVALLR 171

Query: 72  VDVTLVGENRNLAGLKNNFYDHVIMNPPF--NERIGTMTPDKIKEEAHVMLE---DSFEK 126
            D T         GL +N +D V+ NPP+     I T+ P+    E  + L+   D  + 
Sbjct: 172 GDWT--------NGLGDNGFDLVVSNPPYIATHVIETLEPEVRDHEPRLALDGGPDGLDA 223

Query: 127 WIRTACAIMR 136
           +   A  I+R
Sbjct: 224 YRLLAGEILR 233


>gi|241667854|ref|ZP_04755432.1| HemK family modification methylase [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254876396|ref|ZP_05249106.1| modification methylase [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254842417|gb|EET20831.1| modification methylase [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
          Length = 285

 Score = 39.7 bits (91), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 51/113 (45%), Gaps = 12/113 (10%)

Query: 2   ILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANA 61
           +L  + +      + DLGAG+GA  LA+A  L  +Q++  +          KTL +    
Sbjct: 106 VLDDIQDKNAQLKILDLGAGSGAIALALADELPRSQVVAVDLYS-------KTLDVAKKN 158

Query: 62  QISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKE 114
            ++ +I  + V+        NL G K   +D ++ NPP+ +       D ++E
Sbjct: 159 ALANKI--VNVEFMQSSWYENLDGTK---FDIIVSNPPYIDVDDANIDDSVRE 206


>gi|229589292|ref|YP_002871411.1| putative methyltransferase [Pseudomonas fluorescens SBW25]
 gi|229361158|emb|CAY48021.1| putative methyltransferase [Pseudomonas fluorescens SBW25]
          Length = 286

 Score = 39.7 bits (91), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 48/103 (46%), Gaps = 9/103 (8%)

Query: 9   ATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRIS 68
           ATG+  L DL AG+GA GLA+A R  +  +   ER  +  +Y ++ +A  A   +    +
Sbjct: 103 ATGTCVL-DLCAGSGAIGLAIARRRPDLDVTCVEREDVAVNYLKRNIARLATKNVQVSAA 161

Query: 69  LIEV-DVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPD 110
             +V D       R   GL       ++ NPP+  +   + P+
Sbjct: 162 QADVYDTKAFARFRQQVGL-------IVANPPYVPQKAQLQPE 197


>gi|209694152|ref|YP_002262080.1| hypothetical protein VSAL_I0559 [Aliivibrio salmonicida LFI1238]
 gi|262827863|sp|B6EMW5|TRMN6_ALISL RecName: Full=tRNA (adenine-N(6)-)-methyltransferase; AltName:
           Full=tRNA m6A37 methyltransferase
 gi|208008103|emb|CAQ78244.1| conserved hypothetical protein [Aliivibrio salmonicida LFI1238]
          Length = 234

 Score = 39.7 bits (91), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 73/185 (39%), Gaps = 17/185 (9%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++L +  N   S ++ D+G G G   L  A R   + +   E  PL A  A +       
Sbjct: 26  VLLGAWANIEQSKNILDIGCGTGLLSLMSAQRNENSHVDAVELMPLAAEVALQNF---VQ 82

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
           +    R+ LI  D+        L     + YD +I NPP+    G  +    +  A    
Sbjct: 83  SPWKNRLHLIHQDI--------LHYHPAHLYDAIICNPPYFNN-GEQSQKGERSIARHTD 133

Query: 121 EDSFEKWIRTACAIMRSSGQLSLI---ARPQSLIQIVNACARRIGSLEITPLHPREGECA 177
              F+K ++   A+M S G+ S I         I+I    +  +  L  T +   E +  
Sbjct: 134 SLPFDKLLKCCKALMSSKGRASFILPFIEGNQFIEIAKKHSFHLTKL--TKIQTTEKKDV 191

Query: 178 SRILV 182
           SR+L+
Sbjct: 192 SRLLI 196


>gi|115352919|ref|YP_774758.1| putative methyltransferase [Burkholderia ambifaria AMMD]
 gi|115282907|gb|ABI88424.1| putative methyltransferase [Burkholderia ambifaria AMMD]
          Length = 227

 Score = 39.7 bits (91), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 38/86 (44%), Gaps = 10/86 (11%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DL AG GA G   ASR   A +++ ER P  A   R          I  ++    V+V  
Sbjct: 90  DLFAGTGALGFEAASR-GAASVVMVERHPRAAQQLRA---------IKDKLGARAVEVAE 139

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNE 102
               R  AGL    +D V ++PPF E
Sbjct: 140 ADALRLAAGLTPGAFDVVFLDPPFGE 165


>gi|160876751|ref|YP_001556067.1| methyltransferase small [Shewanella baltica OS195]
 gi|262828688|sp|A9L1L1|TRMN6_SHEB9 RecName: Full=tRNA (adenine-N(6)-)-methyltransferase; AltName:
           Full=tRNA m6A37 methyltransferase
 gi|160862273|gb|ABX50807.1| methyltransferase type 12 [Shewanella baltica OS195]
 gi|315268951|gb|ADT95804.1| methyltransferase small [Shewanella baltica OS678]
          Length = 238

 Score = 39.7 bits (91), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 51/218 (23%), Positives = 91/218 (41%), Gaps = 12/218 (5%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++L +    T +  + D+GAG+G   L  A R  +A I   E     A   +       N
Sbjct: 24  VVLGAWAQLTAAKTVLDIGAGSGLLSLMAAQR-SQAHITSVELDTSAAEACQHNFH---N 79

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
           +  + R++L+   +    +          ++DH+I NPP+ E+ GT      +  A    
Sbjct: 80  SPWANRLTLVNSSIQDFCQQIEY----QEYFDHIICNPPYFEQ-GTQAIQSQRAMARHTD 134

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASR 179
             SF   +      +   G  SLI   QS+ +     A  ++  +EIT L    G+ A+R
Sbjct: 135 SLSFAALLDAIHVCLAPQGNASLILPMQSMARFNEILAHSQLSLIEITNLISIVGKSANR 194

Query: 180 ILVTGRKGMRGQLRFRYP-IVLHKPNGQPYSRFVTDLI 216
           +L         Q+  +   I + + +GQ Y++ +  LI
Sbjct: 195 VLCVLAHKTHPQIATKISDITIRELSGQ-YTQTMVQLI 231


>gi|34763422|ref|ZP_00144371.1| METHYLTRANSFERASE [Fusobacterium nucleatum subsp. vincentii ATCC
           49256]
 gi|27886916|gb|EAA24039.1| METHYLTRANSFERASE [Fusobacterium nucleatum subsp. vincentii ATCC
           49256]
          Length = 142

 Score = 39.7 bits (91), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 27/121 (22%), Positives = 58/121 (47%), Gaps = 4/121 (3%)

Query: 90  FYDHVIMNPPF---NERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIAR 146
           F+D +I NPPF   NE +  +   +    A   +E   ++ I+ +  +++  G   L+ R
Sbjct: 12  FFDIIISNPPFFKINENVNFLNNLEQLSIARHEVEIDLDELIKISSELVKDRGYFYLVHR 71

Query: 147 PQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNG 205
              L +I+N   + +  + +I   +  + + A  +L+   K  +  L    P++++K NG
Sbjct: 72  ADRLSEILNILQKYKFEAKKIKFCYTTKYKNAKIVLIEAIKNGKSGLTILPPLIINKENG 131

Query: 206 Q 206
           +
Sbjct: 132 E 132


>gi|256851270|ref|ZP_05556659.1| O-methyltransferase [Lactobacillus jensenii 27-2-CHN]
 gi|260660694|ref|ZP_05861609.1| O-methyltransferase [Lactobacillus jensenii 115-3-CHN]
 gi|282934738|ref|ZP_06339981.1| O-methyltransferase [Lactobacillus jensenii 208-1]
 gi|297206137|ref|ZP_06923532.1| methyltransferase [Lactobacillus jensenii JV-V16]
 gi|256616332|gb|EEU21520.1| O-methyltransferase [Lactobacillus jensenii 27-2-CHN]
 gi|260548416|gb|EEX24391.1| O-methyltransferase [Lactobacillus jensenii 115-3-CHN]
 gi|281301313|gb|EFA93614.1| O-methyltransferase [Lactobacillus jensenii 208-1]
 gi|297149263|gb|EFH29561.1| methyltransferase [Lactobacillus jensenii JV-V16]
          Length = 336

 Score = 39.7 bits (91), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 82/182 (45%), Gaps = 17/182 (9%)

Query: 36  AQILLAERSPLMAHYARKTLALPANAQISKRISL------IEVDVTLVGENRNLAGLKNN 89
           A I LA R+   AH+    +   A  Q  + + L      IE  +  V +     G +NN
Sbjct: 59  ASIYLAHRTE--AHFKTIEIQDHAYDQGKRSVELNHLENRIECFLGDVNDATKFVGRQNN 116

Query: 90  FYDHVIMNPPFNERI--GTMTPDKIKEEA-HVMLEDSFEKWIRTACAIMRSSGQLSLIAR 146
               V++NPP+ +      + P++ K  A H +L D  E  I  A  ++++ G+L ++ R
Sbjct: 117 M---VLVNPPYFKVAPGHVVNPNEKKALARHEILVD-LEHIILQASQVLKNKGRLVMVHR 172

Query: 147 PQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRK-GMRGQLRFRYPIVLHKPN 204
           P+ L +I   C +  +   +I P      + ++ I++T  K G    L  + PIV    +
Sbjct: 173 PERLGEICYFCQKYNLPVKKIQPYTSSSHKESNLIVITASKNGASDGLILKSPIVTQTSD 232

Query: 205 GQ 206
           G 
Sbjct: 233 GH 234


>gi|254247171|ref|ZP_04940492.1| conserved hypothetical protein [Burkholderia cenocepacia PC184]
 gi|124871947|gb|EAY63663.1| conserved hypothetical protein [Burkholderia cenocepacia PC184]
          Length = 237

 Score = 39.7 bits (91), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 39/86 (45%), Gaps = 10/86 (11%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DL AG GA G   ASR   A +++ ER P  A   R          I  ++    V+V  
Sbjct: 100 DLFAGTGALGFEAASR-GAASVVMVERHPRAAQQLRA---------IKDKLGARSVEVAE 149

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNE 102
               R  AGL    +D V ++PPF++
Sbjct: 150 ADALRLAAGLTPGAFDVVFLDPPFDD 175


>gi|298493041|ref|YP_003723218.1| protein-(glutamine-N5) methyltransferase ['Nostoc azollae' 0708]
 gi|298234959|gb|ADI66095.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           ['Nostoc azollae' 0708]
          Length = 299

 Score = 39.7 bits (91), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 60/146 (41%), Gaps = 17/146 (11%)

Query: 2   ILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANA 61
           + A++     S H ADLG G+GA  L +A  L  A I   + SP     A+       N 
Sbjct: 117 VAAAVSGGVQSGHWADLGTGSGAIALGLAEVLINATIHAVDFSPEALAVAKTN---AENV 173

Query: 62  QISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF--NERIGTMTPDKIKEEAHVM 119
              +++   +           L  LK  F   ++ NPP+   + + T+ P+ +K E H+ 
Sbjct: 174 GFGEQVKFYQSSWW-----EPLESLKGQF-SGMVSNPPYIPTDTVLTLQPEVLKHEPHLA 227

Query: 120 LE------DSFEKWIRTACAIMRSSG 139
           L+      D     I  + A +R  G
Sbjct: 228 LDGGADGLDCIRHLIEVSPAYLRPGG 253


>gi|116690828|ref|YP_836451.1| putative methyltransferase [Burkholderia cenocepacia HI2424]
 gi|116648917|gb|ABK09558.1| putative methyltransferase [Burkholderia cenocepacia HI2424]
          Length = 237

 Score = 39.7 bits (91), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 39/86 (45%), Gaps = 10/86 (11%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DL AG GA G   ASR   A +++ ER P  A   R          I  ++    V+V  
Sbjct: 100 DLFAGTGALGFEAASR-GAASVVMVERHPRAAQQLRA---------IKDKLGARSVEVAE 149

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNE 102
               R  AGL    +D V ++PPF++
Sbjct: 150 ADALRLAAGLTPGAFDVVFLDPPFDD 175


>gi|313895855|ref|ZP_07829409.1| methyltransferase small domain protein [Selenomonas sp. oral taxon
           137 str. F0430]
 gi|312975280|gb|EFR40741.1| methyltransferase small domain protein [Selenomonas sp. oral taxon
           137 str. F0430]
          Length = 241

 Score = 39.7 bits (91), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 49/210 (23%), Positives = 94/210 (44%), Gaps = 15/210 (7%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA     TG   + DLG GAG   L +   + E  IL  E +   A  A +  AL   
Sbjct: 30  VLLAHFPRLTGRERVLDLGTGAGVIPLLIVDEVRE--ILAVELNSAQAALAVRNAALNG- 86

Query: 61  AQISKRISLIEVDVTLVGENRNLAGL-KNNFYDHVIMNPPFNE-RIGTMTPDKIKEEAHV 118
             +S +I++ E      G+ R+   L     +D V  NPP+     G ++    +  A  
Sbjct: 87  --VSGKITVRE------GDYRDPPALFVFESFDLVFANPPYYPVGCGAVSTCAGRAAARH 138

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE-ITPLHPREGECA 177
            +  +    +R +   +R  G+L+++  P+ L +I+ A  R   +++ +  + PR  +  
Sbjct: 139 EITATLADTVRASAYALRFGGRLAMVHIPERLGEIICALHRECFAVKRMRLVQPRPDKAP 198

Query: 178 SRILVTGRKGMR-GQLRFRYPIVLHKPNGQ 206
           + +L+   KG     +R   P+++   +G+
Sbjct: 199 NLVLLEAVKGASLTGIRHLPPLIVRTADGR 228


>gi|145630697|ref|ZP_01786476.1| 16S ribosomal RNA m2G1207 methyltransferase [Haemophilus influenzae
           R3021]
 gi|144983823|gb|EDJ91273.1| 16S ribosomal RNA m2G1207 methyltransferase [Haemophilus influenzae
           R3021]
          Length = 330

 Score = 39.7 bits (91), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 41/90 (45%), Gaps = 14/90 (15%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DLG GAG  G  +  R   AQI + +   +    ARKTL   +  Q+   +   +V   +
Sbjct: 196 DLGCGAGVIGSTIKKRAPNAQITMTDIHAMALESARKTL---SENQLQGEVYASDVFSDI 252

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNERIGT 106
            G+           +D +I NPPF++ I T
Sbjct: 253 EGK-----------FDLIISNPPFHDGIDT 271


>gi|184200615|ref|YP_001854822.1| protein methyltransferase HemK [Kocuria rhizophila DC2201]
 gi|183580845|dbj|BAG29316.1| protein methyltransferase HemK [Kocuria rhizophila DC2201]
          Length = 289

 Score = 39.7 bits (91), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 42/92 (45%), Gaps = 15/92 (16%)

Query: 11  GSFHLA--DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRIS 68
           G  H A  DLG G+GA  LAVAS     ++   ER P    + R+ LA         R+ 
Sbjct: 115 GEVHPAVIDLGTGSGAIALAVASEDPACRVTAVEREPAALAWTRRNLA-------GTRVR 167

Query: 69  LIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF 100
           L+E D       R+++      +  V+ NPP+
Sbjct: 168 LLECDY------RDVSVPTAGRFCVVVTNPPY 193


>gi|253731146|ref|ZP_04865311.1| 16S rRNA methyltransferase [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253725111|gb|EES93840.1| 16S rRNA methyltransferase [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
          Length = 202

 Score = 39.7 bits (91), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 65/144 (45%), Gaps = 21/144 (14%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           +AD+G G G  GL +A        +    S  M     + LAL     + K   L ++D 
Sbjct: 64  IADVGCGYGPIGLMIAK-------VSPHHSITMLDVNHRALAL-----VEKNKKLNDIDN 111

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAI 134
            +V E+  L+ +++  +D ++ NPP   R G  T  +I E+A   L+ + E ++     I
Sbjct: 112 VIVKESDALSAVEDKSFDFILTNPPI--RAGKETVHRIFEQALHRLDSNGELFV----VI 165

Query: 135 MRSSGQLSLIARPQSL---IQIVN 155
            +  G  S   R   L   +++VN
Sbjct: 166 QKKQGMPSAKKRMNELFGNVEVVN 189


>gi|154250316|ref|YP_001411141.1| methyltransferase small [Fervidobacterium nodosum Rt17-B1]
 gi|154154252|gb|ABS61484.1| methyltransferase small [Fervidobacterium nodosum Rt17-B1]
          Length = 223

 Score = 39.7 bits (91), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 31/147 (21%), Positives = 68/147 (46%), Gaps = 11/147 (7%)

Query: 14  HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVD 73
           ++ +LG+G G    A+A +L+   +   E    +   A + + +     +  ++  +  D
Sbjct: 46  NVIELGSGTGIVAFALA-KLYNLYVTGIEIQHELYELAIEGIHV---NNLEDKVKFLHCD 101

Query: 74  VTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACA 133
           V  V EN      K   +D V+ N PF+  +G  +PDKI+  +     +    +I+++  
Sbjct: 102 VRDV-ENY----FKAESFDMVVSNFPFH--VGKKSPDKIRNMSRSAGLELINDFIKSSSY 154

Query: 134 IMRSSGQLSLIARPQSLIQIVNACARR 160
           ++R+ G    +  P+ L+ ++N  +  
Sbjct: 155 LLRNKGTFVFVMSPKLLVPVINILSEH 181


>gi|163851886|ref|YP_001639929.1| methyltransferase small [Methylobacterium extorquens PA1]
 gi|163663491|gb|ABY30858.1| methyltransferase small [Methylobacterium extorquens PA1]
          Length = 340

 Score = 39.7 bits (91), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 49/86 (56%), Gaps = 13/86 (15%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           +AD+G G+GAAG+ VA RL EA+++L + +P     AR       NA+++   ++  V  
Sbjct: 162 VADIGCGSGAAGILVAKRLPEAEVVLVDINPAALRAAR------INARLAGVGNVRPVHS 215

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPF 100
            +      L+ ++ +F D ++ NPPF
Sbjct: 216 DM------LSNVEGSF-DLIVSNPPF 234


>gi|145297572|ref|YP_001140413.1| ribosomal RNA small subunit methyltransferase C [Aeromonas
           salmonicida subsp. salmonicida A449]
 gi|226712987|sp|A4SIE3|RSMC_AERS4 RecName: Full=Ribosomal RNA small subunit methyltransferase C;
           AltName: Full=16S rRNA m2G1207 methyltransferase;
           AltName: Full=rRNA (guanine-N(2)-)-methyltransferase
           rsmC
 gi|142850344|gb|ABO88665.1| ribosomal RNA small subunit methyltransferase C [Aeromonas
           salmonicida subsp. salmonicida A449]
          Length = 342

 Score = 39.7 bits (91), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 51/107 (47%), Gaps = 16/107 (14%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           M+LA++   TG   L D G GAG  G  +A R    ++ + + S L    +R+TLA+   
Sbjct: 194 MLLAAVPPMTG--ELLDFGCGAGVIGSVLAKRNPGLEVKMVDISALALESSRRTLAING- 250

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTM 107
             +  ++   +V   + G+           +DH++ NPPF+  + T 
Sbjct: 251 --LQGQVQASDVYSDITGK-----------FDHIVSNPPFHAGLKTF 284


>gi|134297004|ref|YP_001120739.1| putative methyltransferase [Burkholderia vietnamiensis G4]
 gi|134140161|gb|ABO55904.1| putative methyltransferase [Burkholderia vietnamiensis G4]
          Length = 204

 Score = 39.7 bits (91), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 38/86 (44%), Gaps = 10/86 (11%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DL AG GA G   ASR   A +++ ER P  A   R          I  ++    V+V  
Sbjct: 67  DLFAGTGALGFEAASR-GAASVVMVERHPRAAQQLRA---------IKDKLGARSVEVAE 116

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNE 102
               R  AGL    +D V ++PPF E
Sbjct: 117 ADALRLAAGLTPGAFDVVFLDPPFGE 142


>gi|226939170|ref|YP_002794241.1| N6-adenine-specific methylase [Laribacter hongkongensis HLHK9]
 gi|226714094|gb|ACO73232.1| Possible N6-adenine-specific methylase [Laribacter hongkongensis
           HLHK9]
          Length = 191

 Score = 39.3 bits (90), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 49/86 (56%), Gaps = 15/86 (17%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQI--SKRISLIEVDV 74
           DL AG+GA G   ASR H A++++ E++  +A        L ANA++    RI ++E D 
Sbjct: 59  DLFAGSGAMGFEAASR-HAARVVMIEKARPVARQ------LQANARLLGCGRIHVVEADA 111

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPF 100
                 + LA ++ +F D ++M+PPF
Sbjct: 112 L-----QWLAQVRESF-DVIVMDPPF 131


>gi|152984637|ref|YP_001350593.1| hypothetical protein PSPA7_5261 [Pseudomonas aeruginosa PA7]
 gi|229564348|sp|A6VC08|RLMG_PSEA7 RecName: Full=Ribosomal RNA large subunit methyltransferase G;
           AltName: Full=23S rRNA m2G1835 methyltransferase;
           AltName: Full=rRNA (guanine-N(2)-)-methyltransferase
           rlmG
 gi|150959795|gb|ABR81820.1| conserved hypothetical protein [Pseudomonas aeruginosa PA7]
          Length = 374

 Score = 39.3 bits (90), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 55/129 (42%), Gaps = 13/129 (10%)

Query: 2   ILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANA 61
            L  L  + G+   ADLG G G  G+A A    +A++ L + S +    AR+       A
Sbjct: 222 FLPHLPRSLGALRAADLGCGNGVLGIAYALLNPQAELTLVDESYMAVQSARENW----RA 277

Query: 62  QISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNER--IGTMTPDKIKEEAHVM 119
            + +R +    D         LAG      D V+ NPPF+++  +G     ++  +A   
Sbjct: 278 ALGERPAAFRAD-------DGLAGQAAGSLDLVLCNPPFHQQQVVGDFLAWRMFLQARDA 330

Query: 120 LEDSFEKWI 128
           L    E WI
Sbjct: 331 LAAGGELWI 339


>gi|237809368|ref|YP_002893808.1| rRNA (guanine-N(2)-)-methyltransferase [Tolumonas auensis DSM 9187]
 gi|237501629|gb|ACQ94222.1| rRNA (guanine-N(2)-)-methyltransferase [Tolumonas auensis DSM 9187]
          Length = 350

 Score = 39.3 bits (90), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 63/148 (42%), Gaps = 35/148 (23%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLA---L 57
           ++L SL   +G   + D+G GAG  G A+  R  +A +++ + + L    A KTL    L
Sbjct: 203 LLLDSLPALSGD--ILDVGCGAGVIGAAICQRTPDANVVMTDVNALALLSATKTLEGNNL 260

Query: 58  PANAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAH 117
            A    S   S +E                   +D +I NPPF+  +      K   EA 
Sbjct: 261 SAQVIASDMFSDVEAK-----------------FDFIISNPPFHAGL------KTNYEAT 297

Query: 118 VMLEDSFEKWIRTACAIMRSSGQLSLIA 145
                  E+++  A A ++  GQL L+A
Sbjct: 298 -------ERFLHQAPAHLKRGGQLFLVA 318


>gi|218778577|ref|YP_002429895.1| methyltransferase small [Desulfatibacillum alkenivorans AK-01]
 gi|218759961|gb|ACL02427.1| methyltransferase small [Desulfatibacillum alkenivorans AK-01]
          Length = 251

 Score = 39.3 bits (90), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 48/212 (22%), Positives = 90/212 (42%), Gaps = 22/212 (10%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++L   V       + DLG GAG   L + S   + ++   E    +A  A + +     
Sbjct: 38  VLLPHFVQCGKDSLIVDLGTGAGVIPLILTSLYPDIKVYGVEIQDSLAGLAERNV---RE 94

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGT--MTPDKIKEEAHV 118
             +  RIS+I  D+    +   + GL  N  D+V+ NPP+  R+G+  + PD  K  A  
Sbjct: 95  NGLQDRISVIRHDL----KKSPIQGLPKNI-DYVVSNPPY-RRLGSGRINPDSQKAAARH 148

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLI---ARPQSLIQIVNACA---RRIGSLEITPLHPR 172
            +  + E     A  ++   G+ +++    R   LI  +   +   +R+ ++    L P 
Sbjct: 149 EILANLEDTAGAAARLLGKGGRFAVVYPATRTAGLIHCLTKNSLEPKRMRAVHSNTLSP- 207

Query: 173 EGECASRILVTGRKGMRGQLRFRYPIVLHKPN 204
               A  +LV   KG   Q+    P+ +++ +
Sbjct: 208 ----ARLVLVEAVKGAGPQITVERPLFIYRDD 235


>gi|16271987|ref|NP_438185.1| 16S ribosomal RNA m2G1207 methyltransferase [Haemophilus influenzae
           Rd KW20]
 gi|260580684|ref|ZP_05848511.1| ribosomal RNA small subunit methyltransferase C [Haemophilus
           influenzae RdAW]
 gi|1176480|sp|P44453|RSMC_HAEIN RecName: Full=Ribosomal RNA small subunit methyltransferase C;
           AltName: Full=16S rRNA m2G1207 methyltransferase;
           AltName: Full=rRNA (guanine-N(2)-)-methyltransferase
           rsmC
 gi|1572956|gb|AAC21690.1| conserved hypothetical protein [Haemophilus influenzae Rd KW20]
 gi|260092746|gb|EEW76682.1| ribosomal RNA small subunit methyltransferase C [Haemophilus
           influenzae RdAW]
          Length = 330

 Score = 39.3 bits (90), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 41/90 (45%), Gaps = 14/90 (15%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DLG GAG  G  +  R   AQI + +   +    ARKTL   +  Q+   +   +V   +
Sbjct: 196 DLGCGAGVIGSMIKKRTPNAQITMTDIHAMALESARKTL---SENQLQGEVYASDVFSDI 252

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNERIGT 106
            G+           +D +I NPPF++ I T
Sbjct: 253 EGK-----------FDLIISNPPFHDGIDT 271


>gi|120556652|ref|YP_961003.1| putative methyltransferase [Marinobacter aquaeolei VT8]
 gi|120326501|gb|ABM20816.1| 16S rRNA m(2)G-966 methyltransferase [Marinobacter aquaeolei VT8]
          Length = 211

 Score = 39.3 bits (90), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 43/96 (44%), Gaps = 15/96 (15%)

Query: 12  SFHLA-----DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKR 66
           +FHLA     DL AG+GA GL   SR   AQ  L + +P +A   R  L L         
Sbjct: 60  NFHLAGSRCLDLFAGSGALGLEALSR-GAAQATLVDHTPALAKALRDNLRL--------- 109

Query: 67  ISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNE 102
           +   + DV      + LA      YD V M+PPF +
Sbjct: 110 LGTNKGDVACQDVEQFLAKGDGRGYDIVFMDPPFRQ 145


>gi|315503944|ref|YP_004082831.1| protein-(glutamine-n5) methyltransferase, release factor-specific
           [Micromonospora sp. L5]
 gi|315410563|gb|ADU08680.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Micromonospora sp. L5]
          Length = 296

 Score = 39.3 bits (90), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 49/94 (52%), Gaps = 5/94 (5%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DL +G+GA  LAVA  +  A+++  ERSP    + R+ +A  A A   + + ++  DVT 
Sbjct: 111 DLCSGSGAIALAVAQEVPAARVVAVERSPAALAWLRRNVAGRAAAG-DRPVEVVAADVTD 169

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPD 110
                +LAG      D ++ NPP+  R   + P+
Sbjct: 170 PDLLADLAG----RVDVLLCNPPYVPRSVAVPPE 199


>gi|330899754|gb|EGH31173.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Pseudomonas syringae pv. japonica str. M301072PT]
          Length = 277

 Score = 39.3 bits (90), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 43/96 (44%), Gaps = 12/96 (12%)

Query: 5   SLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQIS 64
            LV A  S  + DLG G GA  LA+A+   + ++   +R P     A +           
Sbjct: 103 ELVPAFASAQVLDLGTGTGAIALALANERQQWKVTAVDRVPEAVALAERN---------R 153

Query: 65  KRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF 100
           +R+ L   +V    E+    GL+   +D +I NPP+
Sbjct: 154 QRLQLNNAEVF---ESHWFGGLQGRQFDLIISNPPY 186


>gi|302342175|ref|YP_003806704.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Desulfarculus baarsii DSM 2075]
 gi|301638788|gb|ADK84110.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Desulfarculus baarsii DSM 2075]
          Length = 291

 Score = 39.3 bits (90), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 49/110 (44%), Gaps = 17/110 (15%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQ---ISKRISLIEVD 73
           DL  G GA  LA+AS+L  A++L  + S     YAR+      NAQ   + +R+S ++  
Sbjct: 122 DLCTGGGAVALALASQLPTARVLACDISAQALAYARQ------NAQALGLEERVSFLQ-- 173

Query: 74  VTLVGENRNLAGLKNNFYDHVIMNPPF--NERIGTMTPDKIKEEAHVMLE 121
               G           F+D +  NPP+  +     + PD    E  + LE
Sbjct: 174 ----GPLWEPVAATGGFFDLITANPPYVTSGEWPCLPPDVRDHEPRLALE 219


>gi|126173086|ref|YP_001049235.1| methyltransferase small [Shewanella baltica OS155]
 gi|217974607|ref|YP_002359358.1| type 12 methyltransferase [Shewanella baltica OS223]
 gi|262828680|sp|B8E5T2|TRMN6_SHEB2 RecName: Full=tRNA (adenine-N(6)-)-methyltransferase; AltName:
           Full=tRNA m6A37 methyltransferase
 gi|262828683|sp|A3D0V3|TRMN6_SHEB5 RecName: Full=tRNA (adenine-N(6)-)-methyltransferase; AltName:
           Full=tRNA m6A37 methyltransferase
 gi|125996291|gb|ABN60366.1| methyltransferase small [Shewanella baltica OS155]
 gi|217499742|gb|ACK47935.1| methyltransferase type 12 [Shewanella baltica OS223]
          Length = 238

 Score = 39.3 bits (90), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 52/218 (23%), Positives = 91/218 (41%), Gaps = 12/218 (5%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++L +    T +  + D+GAG+G   L  A R  +A I   E     A   +       N
Sbjct: 24  VVLGAWAQLTAAKTVLDIGAGSGLLSLMAAQRC-QAHITSVELDTSAAEACQHNFH---N 79

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
           +  + R++L+   +    +          ++DH+I NPP+ E+ GT      +  A    
Sbjct: 80  SPWANRLTLVNSSIQEFCQQIEY----QEYFDHIICNPPYFEQ-GTQAIQSQRAMARHTD 134

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSL-EITPLHPREGECASR 179
             SF   +      +   G  SLI   QS+ ++    A    SL E+T L    G+ A+R
Sbjct: 135 SLSFTALLDAIHVCLAPQGNASLILPMQSMARLNEILAHSPLSLIEMTNLISIVGKSANR 194

Query: 180 ILVTGRKGMRGQLRFRYP-IVLHKPNGQPYSRFVTDLI 216
           +L         Q+  +   I + + +GQ Y++ +  LI
Sbjct: 195 VLCVLAHKTHPQIATKISDITIRELSGQ-YTQTMVQLI 231


>gi|170734153|ref|YP_001766100.1| methyltransferase [Burkholderia cenocepacia MC0-3]
 gi|169817395|gb|ACA91978.1| methyltransferase [Burkholderia cenocepacia MC0-3]
          Length = 204

 Score = 39.3 bits (90), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 39/86 (45%), Gaps = 10/86 (11%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DL AG GA G   ASR   A +++ ER P  A   R          I  ++    V+V  
Sbjct: 67  DLFAGTGALGFEAASR-GAASVVMVERHPRAAQQLRA---------IKDKLGARSVEVAE 116

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNE 102
               R  AGL    +D V ++PPF++
Sbjct: 117 ADALRLAAGLTPGAFDVVFLDPPFDD 142


>gi|153002035|ref|YP_001367716.1| methyltransferase small [Shewanella baltica OS185]
 gi|262828685|sp|A6WS64|TRMN6_SHEB8 RecName: Full=tRNA (adenine-N(6)-)-methyltransferase; AltName:
           Full=tRNA m6A37 methyltransferase
 gi|151366653|gb|ABS09653.1| methyltransferase small [Shewanella baltica OS185]
          Length = 238

 Score = 39.3 bits (90), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 76/182 (41%), Gaps = 10/182 (5%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++L +    T +  + D+GAG+G   L  A R  +A I   E     A   +       N
Sbjct: 24  VVLGAWAQLTAAKTVLDIGAGSGLLSLMAAQR-SQAHITSVELDTSAAEACQHNFH---N 79

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
           +  + R++L+   +    +          ++DH+I NPP+ E+ GT      +  A    
Sbjct: 80  SPWANRLTLVNSSIQDFCQQIEY----QEYFDHIICNPPYFEQ-GTQAIQSQRAMARHTD 134

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASR 179
             SF   +      +   G  SLI   QS+ +     A  ++  +EIT L    G+ A+R
Sbjct: 135 SLSFTALLDAIHVCLAPQGNASLILPMQSMARFNEILAHSQLSLIEITNLISIVGKSANR 194

Query: 180 IL 181
           +L
Sbjct: 195 VL 196


>gi|90416051|ref|ZP_01223984.1| probable DNA methylase [marine gamma proteobacterium HTCC2207]
 gi|90332425|gb|EAS47622.1| probable DNA methylase [marine gamma proteobacterium HTCC2207]
          Length = 314

 Score = 39.3 bits (90), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 52/108 (48%), Gaps = 18/108 (16%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV-- 74
           DL  G+G  G+A A    EA+++L++ SP      + T A  A  ++  R+S +E D+  
Sbjct: 147 DLCTGSGCIGIACAYAFEEAEVVLSDISP---EALQVTAANIAQHKLGYRVSAVESDLFQ 203

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPF--NERIGTMTPDKIKEEAHVML 120
            + GE   L          ++ NPP+   E   +M PD+ + E  + L
Sbjct: 204 QMSGEQFQL----------IVSNPPYVDAEDYASM-PDEYQHEPEIAL 240


>gi|268679933|ref|YP_003304364.1| methyltransferase small [Sulfurospirillum deleyianum DSM 6946]
 gi|268617964|gb|ACZ12329.1| methyltransferase small [Sulfurospirillum deleyianum DSM 6946]
          Length = 233

 Score = 39.3 bits (90), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 24/115 (20%), Positives = 54/115 (46%), Gaps = 1/115 (0%)

Query: 91  YDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSL 150
           +D +I NPPF  +    + ++    +       FE +++     + + G        + L
Sbjct: 97  FDFIISNPPFYHQGVVKSENESLRLSRYSSALPFEAFVKKVSKNLSNRGYFCFCYDAKQL 156

Query: 151 IQIVNACARRIGSLE-ITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPN 204
             +++A      S+E +  +HP+E + AS +LV+ RK  +   +   P+++++ N
Sbjct: 157 GNVMHALLENKLSVEALRFVHPKEDKEASLVLVSARKNSKSLCKIHAPLMMYQQN 211


>gi|319774960|ref|YP_004137448.1| ribosomal RNA small subunit methyltransferase C [Haemophilus
           influenzae F3047]
 gi|329123138|ref|ZP_08251708.1| rRNA (guanine-N(2)-)-methyltransferase [Haemophilus aegyptius ATCC
           11116]
 gi|317449551|emb|CBY85756.1| ribosomal RNA small subunit methyltransferase C [Haemophilus
           influenzae F3047]
 gi|327471693|gb|EGF17135.1| rRNA (guanine-N(2)-)-methyltransferase [Haemophilus aegyptius ATCC
           11116]
          Length = 330

 Score = 39.3 bits (90), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 41/90 (45%), Gaps = 14/90 (15%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DLG GAG  G  +  R   AQI + +   +    ARKTL   +  Q+   +   +V   +
Sbjct: 196 DLGCGAGVIGSMIKKRAPNAQITMTDIHAMALESARKTL---SENQLQGEVYASDVFSNI 252

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNERIGT 106
            G+           +D +I NPPF++ I T
Sbjct: 253 EGK-----------FDLIISNPPFHDGIDT 271


>gi|303237111|ref|ZP_07323681.1| methyltransferase small domain protein [Prevotella disiens
           FB035-09AN]
 gi|302482498|gb|EFL45523.1| methyltransferase small domain protein [Prevotella disiens
           FB035-09AN]
          Length = 231

 Score = 39.3 bits (90), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 63/138 (45%), Gaps = 14/138 (10%)

Query: 9   ATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRIS 68
           A G  H+ D+G G G   L +A R  ++ I   E        A + +   A +    +I+
Sbjct: 30  ANGGEHILDIGTGTGLLALMMAQRFEKSLIDAIEIEENAYQQAAQNV---AKSVFKSKIN 86

Query: 69  LIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDS--FEK 126
           +I   +      +N A    N YD +I NPP+   + ++  ++ K +      DS  F++
Sbjct: 87  IIHSSL------QNFAKSNINQYDSIICNPPY--FVNSLKNNE-KSKTIARHNDSLPFKE 137

Query: 127 WIRTACAIMRSSGQLSLI 144
            I  A  ++++ G LSL+
Sbjct: 138 LISLAYKLLKTEGTLSLV 155


>gi|107023741|ref|YP_622068.1| hypothetical protein Bcen_2194 [Burkholderia cenocepacia AU 1054]
 gi|105893930|gb|ABF77095.1| conserved hypothetical protein 95 [Burkholderia cenocepacia AU
           1054]
          Length = 204

 Score = 39.3 bits (90), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 39/86 (45%), Gaps = 10/86 (11%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DL AG GA G   ASR   A +++ ER P  A   R          I  ++    V+V  
Sbjct: 67  DLFAGTGALGFEAASR-GAASVVMVERHPRAAQQLRA---------IKDKLGARSVEVAE 116

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNE 102
               R  AGL    +D V ++PPF++
Sbjct: 117 ADALRLAAGLTPGAFDVVFLDPPFDD 142


>gi|254787711|ref|YP_003075140.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Teredinibacter turnerae T7901]
 gi|237685052|gb|ACR12316.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Teredinibacter turnerae T7901]
          Length = 277

 Score = 39.3 bits (90), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 43/90 (47%), Gaps = 12/90 (13%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DLG G GA  LA+AS L +A I+  ++SP     A +  A         R+    V++  
Sbjct: 115 DLGTGTGAIALALASELSDAVIVAVDKSPEAVKLALRNQA---------RLGFTNVEIL- 164

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNERIGT 106
             ++   + L +  +D ++ NPP+ +   T
Sbjct: 165 --QSDWYSALGDQHFDVIVANPPYIDEKDT 192


>gi|77460933|ref|YP_350440.1| 16S rRNA m(2)G 1207 methyltransferase [Pseudomonas fluorescens
           Pf0-1]
 gi|123603324|sp|Q3K705|RSMC_PSEPF RecName: Full=Ribosomal RNA small subunit methyltransferase C;
           AltName: Full=16S rRNA m2G1207 methyltransferase;
           AltName: Full=rRNA (guanine-N(2)-)-methyltransferase
           rsmC
 gi|77384936|gb|ABA76449.1| 16S rRNA m(2)G 1207 methyltransferase [Pseudomonas fluorescens
           Pf0-1]
          Length = 332

 Score = 39.3 bits (90), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 39/136 (28%), Positives = 58/136 (42%), Gaps = 31/136 (22%)

Query: 12  SFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIE 71
           S HL D G GAG  G AV  R    Q+ L +     A  +R TLA  AN   ++ ++   
Sbjct: 192 SGHLLDFGCGAGVLGAAVKRRYPHNQVTLLDVDAFAAASSRLTLA--ANGLEAEVLTGDG 249

Query: 72  VDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSF--EKWIR 129
           +D   +G N             ++ NPPF+  +G  T             D F  E  +R
Sbjct: 250 IDAAPMGLNA------------ILSNPPFH--VGVHT-------------DYFATENLLR 282

Query: 130 TACAIMRSSGQLSLIA 145
            A   +++ G+L L+A
Sbjct: 283 KAAKHLKNGGELRLVA 298


>gi|145633431|ref|ZP_01789161.1| 16S ribosomal RNA m2G1207 methyltransferase [Haemophilus influenzae
           3655]
 gi|144985994|gb|EDJ92596.1| 16S ribosomal RNA m2G1207 methyltransferase [Haemophilus influenzae
           3655]
          Length = 330

 Score = 39.3 bits (90), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 41/90 (45%), Gaps = 14/90 (15%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DLG GAG  G  +  R   AQI + +   +    ARKTL   +  Q+   +   +V   +
Sbjct: 196 DLGCGAGVIGSMIKKRAPNAQITMTDIHAMALESARKTL---SENQLQGEVYASDVFSNI 252

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNERIGT 106
            G+           +D +I NPPF++ I T
Sbjct: 253 EGK-----------FDLIISNPPFHDGIDT 271


>gi|254251374|ref|ZP_04944692.1| N6-adenine-specific methylase [Burkholderia dolosa AUO158]
 gi|124893983|gb|EAY67863.1| N6-adenine-specific methylase [Burkholderia dolosa AUO158]
          Length = 225

 Score = 39.3 bits (90), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 38/86 (44%), Gaps = 10/86 (11%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DL AG GA G   ASR   A +++ ER P  A   R          I  ++    V+V  
Sbjct: 88  DLFAGTGALGFEAASR-GAASVVMVERHPRAAQQLRA---------IKDKLGARTVEVAE 137

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNE 102
               R  AGL    +D V ++PPF E
Sbjct: 138 ADGLRLAAGLAPGAFDVVFLDPPFGE 163


>gi|330941683|gb|EGH44458.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Pseudomonas syringae pv. pisi str. 1704B]
          Length = 277

 Score = 39.3 bits (90), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 44/96 (45%), Gaps = 12/96 (12%)

Query: 5   SLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQIS 64
            LV A     + DLG G GA  LA+A+   + ++   +R P     A +           
Sbjct: 103 ELVPAFAPAQVLDLGTGTGAIALALANERQQWKVTAVDRVPEAVALAERN---------R 153

Query: 65  KRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF 100
           +R+ L   +V    E+  L+GL+   +D +I NPP+
Sbjct: 154 QRLQLNNAEVF---ESHWLSGLQGRQFDLIISNPPY 186


>gi|34540837|ref|NP_905316.1| hypothetical protein PG1104 [Porphyromonas gingivalis W83]
 gi|81833778|sp|Q7MVG0|TRMN6_PORGI RecName: Full=tRNA (adenine-N(6)-)-methyltransferase; AltName:
           Full=tRNA m6A37 methyltransferase
 gi|34397151|gb|AAQ66215.1| conserved hypothetical protein [Porphyromonas gingivalis W83]
          Length = 255

 Score = 39.3 bits (90), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 63/140 (45%), Gaps = 9/140 (6%)

Query: 8   NATGSF--HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISK 65
           +A GS   H  D+G G G   L +A R  +A++   E  P+ A  AR      A +  S 
Sbjct: 36  DAAGSIPQHCLDIGTGTGLIALMLAQRFPQARVQGIEIDPIAAECARANA---AASPFSD 92

Query: 66  RISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFE 125
           RI +   D+ L     +L G  N  +D ++ NPPF +      PD+ +  A        E
Sbjct: 93  RIVIASGDI-LDSSLESLIG--NQRFDLIVSNPPFFKS-SMHAPDRQRTMARHEETLPLE 148

Query: 126 KWIRTACAIMRSSGQLSLIA 145
           K I  A  ++   G+L+LI 
Sbjct: 149 KLICRASELLSPQGRLALIT 168


>gi|260494434|ref|ZP_05814564.1| ribosomal RNA small subunit methyltransferase C [Fusobacterium sp.
           3_1_33]
 gi|260197596|gb|EEW95113.1| ribosomal RNA small subunit methyltransferase C [Fusobacterium sp.
           3_1_33]
          Length = 225

 Score = 38.9 bits (89), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 43/193 (22%), Positives = 83/193 (43%), Gaps = 21/193 (10%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           L D+G G G   + +++    ++++  +        A K L L    +I K I    +D+
Sbjct: 48  LLDIGTGNGILPILLSNNEFLSELVGIDIQKENIDRANKALQL---NKIEKNIQFECIDI 104

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLED-----SFEKWIR 129
               E R     K+N++D +I NPP+ +  G     KI E  H  +       S  + I 
Sbjct: 105 R---EYR-----KSNYFDVIISNPPYMDDNGK----KINENEHKAISRHEIKLSLNELIS 152

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNACARRIGSL-EITPLHPREGECASRILVTGRKGM 188
            A  +++  G L  I R   L++I+    +   S+ +I  ++  +   ++ + V   KG 
Sbjct: 153 NAKRLLKPIGLLYFIHRTHRLVEIIKVLDKNNFSIKKIIFIYSAQNNKSTMMFVEAIKGK 212

Query: 189 RGQLRFRYPIVLH 201
           + +L  +   + H
Sbjct: 213 KIKLEIQNYYIYH 225


>gi|145635202|ref|ZP_01790906.1| 16S ribosomal RNA m2G1207 methyltransferase [Haemophilus influenzae
           PittAA]
 gi|229845358|ref|ZP_04465489.1| 16S ribosomal RNA m2G1207 methyltransferase [Haemophilus influenzae
           6P18H1]
 gi|145267481|gb|EDK07481.1| 16S ribosomal RNA m2G1207 methyltransferase [Haemophilus influenzae
           PittAA]
 gi|229811666|gb|EEP47364.1| 16S ribosomal RNA m2G1207 methyltransferase [Haemophilus influenzae
           6P18H1]
          Length = 330

 Score = 38.9 bits (89), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 41/90 (45%), Gaps = 14/90 (15%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DLG GAG  G  +  R   AQI + +   +    ARKTL   +  Q+   +   +V   +
Sbjct: 196 DLGCGAGVIGSMIKKRAPNAQITMTDIHAMALESARKTL---SENQLQGEVYASDVFSDI 252

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNERIGT 106
            G+           +D +I NPPF++ I T
Sbjct: 253 EGK-----------FDLIISNPPFHDGIDT 271


>gi|297568590|ref|YP_003689934.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Desulfurivibrio alkaliphilus AHT2]
 gi|296924505|gb|ADH85315.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Desulfurivibrio alkaliphilus AHT2]
          Length = 299

 Score = 38.9 bits (89), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 58/139 (41%), Gaps = 18/139 (12%)

Query: 13  FHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEV 72
           + + DLG G+G   + +A  +  AQ++  +RSP     AR        A+          
Sbjct: 128 WRILDLGTGSGILAVVLAREIASAQVVALDRSPAALAMARANARRHGVAE---------- 177

Query: 73  DVTLVGENRNLAGLKNNFYDHVIMNPPFNERIG--TMTPDKIKEEAHVMLE------DSF 124
            +T VG +   A      +D V+ NPP+  R    T+ P+  + E H  L+      D  
Sbjct: 178 KITFVGSDWLSALAARPAFDLVVANPPYVCRSAMLTLQPEVREHEPHTALDGGRQGLDDI 237

Query: 125 EKWIRTACAIMRSSGQLSL 143
           +   R   A++R  G L L
Sbjct: 238 KIICRDLPAVLRPDGLLLL 256


>gi|319896430|ref|YP_004134623.1| ribosomal RNA small subunit methyltransferase c [Haemophilus
           influenzae F3031]
 gi|317431932|emb|CBY80280.1| ribosomal RNA small subunit methyltransferase C [Haemophilus
           influenzae F3031]
          Length = 330

 Score = 38.9 bits (89), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 41/90 (45%), Gaps = 14/90 (15%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DLG GAG  G  +  R   AQI + +   +    ARKTL   +  Q+   +   +V   +
Sbjct: 196 DLGCGAGVIGSMIKKRAPNAQITMTDIHAMALESARKTL---SENQLQGEVYASDVFSDI 252

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNERIGT 106
            G+           +D +I NPPF++ I T
Sbjct: 253 EGK-----------FDLIISNPPFHDGIDT 271


>gi|291320135|ref|YP_003515393.1| DNA methylase [Mycoplasma agalactiae]
 gi|290752464|emb|CBH40436.1| DNA methylase [Mycoplasma agalactiae]
          Length = 261

 Score = 38.9 bits (89), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 45/198 (22%), Positives = 80/198 (40%), Gaps = 15/198 (7%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + ++G   GA  + ++ R    +I   E     A  A   + +  N Q  ++I++I+ D 
Sbjct: 50  MLEIGTNNGALSIFISERSKNLKIDAIEIQEKAAKLATDNVII-NNKQ--EQINVIQADF 106

Query: 75  T-LVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLED---SFEKWIRT 130
                E+  L   K   Y+ ++ NPPF     +    KI EE  +   +   + E+ I  
Sbjct: 107 NDFYKEHTKLVKPK---YEAIVCNPPFYVYDKSKISKKISEEVLIATHEVKLNLEQIISG 163

Query: 131 ACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE---ITPLHPREGECASRILVTGRKG 187
           +  I+   G L+L+   + L+     C  R    E   +  + PR  +    +LV  R  
Sbjct: 164 SAKIIEQKGYLTLVIPAERLVDCF--CLMRQYKFEPKRVQFMIPRVYDKPKLVLVEARYQ 221

Query: 188 MRGQLRFRYPIVLHKPNG 205
               + F   + LH PN 
Sbjct: 222 AGWGIHFLPNLYLHDPND 239


>gi|269137803|ref|YP_003294503.1| 16S RNA G1207 methylase RsmC [Edwardsiella tarda EIB202]
 gi|267983463|gb|ACY83292.1| 16S RNA G1207 methylase RsmC [Edwardsiella tarda EIB202]
 gi|304557858|gb|ADM40522.1| 23S rRNA (guanine-N-2-) -methyltransferase RmG [Edwardsiella tarda
           FL6-60]
          Length = 381

 Score = 38.9 bits (89), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 9/89 (10%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           +ADLG G G  GLA  S   +A++L A+ S +    AR       N Q ++   L   + 
Sbjct: 238 VADLGCGNGVLGLAALSSSPQARVLFADESYMAVASAR------LNVQHNRPQDLARCEF 291

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNER 103
            +      LAG +    D V+ NPPF+++
Sbjct: 292 WV---GNGLAGREGGTLDAVLCNPPFHQQ 317


>gi|148827172|ref|YP_001291925.1| 16S ribosomal RNA m2G1207 methyltransferase [Haemophilus influenzae
           PittGG]
 gi|226712956|sp|A5UFI6|RSMC_HAEIG RecName: Full=Ribosomal RNA small subunit methyltransferase C;
           AltName: Full=16S rRNA m2G1207 methyltransferase;
           AltName: Full=rRNA (guanine-N(2)-)-methyltransferase
           rsmC
 gi|148718414|gb|ABQ99541.1| 16S ribosomal RNA m2G1207 methyltransferase [Haemophilus influenzae
           PittGG]
          Length = 330

 Score = 38.9 bits (89), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 41/90 (45%), Gaps = 14/90 (15%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DLG GAG  G  +  R   AQI + +   +    ARKTL   +  Q+   +   +V   +
Sbjct: 196 DLGCGAGVIGSMIKKRAPNAQITMTDIHAMALESARKTL---SENQLQGEVYASDVFSDI 252

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNERIGT 106
            G+           +D +I NPPF++ I T
Sbjct: 253 EGK-----------FDLIISNPPFHDGIDT 271


>gi|240139009|ref|YP_002963484.1| hypothetical protein MexAM1_META1p2426 [Methylobacterium extorquens
           AM1]
 gi|240008981|gb|ACS40207.1| conserved hypothetical protein [Methylobacterium extorquens AM1]
          Length = 341

 Score = 38.9 bits (89), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 48/85 (56%), Gaps = 13/85 (15%)

Query: 16  ADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVT 75
           AD+G G+GAAG+ VA RL EA+++L + +P     AR       NA+++   ++  V   
Sbjct: 163 ADIGCGSGAAGILVAKRLPEAEVVLVDINPAALRAAR------INARLAGVGNVRPVHSD 216

Query: 76  LVGENRNLAGLKNNFYDHVIMNPPF 100
           +      L+ ++ +F D ++ NPPF
Sbjct: 217 M------LSNVEGSF-DLIVSNPPF 234


>gi|146305786|ref|YP_001186251.1| 16S rRNA m(2)G 1207 methyltransferase [Pseudomonas mendocina ymp]
 gi|145573987|gb|ABP83519.1| 16S rRNA m(2)G 1207 methyltransferase / 23S rRNA m(2)G-1835
           methyltransferase [Pseudomonas mendocina ymp]
          Length = 377

 Score = 38.9 bits (89), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 52/116 (44%), Gaps = 13/116 (11%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           +ADLG G G  G+A A    +AQ+ L + S +    AR+  A    A + +R + I    
Sbjct: 238 VADLGCGNGVLGIAYALGSPQAQLTLVDESYMAVQSARENWA----AALGERPATIRA-- 291

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNER--IGTMTPDKIKEEAHVMLEDSFEKWI 128
                   LA       D V+ NPPF+++  +G     ++ ++A   L    E WI
Sbjct: 292 -----GDGLAEQPAGSLDLVLCNPPFHQQQVVGDFLAWRMFQQARAALVTGGELWI 342


>gi|284992527|ref|YP_003411081.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Geodermatophilus obscurus DSM 43160]
 gi|284065772|gb|ADB76710.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Geodermatophilus obscurus DSM 43160]
          Length = 286

 Score = 38.9 bits (89), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 59/135 (43%), Gaps = 11/135 (8%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DLG+G+GA  L++A     A++   ER P    + R   A  A A  +  + ++  D+
Sbjct: 114 VVDLGSGSGAIALSIAHEHPGARVTAVERDPGAIEWTRHNAASRAAAGDTP-VDVLSGDM 172

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLE------DSFEKWI 128
           T  G  R L G      D V+ NPP+     T+  +    +  + L       D     +
Sbjct: 173 TDPGLLRELDG----TVDLVVSNPPYVPDGATVPREVADHDPPLALWGGPDGLDVVRGLL 228

Query: 129 RTACAIMRSSGQLSL 143
           RTA  ++R  G L +
Sbjct: 229 RTAARLLRPGGGLGI 243


>gi|229564351|sp|A4XQA3|RLMG_PSEMY RecName: Full=Ribosomal RNA large subunit methyltransferase G;
           AltName: Full=23S rRNA m2G1835 methyltransferase;
           AltName: Full=rRNA (guanine-N(2)-)-methyltransferase
           rlmG
          Length = 374

 Score = 38.9 bits (89), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 52/116 (44%), Gaps = 13/116 (11%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           +ADLG G G  G+A A    +AQ+ L + S +    AR+  A    A + +R + I    
Sbjct: 235 VADLGCGNGVLGIAYALGSPQAQLTLVDESYMAVQSARENWA----AALGERPATIRA-- 288

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNER--IGTMTPDKIKEEAHVMLEDSFEKWI 128
                   LA       D V+ NPPF+++  +G     ++ ++A   L    E WI
Sbjct: 289 -----GDGLAEQPAGSLDLVLCNPPFHQQQVVGDFLAWRMFQQARAALVTGGELWI 339


>gi|183599785|ref|ZP_02961278.1| hypothetical protein PROSTU_03293 [Providencia stuartii ATCC 25827]
 gi|188022049|gb|EDU60089.1| hypothetical protein PROSTU_03293 [Providencia stuartii ATCC 25827]
          Length = 242

 Score = 38.9 bits (89), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 66/146 (45%), Gaps = 11/146 (7%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           D+G+G+G   L +A R  +  +   E     A  A++     A ++  +R+ + E D+T 
Sbjct: 47  DIGSGSGLIALMLAQRNQQMTVDAVELDKAAAQQAQENF---AESKWGERLQIFEQDITQ 103

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMR 136
              +R  A      YD ++ NPP+ E   + + ++ +E+A      + +  + +A   + 
Sbjct: 104 FSVSRQKA------YDLIVSNPPYFEPSVSCSSEQ-REQARYTATLTHQALLDSAMDCLT 156

Query: 137 SSGQLSLIARPQSLIQIVNACARRIG 162
           + G   L+  P  + + V   A R G
Sbjct: 157 TDGLFCLVL-PYDVGEKVELMAHRNG 181


>gi|167755129|ref|ZP_02427256.1| hypothetical protein CLORAM_00633 [Clostridium ramosum DSM 1402]
 gi|237733445|ref|ZP_04563926.1| methyltransferase [Mollicutes bacterium D7]
 gi|167705179|gb|EDS19758.1| hypothetical protein CLORAM_00633 [Clostridium ramosum DSM 1402]
 gi|229383480|gb|EEO33571.1| methyltransferase [Coprobacillus sp. D7]
          Length = 245

 Score = 38.9 bits (89), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 47/210 (22%), Positives = 90/210 (42%), Gaps = 17/210 (8%)

Query: 1   MILASLVNATGSF-HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPA 59
           ++LA+    T     + D G    A  L ++ R +   I   E        A K + L  
Sbjct: 32  VLLANFCTITKDVKQIIDFGTNNAAIPLLLSQRTNRP-ITGIEIQKEAVDLAIKNIEL-- 88

Query: 60  NAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFN--ERIGTMTPDKIKEEAH 117
              +  +I+++  D+    ++    GL       VI NPPF   +    +  ++    A 
Sbjct: 89  -NNLETQINIVHADIAEYVKDAKKVGL-------VICNPPFFKVDEDSNLNENEYLTIAR 140

Query: 118 VMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGEC 176
             ++ + E  I++A  I+ + G+ +++ RP  +I I+N   +  I    I  ++P+    
Sbjct: 141 HEIKINLEGIIKSAARILDNKGKFAMVHRPDRMIDILNLMQKYDIEPKRIRFVYPKIDRD 200

Query: 177 ASRILVTG-RKGMRGQLRFRYPIVLHKPNG 205
           +  +LV G  KG +G L+   P+  H  +G
Sbjct: 201 SHVLLVEGMYKGKKG-LKIEPPLYAHNADG 229


>gi|238854753|ref|ZP_04645083.1| GIY-YIG catalytic domain protein [Lactobacillus jensenii 269-3]
 gi|260663985|ref|ZP_05864838.1| O-methyltransferase [Lactobacillus jensenii SJ-7A-US]
 gi|282932856|ref|ZP_06338253.1| O-methyltransferase [Lactobacillus jensenii 208-1]
 gi|313472273|ref|ZP_07812765.1| methyltransferase [Lactobacillus jensenii 1153]
 gi|238832543|gb|EEQ24850.1| GIY-YIG catalytic domain protein [Lactobacillus jensenii 269-3]
 gi|239529672|gb|EEQ68673.1| methyltransferase [Lactobacillus jensenii 1153]
 gi|260561871|gb|EEX27840.1| O-methyltransferase [Lactobacillus jensenii SJ-7A-US]
 gi|281302891|gb|EFA95096.1| O-methyltransferase [Lactobacillus jensenii 208-1]
          Length = 336

 Score = 38.9 bits (89), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 80/184 (43%), Gaps = 21/184 (11%)

Query: 36  AQILLAERSPLMAHYARKTLALPANAQISKRISL------IEVDVTLVGENRNLAGLKNN 89
           A I LA RS   AH+    +   A  Q  + I L      +E  +  V +     G +NN
Sbjct: 59  ASIYLAHRSE--AHFKTIEIQEHAYDQGKRSIELNHLENRVEPFLGDVNDAVKFVGRQNN 116

Query: 90  FYDHVIMNPPFNERI--GTMTPDKIKEEA-HVMLEDSFEKWIRTACAIMRSSGQLSLIAR 146
               V++NPP+ +      + P++ K  A H +L D  E  I  A  ++++ G+L ++ R
Sbjct: 117 M---VLVNPPYFKVAPGHVVNPNEKKAIARHEILVD-LEHIILQASQVLKNKGRLVMVHR 172

Query: 147 PQSLIQIVNACARRIGSLEITPLHPR----EGECASRILVTGRKGMRGQLRFRYPIVLHK 202
           P+ L +I   C +   +L +  + P     E E    ++   + G    L  + PI+   
Sbjct: 173 PERLGEICYFCQKY--NLPVKKIQPYSSSAEKESNLIVITASKNGASDGLILKSPIITQT 230

Query: 203 PNGQ 206
            +G 
Sbjct: 231 SDGH 234


>gi|54023022|ref|YP_117264.1| putative methyltransferase [Nocardia farcinica IFM 10152]
 gi|54014530|dbj|BAD55900.1| putative methyltransferase [Nocardia farcinica IFM 10152]
          Length = 290

 Score = 38.9 bits (89), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 48/104 (46%), Gaps = 5/104 (4%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DL  G+GA  LA+A    +AQ+   E  P    +AR+     A+ +I+   + I +    
Sbjct: 122 DLCTGSGALALAIAHARPDAQVHAVELDPAALRWARRN----ADERIADGDTPITLHADD 177

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
           V +   L  L N   D V+ NPP+      + P+ +  + H+ L
Sbjct: 178 VTDPSLLTDL-NGRVDLVVANPPYIPEGAVLDPEVVDHDPHLAL 220


>gi|317151857|ref|YP_004119905.1| methyltransferase small [Desulfovibrio aespoeensis Aspo-2]
 gi|316942108|gb|ADU61159.1| methyltransferase small [Desulfovibrio aespoeensis Aspo-2]
          Length = 268

 Score = 38.9 bits (89), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 41/192 (21%), Positives = 78/192 (40%), Gaps = 13/192 (6%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DLG G G  GLA+  R  + ++   +  P     A        N   + R +    DV  
Sbjct: 55  DLGCGCGVVGLALLLRQPDLRLTGVDIDPESVRVAGLNA---VNLHYADRYAATLADVAQ 111

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNE-RIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIM 135
               R +        D V+ NPP+     G ++  + +  A       F  + + A   +
Sbjct: 112 WRSERVV--------DFVVANPPYRPLGCGRVSQGESRAVARFESRGDFALFAQCAAVAL 163

Query: 136 RSSGQLSLIARPQSLIQIVNACARR-IGSLEITPLHPREGECASRILVTGRKGMRGQLRF 194
           R+ G+ + +  P+ L +I++  ++  +    +  ++ R  + A   LV   K  +  LR 
Sbjct: 164 RTRGRFTFVHLPERLSEIMDGLSKAGLAPKRLRLVYGRSDQEARMALVEAVKAGKPGLRV 223

Query: 195 RYPIVLHKPNGQ 206
             P++LH  +G+
Sbjct: 224 EPPLILHSGSGR 235


>gi|51894217|ref|YP_076908.1| hypothetical protein STH3082 [Symbiobacterium thermophilum IAM
           14863]
 gi|51857906|dbj|BAD42064.1| conserved hypothetical protein [Symbiobacterium thermophilum IAM
           14863]
          Length = 206

 Score = 38.9 bits (89), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 61/147 (41%), Gaps = 20/147 (13%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DLG G G  G+  A    +  I + E +   A  AR+ L   A A    R          
Sbjct: 63  DLGCGYGPIGIVAARLAPQGFIYMVEINERAAELARRNLEANAIANAEVR---------- 112

Query: 77  VGEN-RNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIM 135
           VG+    +AG+    +D V+ NPP   R G  T  ++ +EAH  L+     W+     + 
Sbjct: 113 VGDGLEPVAGIA---FDAVVTNPPI--RAGKATVYRLLDEAHAALKPGGSLWV----VVQ 163

Query: 136 RSSGQLSLIARPQSLIQIVNACARRIG 162
              G  S+  + ++L   V   AR+ G
Sbjct: 164 NKQGAPSMKRKLEALFGNVEDVARQAG 190


>gi|119476715|ref|ZP_01617025.1| probable DNA methylase [marine gamma proteobacterium HTCC2143]
 gi|119449971|gb|EAW31207.1| probable DNA methylase [marine gamma proteobacterium HTCC2143]
          Length = 311

 Score = 38.9 bits (89), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 48/109 (44%), Gaps = 12/109 (11%)

Query: 13  FHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEV 72
           F + DL +G G  G+A A    EAQ+ L + S      A + +      ++  R+S+I+ 
Sbjct: 133 FEILDLCSGGGCIGIACAHYFEEAQVSLVDLSAPALQVAVENI---QRFELPHRVSVIQS 189

Query: 73  DVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMT-PDKIKEEAHVML 120
           D+          GL    Y  ++ NPP+ + +   T P +   E  + L
Sbjct: 190 DL--------FTGLVGRTYQLIVANPPYVDGVDLQTMPAEYHHEPQLAL 230


>gi|255626525|gb|ACU13607.1| unknown [Glycine max]
          Length = 169

 Score = 38.9 bits (89), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 42/104 (40%), Gaps = 19/104 (18%)

Query: 6   LVNATGSFH------LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPA 59
           L  A  SF       +AD G G G  G+A A        LL+    L      ++L + +
Sbjct: 37  LFTAENSFEDVSDKVVADFGCGCGTLGVAAA--------LLSAEHVLGIDIDPESLEIAS 88

Query: 60  NAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNER 103
           N         +EVD+  +  N    G +    D VIMNPPF  R
Sbjct: 89  N-----NAEELEVDIDFIQSNVMDLGWRGRIVDTVIMNPPFGTR 127


>gi|330501770|ref|YP_004378639.1| 16S rRNA m(2)G 1207 methyltransferase [Pseudomonas mendocina NK-01]
 gi|328916056|gb|AEB56887.1| 16S rRNA m(2)G 1207 methyltransferase [Pseudomonas mendocina NK-01]
          Length = 374

 Score = 38.9 bits (89), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 55/116 (47%), Gaps = 13/116 (11%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           +ADLG G G  G+A A    +AQ+ L + S +             +AQ + R +L E  V
Sbjct: 235 VADLGCGNGVLGIAYALGSPQAQLTLVDESYMAVQ----------SAQENWRAALGERPV 284

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNER--IGTMTPDKIKEEAHVMLEDSFEKWI 128
           T+   +  LA    +  D V+ NPPF+++  +G     ++ ++A   L    E WI
Sbjct: 285 TIRAGD-GLAEQPADSLDLVLCNPPFHQQQVVGDFLAWRMFQQARSALVTGGELWI 339


>gi|85859820|ref|YP_462022.1| methyltransferase [Syntrophus aciditrophicus SB]
 gi|85722911|gb|ABC77854.1| methyltransferase [Syntrophus aciditrophicus SB]
          Length = 254

 Score = 38.9 bits (89), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 50/234 (21%), Positives = 100/234 (42%), Gaps = 28/234 (11%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA  +    +  L D+G G+G   L  A R  + +I   +    M   A ++ AL + 
Sbjct: 34  LLLAHFIRLRRNESLLDMGTGSGVIALITAMRRPDVRIAGIDIQEEMVEMASRSAALNS- 92

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNE-RIGTMTPDKIKEEAHVM 119
             + +R++    D+  +   R +    +  +D V++NPP+ +   G + P   K  A   
Sbjct: 93  --LEERLTFKAGDIHSI---RRI--FDSESFDAVVVNPPYRKLHSGRINPRGEKALARHE 145

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPR-----EG 174
           +  +   ++  A  ++R  G++        +I  +   A  I  +  T L P+       
Sbjct: 146 VRGTLRDFLEAASYVLRPGGRI-------FVIYPIRRMAALIAGMRKTVLEPKRCRIIHS 198

Query: 175 ECASR---ILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSLTRL 225
            C +    IL  G KG   +L    P+ +++  G+ Y+  + ++ N    L+RL
Sbjct: 199 RCDTEGIFILAEGCKGGGEELEILPPLFIYRNEGE-YTEAMGEIFN---ELSRL 248


>gi|311748643|ref|ZP_07722428.1| putative transferase [Algoriphagus sp. PR1]
 gi|126577169|gb|EAZ81417.1| putative transferase [Algoriphagus sp. PR1]
          Length = 236

 Score = 38.9 bits (89), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 46/220 (20%), Positives = 87/220 (39%), Gaps = 31/220 (14%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           +++  LV+      + D+G G G   L +A R  E+ +   E     A  A+        
Sbjct: 27  VLMGGLVHGENPHRILDVGTGTGVIALMLAQRYRESFLTAVELDEKAAEQAKSNF---KE 83

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIK----EEA 116
           +  S R+ L +      GE ++     +  +D ++ NPP+        PD +K    +  
Sbjct: 84  SPFSNRMKLWK------GEFQSYQS--DEKFDMIVSNPPY-------FPDHLKAKDSQRN 128

Query: 117 HVMLED--SFEKWIRTACAIMRSSGQLSLIARP---QSLIQIVNACARRIGSLEITPLHP 171
             +  D  SF+  +  A +++   G   +I  P   Q  IQI       I  +E   +  
Sbjct: 129 QALHTDALSFKDLVSKASSLITEDGNFWVILPPRQMQDFIQITEEVGFHI--IEKLTVQD 186

Query: 172 REGECASRILVTGRKGMRGQLRFRYPIVLHKPNGQPYSRF 211
           + G+   R +V   K +R  L  +  + +   +G P+  +
Sbjct: 187 KPGKKVLREIVCFSKILRDLLEKQ--VFIKNEDGSPHMSY 224


>gi|126733090|ref|ZP_01748845.1| N-6 Adenine-specific DNA methylase [Sagittula stellata E-37]
 gi|126706467|gb|EBA05549.1| N-6 Adenine-specific DNA methylase [Sagittula stellata E-37]
          Length = 153

 Score = 38.9 bits (89), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 46/102 (45%), Gaps = 10/102 (9%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           +ILA+ V A     + +LG G GAA   +  R+    +   E  P  A  AR+ LA   N
Sbjct: 22  VILAASVQACAGETVLELGCGGGAALCCLGWRVPGLTLTGLEIQPGYADLARRNLA--GN 79

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNE 102
               +   + E DV         A LK   +DHVI NPP+ E
Sbjct: 80  GLAGE---IHEGDVAA-----PPAALKARSFDHVIANPPYFE 113


>gi|257462415|ref|ZP_05626829.1| methyltransferase [Fusobacterium sp. D12]
 gi|317060079|ref|ZP_07924564.1| methyltransferase [Fusobacterium sp. D12]
 gi|313685755|gb|EFS22590.1| methyltransferase [Fusobacterium sp. D12]
          Length = 368

 Score = 38.5 bits (88), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 30/133 (22%), Positives = 60/133 (45%), Gaps = 20/133 (15%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           D+G G+GA  + +A  + EA++L  ++S      A++        Q+ + +S ++ D+  
Sbjct: 203 DIGTGSGAIAITLAKEVPEAEVLGIDKSEKALSLAKEN----KEYQLVRNVSFLQSDL-- 256

Query: 77  VGENRNLAGLKNNFYDHVIMNPPF--NERIGTMTPDKIKEEAHVMLEDS------FEKWI 128
                    L+   +D ++ NPP+   E    + P+  K E    L D       ++K I
Sbjct: 257 ------FEALQGQRFDIIVSNPPYISQEEYEDLMPEVKKYEPKNALTDEGDGYSFYQKII 310

Query: 129 RTACAIMRSSGQL 141
           + A + ++  G L
Sbjct: 311 QQANSHLQKKGYL 323


>gi|154175164|ref|YP_001408352.1| UDP-MurNac-pentapeptide presynthetase [Campylobacter curvus 525.92]
 gi|112803155|gb|EAU00499.1| UDP-MurNac-pentapeptide presynthetase [Campylobacter curvus 525.92]
          Length = 237

 Score = 38.5 bits (88), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 46/208 (22%), Positives = 86/208 (41%), Gaps = 30/208 (14%)

Query: 7   VNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKR 66
           +NA     + D+G G G  GL +      A + L +   +    +R+          + R
Sbjct: 27  LNAWFKGEVLDVGCGCGVLGLLLKRDFKGASLSLLDVQDINLEISRQ----------NAR 76

Query: 67  ISLIEVDVTLVGENRNLAGLKNNF-YDHVIMNPPFNERIGTMTPDKIKEEA--HVMLED- 122
            + +E  +     N + AG K+   +D ++ NPPF         D +K+ A  H+ L   
Sbjct: 77  ANGLEAKIL----NADFAGFKSETKFDLIVSNPPFYH-------DGVKQSAVEHLKLSRY 125

Query: 123 ----SFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECA 177
               S   +I  A   ++  G+L        + +I  A    R+  + +  +H +  + A
Sbjct: 126 ASALSLCGFIAGANVNLKPKGELFFCYDTAEVAEIFAALKEFRLVPVSLRFVHAKAQKAA 185

Query: 178 SRILVTGRKGMRGQLRFRYPIVLHKPNG 205
           + +LV  +KG R + +   P+V+   NG
Sbjct: 186 NLVLVHAKKGSRSKAKILPPLVMMDENG 213


>gi|206559191|ref|YP_002229951.1| hypothetical protein BCAL0794 [Burkholderia cenocepacia J2315]
 gi|198035228|emb|CAR51102.1| conserved hypothetical protein [Burkholderia cenocepacia J2315]
          Length = 204

 Score = 38.5 bits (88), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 39/86 (45%), Gaps = 10/86 (11%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DL AG GA G   ASR   A +++ ER P  A   R          I  ++    V++  
Sbjct: 67  DLFAGTGALGFEAASR-GAASVVMVERHPRAAQQLRA---------IKDKLGARSVEIAE 116

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNE 102
               R  AGL    +D V ++PPF++
Sbjct: 117 ADALRLAAGLTPGAFDVVFLDPPFDD 142


>gi|296109907|ref|YP_003616856.1| methyltransferase small [Methanocaldococcus infernus ME]
 gi|295434721|gb|ADG13892.1| methyltransferase small [Methanocaldococcus infernus ME]
          Length = 196

 Score = 38.5 bits (88), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 50/127 (39%), Gaps = 17/127 (13%)

Query: 2   ILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANA 61
           +L   V       + DLG G GA G+A+A  +         +  LM    R+ L L    
Sbjct: 46  LLIETVEVNKEDEILDLGCGYGAIGIALADEV---------KKVLMVDINRRALKLAKEN 96

Query: 62  QISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLE 121
                I   EV  + + EN +        +D +I NPP   R G     KI  EA   L+
Sbjct: 97  VKLNNIKNAEVRFSDLYENVDEK------FDKIITNPPI--RAGKDVVKKIVSEALNHLK 148

Query: 122 DSFEKWI 128
           D  E W+
Sbjct: 149 DGGELWM 155


>gi|148377473|ref|YP_001256349.1| DNA methylase [Mycoplasma agalactiae PG2]
 gi|148291519|emb|CAL58905.1| DNA methylase [Mycoplasma agalactiae PG2]
          Length = 261

 Score = 38.5 bits (88), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 46/198 (23%), Positives = 79/198 (39%), Gaps = 15/198 (7%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + ++G   GA  + ++ R    +I   E     A  A   + L  N Q  ++I++I+ D 
Sbjct: 50  MLEIGTNNGALSIFISERSKNLKIDAIEIQEKAAKLAANNVIL-NNKQ--EQINVIQADF 106

Query: 75  T-LVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLED---SFEKWIRT 130
                E+  L   K   Y+ ++ NPPF     +    KI EE  +   +   + E+ I  
Sbjct: 107 NDFYKEHTKLVKPK---YEAIVCNPPFYVYDKSKISKKISEEVLIATHEVKLNLEQIISG 163

Query: 131 ACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLE---ITPLHPREGECASRILVTGRKG 187
           +  I+   G L+L+   + L+     C  R    E   +  + PR  +    +LV  R  
Sbjct: 164 SAKIIEQKGYLTLVIPAERLVDCF--CLMRQYKFEPKRVQFMIPRVYDKPKLVLVEARYQ 221

Query: 188 MRGQLRFRYPIVLHKPNG 205
                 F   + LH PN 
Sbjct: 222 AGWGTHFLPNLYLHDPND 239


>gi|94499825|ref|ZP_01306361.1| methyltransferase, putative [Oceanobacter sp. RED65]
 gi|94428026|gb|EAT13000.1| methyltransferase, putative [Oceanobacter sp. RED65]
          Length = 189

 Score = 38.5 bits (88), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 49/114 (42%), Gaps = 18/114 (15%)

Query: 14  HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVD 73
           H+ D+ AG+GA G    SR  E  +LL + +  +         L  NA +      ++ D
Sbjct: 52  HVLDVFAGSGALGFEALSRGAEHGVLLEKNAKAVKQLKENCQVLSCNADV------VQTD 105

Query: 74  VTLVGENRNLAGLKNNFYDHVIMNPPFNERI------GTMTPDKIKEEAHVMLE 121
             +  +N   A      +D + ++PPFN+ +           D +KE+  + +E
Sbjct: 106 ALVFLQNCEQA------FDVIFLDPPFNKGLLPSCLQAIQDKDLLKEDGWIYIE 153


>gi|262380905|ref|ZP_06074055.1| methyltransferase-endonuclease [Acinetobacter radioresistens SH164]
 gi|262297468|gb|EEY85387.1| methyltransferase-endonuclease [Acinetobacter radioresistens SH164]
          Length = 476

 Score = 38.5 bits (88), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 70/146 (47%), Gaps = 12/146 (8%)

Query: 3   LASLVNA-TGSFHLADLGAGAGAAGLAVASRLHEAQIL-LAERSPLMAHYARKTLALPAN 60
           +ASL +       L D GAG G+  ++ A +L   +++ L E  P+M    R+ L +  +
Sbjct: 38  MASLFDDHKKEIKLLDCGAGIGSLTISAAKKLKNIKLVDLWEIDPIM----REQLEVNMH 93

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
           A I    S+   D  L G   N++  K   Y H I+NPP+ ++I + +  + KE   V +
Sbjct: 94  A-IDINFSIYAQDFIL-GAVENISSDKGERYTHAIINPPY-KKINSNSEHR-KELRKVGI 149

Query: 121 E--DSFEKWIRTACAIMRSSGQLSLI 144
           E  + +  ++     +M   GQ+  I
Sbjct: 150 ETVNLYSAFVALTIQLMEQDGQIVAI 175


>gi|223985837|ref|ZP_03635878.1| hypothetical protein HOLDEFILI_03184 [Holdemania filiformis DSM
           12042]
 gi|223962227|gb|EEF66698.1| hypothetical protein HOLDEFILI_03184 [Holdemania filiformis DSM
           12042]
          Length = 233

 Score = 38.5 bits (88), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 56/127 (44%), Gaps = 17/127 (13%)

Query: 82  NLAGLKNNFYDHVIMNPPFNERIGTMTPDKI---------KEEAHVMLEDSFEKWIRTAC 132
           +LA  ++  +D ++ NPP+     T  P  I         + EA   LE  F    R   
Sbjct: 106 DLAEFRHLPFDVIVCNPPY---FATPDPASINPNPFLATARHEAGCTLETLFAAGGR--- 159

Query: 133 AIMRSSGQLSLIARPQSLIQIVNACARRIGSL-EITPLHPREGECASRILVTGRKGMRGQ 191
            +++  G+  L+ R   L QI+ A      +L E T +  R    A+ ++   RKG  G 
Sbjct: 160 -LLKDKGRFYLVHRADRLAQIIAALQNSPLTLREATLVFDRRTRQATAVIAELRKGKLGP 218

Query: 192 LRFRYPI 198
           +RFR P+
Sbjct: 219 VRFREPL 225


>gi|89095195|ref|ZP_01168119.1| hypothetical protein MED92_08565 [Oceanospirillum sp. MED92]
 gi|89080553|gb|EAR59801.1| hypothetical protein MED92_08565 [Oceanospirillum sp. MED92]
          Length = 378

 Score = 38.5 bits (88), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 52/117 (44%), Gaps = 14/117 (11%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTL-ALPANAQISKRISLIEVD 73
           + DLG G G  GL  A R   A++   + S +    A +   A  AN +     S +  D
Sbjct: 237 IIDLGCGNGVVGLMAAERNPSAELTFVDESFMAVASASENFNAAFANTRTG---SFLATD 293

Query: 74  VTLVGENRNLAGLKNNFYDHVIMNPPFNER--IGTMTPDKIKEEAHVMLEDSFEKWI 128
                    L G++ N  D ++ NPPF+++  +G     ++  EA  +L+   E W+
Sbjct: 294 C--------LKGIEKNSADLILNNPPFHQQNVVGDFIALQMFREAKSVLKKGGEIWV 342


>gi|304410565|ref|ZP_07392183.1| Methyltransferase type 11 [Shewanella baltica OS183]
 gi|307304658|ref|ZP_07584408.1| Methyltransferase type 11 [Shewanella baltica BA175]
 gi|304351049|gb|EFM15449.1| Methyltransferase type 11 [Shewanella baltica OS183]
 gi|306912060|gb|EFN42484.1| Methyltransferase type 11 [Shewanella baltica BA175]
          Length = 238

 Score = 38.5 bits (88), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 76/182 (41%), Gaps = 10/182 (5%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++L +    T +  + D+GAG+G   L  A R  +A I   E     A   +       N
Sbjct: 24  VVLGAWAQLTAAKTVLDIGAGSGLLSLMAAQR-SQAHITSVELDTSAAEACQHNFH---N 79

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
           +  + R++L+   +    ++         ++DH+I NPP+ E+ GT      +  A    
Sbjct: 80  SPWANRLTLVNSSIQDFCQHIEY----QEYFDHIICNPPYFEQ-GTQAIQSQRAMARHTD 134

Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSL-EITPLHPREGECASR 179
             SF   +      +   G  SLI   QS+ +     A    SL EIT L    G+ A+R
Sbjct: 135 SLSFTALLDAIHVCLAPQGNASLILPMQSMERFNEILAHSPLSLIEITNLISIVGKSANR 194

Query: 180 IL 181
           +L
Sbjct: 195 VL 196


>gi|294851395|ref|ZP_06792068.1| ribosomal RNA small subunit methyltransferase C [Brucella sp. NVSL
           07-0026]
 gi|294819984|gb|EFG36983.1| ribosomal RNA small subunit methyltransferase C [Brucella sp. NVSL
           07-0026]
          Length = 340

 Score = 38.5 bits (88), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 63/138 (45%), Gaps = 29/138 (21%)

Query: 14  HLADLGAGAG---AAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLI 70
           ++ADLGAG G   A  L  A R+    +  A+   L A  AR  L        S  IS  
Sbjct: 199 NVADLGAGWGYLAAQCLKYADRIKNIDLYEADYEALEA--ARGNLE---RLGASIPISFN 253

Query: 71  EVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRT 130
             DVT    +  +AG+    YD VIMNPPF+E  G +T         V L  SF   I  
Sbjct: 254 WFDVT----SEKIAGI----YDTVIMNPPFHE--GRVT--------DVSLGQSF---IAA 292

Query: 131 ACAIMRSSGQLSLIARPQ 148
           A + ++  G+L ++A  Q
Sbjct: 293 AASRLKPGGRLLMVANRQ 310


>gi|23503017|ref|NP_699144.1| methyltransferase [Brucella suis 1330]
 gi|225626534|ref|ZP_03784573.1| methyltransferase [Brucella ceti str. Cudo]
 gi|254705169|ref|ZP_05166997.1| methyltransferase [Brucella suis bv. 3 str. 686]
 gi|254707315|ref|ZP_05169143.1| methyltransferase [Brucella pinnipedialis M163/99/10]
 gi|254709145|ref|ZP_05170956.1| methyltransferase [Brucella pinnipedialis B2/94]
 gi|254713430|ref|ZP_05175241.1| methyltransferase [Brucella ceti M644/93/1]
 gi|254716213|ref|ZP_05178024.1| methyltransferase [Brucella ceti M13/05/1]
 gi|256030670|ref|ZP_05444284.1| methyltransferase [Brucella pinnipedialis M292/94/1]
 gi|256158671|ref|ZP_05456554.1| methyltransferase [Brucella ceti M490/95/1]
 gi|256254075|ref|ZP_05459611.1| methyltransferase [Brucella ceti B1/94]
 gi|256370565|ref|YP_003108076.1| methyltransferase [Brucella microti CCM 4915]
 gi|260169574|ref|ZP_05756385.1| methyltransferase [Brucella sp. F5/99]
 gi|261217987|ref|ZP_05932268.1| methyltransferase small [Brucella ceti M13/05/1]
 gi|261221216|ref|ZP_05935497.1| methyltransferase [Brucella ceti B1/94]
 gi|261314797|ref|ZP_05953994.1| methyltransferase small [Brucella pinnipedialis M163/99/10]
 gi|261316644|ref|ZP_05955841.1| methyltransferase small [Brucella pinnipedialis B2/94]
 gi|261321163|ref|ZP_05960360.1| methyltransferase small [Brucella ceti M644/93/1]
 gi|261755874|ref|ZP_05999583.1| methyltransferase small [Brucella suis bv. 3 str. 686]
 gi|261759101|ref|ZP_06002810.1| methyltransferase small [Brucella sp. F5/99]
 gi|265987716|ref|ZP_06100273.1| methyltransferase [Brucella pinnipedialis M292/94/1]
 gi|265997177|ref|ZP_06109734.1| methyltransferase [Brucella ceti M490/95/1]
 gi|23349058|gb|AAN31059.1| methyltransferase [Brucella suis 1330]
 gi|225618191|gb|EEH15234.1| methyltransferase [Brucella ceti str. Cudo]
 gi|256000728|gb|ACU49127.1| methyltransferase [Brucella microti CCM 4915]
 gi|260919800|gb|EEX86453.1| methyltransferase [Brucella ceti B1/94]
 gi|260923076|gb|EEX89644.1| methyltransferase small [Brucella ceti M13/05/1]
 gi|261293853|gb|EEX97349.1| methyltransferase small [Brucella ceti M644/93/1]
 gi|261295867|gb|EEX99363.1| methyltransferase small [Brucella pinnipedialis B2/94]
 gi|261303823|gb|EEY07320.1| methyltransferase small [Brucella pinnipedialis M163/99/10]
 gi|261739085|gb|EEY27081.1| methyltransferase small [Brucella sp. F5/99]
 gi|261745627|gb|EEY33553.1| methyltransferase small [Brucella suis bv. 3 str. 686]
 gi|262551645|gb|EEZ07635.1| methyltransferase [Brucella ceti M490/95/1]
 gi|264659913|gb|EEZ30174.1| methyltransferase [Brucella pinnipedialis M292/94/1]
          Length = 340

 Score = 38.5 bits (88), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 63/138 (45%), Gaps = 29/138 (21%)

Query: 14  HLADLGAGAG---AAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLI 70
           ++ADLGAG G   A  L  A R+    +  A+   L A  AR  L        S  IS  
Sbjct: 199 NVADLGAGWGYLAAQCLKYADRIKNIDLYEADYEALEA--ARGNLE---RLGASIPISFN 253

Query: 71  EVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRT 130
             DVT    +  +AG+    YD VIMNPPF+E  G +T         V L  SF   I  
Sbjct: 254 WFDVT----SEKIAGI----YDTVIMNPPFHE--GRVT--------DVSLGQSF---IAA 292

Query: 131 ACAIMRSSGQLSLIARPQ 148
           A + ++  G+L ++A  Q
Sbjct: 293 AASRLKPGGRLLMVANRQ 310


>gi|113969137|ref|YP_732930.1| methyltransferase small [Shewanella sp. MR-4]
 gi|122944086|sp|Q0HM44|TRMN6_SHESM RecName: Full=tRNA (adenine-N(6)-)-methyltransferase; AltName:
           Full=tRNA m6A37 methyltransferase
 gi|113883821|gb|ABI37873.1| methyltransferase small [Shewanella sp. MR-4]
          Length = 236

 Score = 38.5 bits (88), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 46/102 (45%), Gaps = 8/102 (7%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           +IL +      + ++ D+GAG+G   L  A R  + QI   E     A   R  +     
Sbjct: 24  VILGAWAPLAEAKNILDIGAGSGLLSLMAAQR-SQGQITAVELEEKAAAACRYNMT---Q 79

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNE 102
           +  +KR  L+  D+  V +     G    ++DH+I NPP+ E
Sbjct: 80  SPWAKRCQLVHGDIQSVCQLAQYQG----YFDHIICNPPYFE 117


>gi|254700801|ref|ZP_05162629.1| methyltransferase [Brucella suis bv. 5 str. 513]
 gi|261751309|ref|ZP_05995018.1| methyltransferase small [Brucella suis bv. 5 str. 513]
 gi|261741062|gb|EEY28988.1| methyltransferase small [Brucella suis bv. 5 str. 513]
          Length = 340

 Score = 38.5 bits (88), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 63/138 (45%), Gaps = 29/138 (21%)

Query: 14  HLADLGAGAG---AAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLI 70
           ++ADLGAG G   A  L  A R+    +  A+   L A  AR  L        S  IS  
Sbjct: 199 NVADLGAGWGYLAAQCLKYADRIKNIDLYEADYEALEA--ARGNLE---RLGASIPISFN 253

Query: 71  EVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRT 130
             DVT    +  +AG+    YD VIMNPPF+E  G +T         V L  SF   I  
Sbjct: 254 WFDVT----SEKIAGI----YDTVIMNPPFHE--GRVT--------DVSLGQSF---IAA 292

Query: 131 ACAIMRSSGQLSLIARPQ 148
           A + ++  G+L ++A  Q
Sbjct: 293 AASRLKPGGRLLMVANRQ 310


>gi|197119799|ref|YP_002140226.1| O-methyltransferase [Geobacter bemidjiensis Bem]
 gi|197089159|gb|ACH40430.1| O-methyltransferase, putative [Geobacter bemidjiensis Bem]
          Length = 258

 Score = 38.1 bits (87), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 46/207 (22%), Positives = 93/207 (44%), Gaps = 10/207 (4%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA            DLG G G   L +A     A +   E   +MA  A + + +   
Sbjct: 44  LLLADFAGVRTGERCVDLGTGCGVIALLLARLGENASVAAIEFQQVMAQIAARNVMMNG- 102

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNE-RIGTMTPDKIKEEAHVM 119
             +S R+ ++E DV  V ++R L     + +D V+ NPP+     G ++P   ++++   
Sbjct: 103 --LSDRVEVVEEDVVSV-KSRFLV----DSFDLVVSNPPYRRPGTGKVSPRAGRDDSRHE 155

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIV-NACARRIGSLEITPLHPREGECAS 178
              +   ++  A  +++ SG++ LI     L +++  A  +++  L +  +H      A 
Sbjct: 156 STAALSDFLAAAKYLVKPSGRICLIYHTSRLAELMAQAAHQKLAPLRLRMVHGNSRMEAR 215

Query: 179 RILVTGRKGMRGQLRFRYPIVLHKPNG 205
             ++   KG  G+LR   P+++   +G
Sbjct: 216 MFMIELAKGRSGELRVEPPLMVRGEDG 242


>gi|325278033|ref|ZP_08143557.1| methyltransferase small [Pseudomonas sp. TJI-51]
 gi|324096832|gb|EGB95154.1| methyltransferase small [Pseudomonas sp. TJI-51]
          Length = 317

 Score = 38.1 bits (87), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 40/95 (42%), Gaps = 13/95 (13%)

Query: 14  HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVD 73
           H  D+G G G   L +A   H AQ+   + +PL   Y     AL   + IS + S +  D
Sbjct: 141 HAVDIGCGTGIGALLIARAAHHAQVSAVDINPLALRYTAVNAALAGVSNISVKHSDLLDD 200

Query: 74  VTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMT 108
           V              NF D ++ NPP+   +G  T
Sbjct: 201 V------------PGNF-DLIVANPPYMLDVGERT 222


>gi|117921771|ref|YP_870963.1| methyltransferase small [Shewanella sp. ANA-3]
 gi|262828713|sp|A0L0I8|TRMN6_SHESA RecName: Full=tRNA (adenine-N(6)-)-methyltransferase; AltName:
           Full=tRNA m6A37 methyltransferase
 gi|117614103|gb|ABK49557.1| methyltransferase small [Shewanella sp. ANA-3]
          Length = 241

 Score = 38.1 bits (87), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 45/103 (43%), Gaps = 8/103 (7%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           +IL +    + + H+ D+GAG+G   L  A R  + QI   E     A   +  +     
Sbjct: 24  VILGAWAPLSRAKHILDIGAGSGLLSLMAAQR-SQGQITAVELEEKAAAACQYNM---TQ 79

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNER 103
           +  + R  LI  D+  V +          ++DH+I NPP+ E 
Sbjct: 80  SPWADRCKLIHGDIQHVCQQAEY----QEYFDHIICNPPYFEH 118


>gi|161620078|ref|YP_001593965.1| methyltransferase small [Brucella canis ATCC 23365]
 gi|260567363|ref|ZP_05837833.1| methyltransferase [Brucella suis bv. 4 str. 40]
 gi|161336889|gb|ABX63194.1| methyltransferase small [Brucella canis ATCC 23365]
 gi|260156881|gb|EEW91961.1| methyltransferase [Brucella suis bv. 4 str. 40]
          Length = 340

 Score = 38.1 bits (87), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 63/138 (45%), Gaps = 29/138 (21%)

Query: 14  HLADLGAGAG---AAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLI 70
           ++ADLGAG G   A  L  A R+    +  A+   L A  AR  L        S  IS  
Sbjct: 199 NVADLGAGWGYLAAQCLKYADRIKNIDLYEADYEALEA--ARGNLE---RLGASIPISFN 253

Query: 71  EVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRT 130
             DVT    +  +AG+    YD VIMNPPF+E  G +T         V L  SF   I  
Sbjct: 254 WFDVT----SEKIAGI----YDTVIMNPPFHE--GRVT--------DVSLGQSF---IAA 292

Query: 131 ACAIMRSSGQLSLIARPQ 148
           A + ++  G+L ++A  Q
Sbjct: 293 AASRLKPGGRLLMVANRQ 310


>gi|237785783|ref|YP_002906488.1| putative DNA methylase [Corynebacterium kroppenstedtii DSM 44385]
 gi|237758695|gb|ACR17945.1| putative DNA methylase [Corynebacterium kroppenstedtii DSM 44385]
          Length = 188

 Score = 38.1 bits (87), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 42/84 (50%), Gaps = 10/84 (11%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DL AG+GA GL  ASR  ++ + +   S           A+       +R+  ++ DV  
Sbjct: 48  DLFAGSGALGLEAASRGADSVVFVDTDS----------AAIETIKDNIRRVGDVDADVVQ 97

Query: 77  VGENRNLAGLKNNFYDHVIMNPPF 100
           +  +  L+G   N++D V+++PP+
Sbjct: 98  LKVSSYLSGAPENYFDIVLIDPPY 121


>gi|172061767|ref|YP_001809419.1| methyltransferase [Burkholderia ambifaria MC40-6]
 gi|171994284|gb|ACB65203.1| methyltransferase [Burkholderia ambifaria MC40-6]
          Length = 204

 Score = 38.1 bits (87), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 37/86 (43%), Gaps = 10/86 (11%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DL AG GA G   ASR     +++ ER P  A   R          I  ++    V+V  
Sbjct: 67  DLFAGTGALGFEAASR-GATSVVMVERHPRAAQQLRA---------IKDKLGARSVEVAE 116

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNE 102
               R  AGL    +D V ++PPF E
Sbjct: 117 ADALRLAAGLTPGAFDVVFLDPPFGE 142


>gi|114048720|ref|YP_739270.1| methyltransferase small [Shewanella sp. MR-7]
 gi|123326200|sp|Q0HRP2|TRMN6_SHESR RecName: Full=tRNA (adenine-N(6)-)-methyltransferase; AltName:
           Full=tRNA m6A37 methyltransferase
 gi|113890162|gb|ABI44213.1| methyltransferase small [Shewanella sp. MR-7]
          Length = 236

 Score = 38.1 bits (87), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 46/102 (45%), Gaps = 8/102 (7%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           +IL +      + ++ D+GAG+G   L  A R  + QI   E     A   R  +     
Sbjct: 24  VILGAWAPLAEAKNILDIGAGSGLLSLMAAQR-SQGQITAVELEEKAAAACRYNMT---Q 79

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNE 102
           +  +KR  L+  D+  V +     G    ++DH+I NPP+ E
Sbjct: 80  SPWAKRCQLVHGDIQHVCQLAQYQG----YFDHIICNPPYFE 117


>gi|212636947|ref|YP_002313472.1| O-methyltransferase [Shewanella piezotolerans WP3]
 gi|212558431|gb|ACJ30885.1| Conserved hypothetical O-methyltransferase [Shewanella
           piezotolerans WP3]
          Length = 297

 Score = 38.1 bits (87), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 66/144 (45%), Gaps = 10/144 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++L +    + S ++ D+GAG+G   L  A R  +A I   E     A   +    L   
Sbjct: 80  VLLGAWAPLSNSKNILDIGAGSGLLSLMAAQR-SKANITAIELDENAALDCQSNFNL--- 135

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
           +  SKR++L+   +      +     K + +DH+I NPP+ +  G  +   ++  A    
Sbjct: 136 SPWSKRLTLLTRSI-----QQFCTTAKKHSFDHIICNPPYFDN-GPQSNSALRATARHTD 189

Query: 121 EDSFEKWIRTACAIMRSSGQLSLI 144
             SF++ +    +++  +GQ SLI
Sbjct: 190 SLSFDELLTAISSLLSPAGQASLI 213


>gi|262831299|sp|B2RK25|TRMN6_PORG3 RecName: Full=tRNA (adenine-N(6)-)-methyltransferase; AltName:
           Full=tRNA m6A37 methyltransferase
          Length = 255

 Score = 38.1 bits (87), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 59/132 (44%), Gaps = 7/132 (5%)

Query: 14  HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVD 73
           H  D+G G G   L +A R  +A++   E  P+ A  AR      A +  S RI +   D
Sbjct: 44  HCLDIGTGTGLIALMLAQRFPQARVQGIEIDPIAAECARANA---AASPFSDRIVIASGD 100

Query: 74  VTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACA 133
           + L     +L G  N  +D ++ NPPF +      PD+ +  A        EK I  A  
Sbjct: 101 I-LDSSLESLIG--NQRFDLIVSNPPFFKS-SLHAPDRQRTMARHEETLPLEKLICRASE 156

Query: 134 IMRSSGQLSLIA 145
           ++   G+L+LI 
Sbjct: 157 LLSPQGRLALIT 168


>gi|188995065|ref|YP_001929317.1| hypothetical protein PGN_1201 [Porphyromonas gingivalis ATCC 33277]
 gi|188594745|dbj|BAG33720.1| conserved hypothetical protein [Porphyromonas gingivalis ATCC
           33277]
          Length = 236

 Score = 38.1 bits (87), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 59/132 (44%), Gaps = 7/132 (5%)

Query: 14  HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVD 73
           H  D+G G G   L +A R  +A++   E  P+ A  AR      A +  S RI +   D
Sbjct: 25  HCLDIGTGTGLIALMLAQRFPQARVQGIEIDPIAAECARANA---AASPFSDRIVIASGD 81

Query: 74  VTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACA 133
           + L     +L G  N  +D ++ NPPF +      PD+ +  A        EK I  A  
Sbjct: 82  I-LDSSLESLIG--NQRFDLIVSNPPFFKS-SLHAPDRQRTMARHEETLPLEKLICRASE 137

Query: 134 IMRSSGQLSLIA 145
           ++   G+L+LI 
Sbjct: 138 LLSPQGRLALIT 149


>gi|254459389|ref|ZP_05072810.1| methyltransferase small [Campylobacterales bacterium GD 1]
 gi|207084002|gb|EDZ61293.1| methyltransferase small [Campylobacterales bacterium GD 1]
          Length = 231

 Score = 38.1 bits (87), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 34/185 (18%), Positives = 72/185 (38%), Gaps = 16/185 (8%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           D+GAG G  GL VA    + ++   E+      Y          A I+ R++ I+  +  
Sbjct: 34  DVGAGCGIVGLLVARDNPKVKLEAVEKQEAFVEY----------ATINSRVNKIDYKI-- 81

Query: 77  VGENRNLAGLKNNF-YDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIM 135
                +   L  N  YD++I NPPF     +++ +++   A   +      + +    ++
Sbjct: 82  --HKNDFVELDENIKYDYIISNPPFYYDKVSVSKNEMLFNARYNINLPLRAFFKKVSRVL 139

Query: 136 RSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRKGMRGQLRF 194
                            I     R ++  +++  +HP+    AS +++  R G    ++ 
Sbjct: 140 NPRSHFIFCYDASQFGLICAELDRVKLRVVDVRFVHPKVDRGASLVMLHVRNGSSSLMKV 199

Query: 195 RYPIV 199
             P++
Sbjct: 200 HKPLI 204


>gi|262831165|sp|B8CU29|TRMN6_SHEPW RecName: Full=tRNA (adenine-N(6)-)-methyltransferase; AltName:
           Full=tRNA m6A37 methyltransferase
          Length = 241

 Score = 38.1 bits (87), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 66/144 (45%), Gaps = 10/144 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++L +    + S ++ D+GAG+G   L  A R  +A I   E     A   +    L   
Sbjct: 24  VLLGAWAPLSNSKNILDIGAGSGLLSLMAAQR-SKANITAIELDENAALDCQSNFNL--- 79

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
           +  SKR++L+   +      +     K + +DH+I NPP+ +  G  +   ++  A    
Sbjct: 80  SPWSKRLTLLTRSI-----QQFCTTAKKHSFDHIICNPPYFDN-GPQSNSALRATARHTD 133

Query: 121 EDSFEKWIRTACAIMRSSGQLSLI 144
             SF++ +    +++  +GQ SLI
Sbjct: 134 SLSFDELLTAISSLLSPAGQASLI 157


>gi|330686234|gb|EGG97846.1| methyltransferase small domain protein [Staphylococcus epidermidis
           VCU121]
          Length = 202

 Score = 38.1 bits (87), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 58/150 (38%), Gaps = 22/150 (14%)

Query: 15  LADLGAGAGAAGLAVA--SRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEV 72
           +AD+G G G  GL +A  S  H   +L   R  L      K      NA I +   + +V
Sbjct: 64  IADVGCGYGPIGLMIAKVSPHHHITMLDVNRRALELAKKNKKKNHIENADIFESDGMTQV 123

Query: 73  DVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTAC 132
           D              NN +D V+ NPP   R G     +I EEA+  L+ + E ++    
Sbjct: 124 D--------------NNQFDFVLTNPPI--RAGKTVVHRIFEEAYQKLKSNGELFV---- 163

Query: 133 AIMRSSGQLSLIARPQSLIQIVNACARRIG 162
            I +  G  S   +   L   V    +  G
Sbjct: 164 VIQKKQGMPSAKKKMDELFNNVEVVNKSKG 193


>gi|322378923|ref|ZP_08053339.1| putative O-methyltransferase [Helicobacter suis HS1]
 gi|322380243|ref|ZP_08054464.1| O-methyltransferase [Helicobacter suis HS5]
 gi|321147321|gb|EFX42000.1| O-methyltransferase [Helicobacter suis HS5]
 gi|321148665|gb|EFX43149.1| putative O-methyltransferase [Helicobacter suis HS1]
          Length = 238

 Score = 38.1 bits (87), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 49/222 (22%), Positives = 91/222 (40%), Gaps = 27/222 (12%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYAR-KTLALPANAQISKRISLIEVD 73
           L D+GAG G  G+  A + +   + L E    +A +AR  +  LP  AQ+ +  + ++  
Sbjct: 33  LLDVGAGCGIVGILCAKK-YANPLDLIEIDSNLAFFARLNSQNLP-QAQVYQA-NFLDYP 89

Query: 74  VTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACA 133
           +T         G     YD ++ NPP+       +P   K  A          +   A  
Sbjct: 90  LT--------PG-----YDAILSNPPYYPAESLKSPYTQKARATNQSFLPLLDFCTKASF 136

Query: 134 IMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRKGMRGQL 192
           +++  G   L      +  +++A  + ++ ++ +  +HP + + AS IL   RK  +  +
Sbjct: 137 LLKPKGYFILCYHASLIDTLISALQKAKLKAILLRFVHPFKDQKASLILCCARKNSKSLV 196

Query: 193 RFRYPIVLHKPNGQ---------PYSRFVTDLINGKRSLTRL 225
           +   P++ HK   Q          Y+RF T  I     +  L
Sbjct: 197 QIGPPLITHKAKDQRAITEEVASIYARFKTHSIKASLEMCAL 238


>gi|254718208|ref|ZP_05180019.1| methyltransferase [Brucella sp. 83/13]
 gi|265983165|ref|ZP_06095900.1| methyltransferase small [Brucella sp. 83/13]
 gi|306839948|ref|ZP_07472742.1| methyltransferase small [Brucella sp. NF 2653]
 gi|264661757|gb|EEZ32018.1| methyltransferase small [Brucella sp. 83/13]
 gi|306404912|gb|EFM61197.1| methyltransferase small [Brucella sp. NF 2653]
          Length = 340

 Score = 38.1 bits (87), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 63/138 (45%), Gaps = 29/138 (21%)

Query: 14  HLADLGAGAG---AAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLI 70
           ++ADLGAG G   A  L  A R+    +  A+   L A  AR  L        S  IS  
Sbjct: 199 NVADLGAGWGYLAAQCLKYADRIKNIDLYEADYEALEA--ARGNLE---RLGASIPISFN 253

Query: 71  EVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRT 130
             DVT    +  +AG+    YD VIMNPPF+E  G +T         V L  SF   I  
Sbjct: 254 WFDVT----SEKIAGI----YDTVIMNPPFHE--GRVT--------DVSLGQSF---IAA 292

Query: 131 ACAIMRSSGQLSLIARPQ 148
           A + ++  G+L ++A  Q
Sbjct: 293 AASRLKPGGRLLVVANRQ 310


>gi|73663523|ref|YP_302304.1| hypothetical protein SSP2214 [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
 gi|72496038|dbj|BAE19359.1| conserved hypothetical protein [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
          Length = 202

 Score = 37.7 bits (86), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 61/153 (39%), Gaps = 28/153 (18%)

Query: 15  LADLGAGAGAAGLAVA--SRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEV 72
           + D+G G G  GL +A  S  HE           M    ++ L+L    +   RI   E+
Sbjct: 64  IIDVGCGYGPIGLMIAKVSPHHEVT---------MVDINQRALSLSRKNKKRNRIDNAEI 114

Query: 73  DVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTAC 132
                 E+  L+ +++N YD V+ NPP   R G       K+  H +LED+F K  +   
Sbjct: 115 -----IESNGLSQVEDNTYDFVLTNPPI--RAG-------KQVVHSILEDAFNKLKQGGA 160

Query: 133 ---AIMRSSGQLSLIARPQSLIQIVNACARRIG 162
               I +  G  S   + Q     V    +  G
Sbjct: 161 LYVVIQKKQGMPSAKKKMQETFDNVEVLEKSKG 193


>gi|94264415|ref|ZP_01288205.1| Modification methylase HemK [delta proteobacterium MLMS-1]
 gi|93455172|gb|EAT05390.1| Modification methylase HemK [delta proteobacterium MLMS-1]
          Length = 319

 Score = 37.7 bits (86), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 43/88 (48%), Gaps = 9/88 (10%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DLG G+G   + +A  L  A+++  +RSP     AR+ +      ++  R+SL+  D   
Sbjct: 148 DLGTGSGILAVVLARELAPARVIAVDRSPAALAVARRNV---CRHRVESRVSLLAADWL- 203

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNERI 104
                 LA  K   +D V+ NPP+ E +
Sbjct: 204 ----SALAAGK-ALFDLVVANPPYVEDV 226


>gi|38233728|ref|NP_939495.1| putative DNA methylase [Corynebacterium diphtheriae NCTC 13129]
 gi|38199989|emb|CAE49658.1| Putative DNA methylase [Corynebacterium diphtheriae]
          Length = 192

 Score = 37.7 bits (86), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 42/85 (49%), Gaps = 10/85 (11%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DL AG+GA GL  ASR  E+ ++L E +P      R  +A+  +           VDV  
Sbjct: 49  DLFAGSGALGLEAASRGAES-VVLVENNPKAVAVIRHNIAVVGHPH---------VDVVE 98

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFN 101
           +  +  +A    N +D V+ +PP++
Sbjct: 99  MKASTYVASAPKNHFDMVLADPPYD 123


>gi|154486887|ref|ZP_02028294.1| hypothetical protein BIFADO_00720 [Bifidobacterium adolescentis
           L2-32]
 gi|154084750|gb|EDN83795.1| hypothetical protein BIFADO_00720 [Bifidobacterium adolescentis
           L2-32]
          Length = 306

 Score = 37.7 bits (86), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 44/90 (48%), Gaps = 10/90 (11%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLI---- 70
           + DL AG+GA GLA AS +  +++   E+S   A + R+ L      + +KR   I    
Sbjct: 129 VVDLCAGSGAIGLAFASEVPGSEVWAVEKSATTAEWTRRNL-----DETAKRYPAIAGNY 183

Query: 71  EVDVTLVGENRNLAGLKNNFYDHVIMNPPF 100
            +D+    +   L+ L     D V+ NPP+
Sbjct: 184 HLDIADATQMPTLSQLDGTI-DIVLTNPPY 212


>gi|153008078|ref|YP_001369293.1| methyltransferase small [Ochrobactrum anthropi ATCC 49188]
 gi|151559966|gb|ABS13464.1| methyltransferase small [Ochrobactrum anthropi ATCC 49188]
          Length = 340

 Score = 37.7 bits (86), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 63/138 (45%), Gaps = 29/138 (21%)

Query: 14  HLADLGAGAG---AAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLI 70
           ++ADLGAG G   A  L  A R+    +  A+   L A  AR  L        S  IS  
Sbjct: 199 NVADLGAGWGYLAAQCLKFADRIKSIDLYEADYEALEA--ARGNLE---RLGASVPISFN 253

Query: 71  EVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRT 130
             DVT    +  +AG+    YD VIMNPPF+E  G +T         V L  +F   I  
Sbjct: 254 WFDVT----SEKMAGI----YDTVIMNPPFHE--GRVT--------DVSLGQAF---IAA 292

Query: 131 ACAIMRSSGQLSLIARPQ 148
           A + ++  G+L ++A  Q
Sbjct: 293 AASRLKPGGRLLMVANRQ 310


>gi|9955209|pdb|1DUS|A Chain A, Mj0882-A Hypothetical Protein From M. Jannaschii
          Length = 194

 Score = 37.7 bits (86), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 57/128 (44%), Gaps = 16/128 (12%)

Query: 2   ILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLAL-PAN 60
           IL   V       + DLG G G  G+A+A  +         +S   A   R+ + L   N
Sbjct: 43  ILVENVVVDKDDDILDLGCGYGVIGIALADEV---------KSTTXADINRRAIKLAKEN 93

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
            +++   +L   D+ +V  +     +K+  Y+ +I NPP   R G     +I EE   +L
Sbjct: 94  IKLN---NLDNYDIRVVHSDL-YENVKDRKYNKIITNPPI--RAGKEVLHRIIEEGKELL 147

Query: 121 EDSFEKWI 128
           +D+ E W+
Sbjct: 148 KDNGEIWV 155


>gi|330951101|gb|EGH51361.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Pseudomonas syringae Cit 7]
          Length = 277

 Score = 37.7 bits (86), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 43/96 (44%), Gaps = 12/96 (12%)

Query: 5   SLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQIS 64
            LV A     + DLG G GA  LA+A+   + ++   +R P     A +           
Sbjct: 103 ELVPAFAPAQVLDLGTGTGAIALALANERQQWKVTAVDRVPEAVALAERN---------R 153

Query: 65  KRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF 100
           +R+ L   +V    E+   +GL+   +D +I NPP+
Sbjct: 154 QRLQLNNAEVF---ESHWFSGLQGRQFDLIISNPPY 186


>gi|94271211|ref|ZP_01291906.1| Modification methylase HemK [delta proteobacterium MLMS-1]
 gi|93450531|gb|EAT01681.1| Modification methylase HemK [delta proteobacterium MLMS-1]
          Length = 325

 Score = 37.7 bits (86), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 43/88 (48%), Gaps = 9/88 (10%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DLG G+G   + +A  L  A+++  +RSP     AR+ +      ++  R+SL+  D   
Sbjct: 148 DLGTGSGILAVVLARELAPARVIAVDRSPAALAVARRNV---CRHRVESRVSLLAADWL- 203

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNERI 104
                 LA  K   +D V+ NPP+ E +
Sbjct: 204 ----SALAAGK-ALFDLVVANPPYVEDV 226


>gi|258422612|ref|ZP_05685518.1| conserved hypothetical protein [Staphylococcus aureus A9635]
 gi|257847184|gb|EEV71192.1| conserved hypothetical protein [Staphylococcus aureus A9635]
 gi|302332254|gb|ADL22447.1| methyltransferase small domain protein [Staphylococcus aureus
           subsp. aureus JKD6159]
          Length = 202

 Score = 37.7 bits (86), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 64/144 (44%), Gaps = 21/144 (14%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           +AD+G G G  GL +A        +    S  M     + LAL     + K   L  +D 
Sbjct: 64  IADVGCGYGPIGLMIAK-------VSPHHSITMLDVNHRALAL-----VEKNKKLNGIDN 111

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAI 134
            +V E+  L+ +++  +D ++ NPP   R G  T  +I E+A   L+ + E ++     I
Sbjct: 112 VIVKESDALSAVEDKSFDFILTNPPI--RAGKETVHRIFEQALHRLDSNGELFV----VI 165

Query: 135 MRSSGQLSLIARPQSL---IQIVN 155
            +  G  S   R   L   +++VN
Sbjct: 166 QKKQGMPSAKKRMNELFGNVEVVN 189


>gi|222153024|ref|YP_002562201.1| methyltransferase [Streptococcus uberis 0140J]
 gi|222113837|emb|CAR41935.1| putative methyltransferase [Streptococcus uberis 0140J]
          Length = 274

 Score = 37.7 bits (86), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 74/154 (48%), Gaps = 34/154 (22%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALP-A 59
           +ILA   N+T S  L D+G G+GA  +++     +  +  ++ SP       + LAL   
Sbjct: 101 LILAE--NSTQSLRLLDIGTGSGAIAISLKKERPDWDVFASDISP-------EALALANY 151

Query: 60  NA-QISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF-----NERIGTMTPDKIK 113
           NA Q+  +I+ +E D+      R++ G     +D ++ NPP+      E +G      +K
Sbjct: 152 NAEQLGCQITFVESDIF-----RSITGS----FDIIVSNPPYIAFEDKEEVGINV---LK 199

Query: 114 EEAHVML--EDS----FEKWIRTACAIMRSSGQL 141
            E H+ L  E++    + K I  A   ++ +G+L
Sbjct: 200 SEPHLALFAEENGYAIYRKIIEEAGFYLKENGKL 233


>gi|306843587|ref|ZP_07476188.1| methyltransferase small [Brucella sp. BO1]
 gi|306276278|gb|EFM57978.1| methyltransferase small [Brucella sp. BO1]
          Length = 340

 Score = 37.7 bits (86), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 45/141 (31%), Positives = 64/141 (45%), Gaps = 35/141 (24%)

Query: 14  HLADLGAGAG---AAGLAVASRLHEAQILLAERSPLMAHYA---RKTLALPANAQISKRI 67
           ++ADLGAG G   A  L  A R+    +  A+   L A +    R   ++P        I
Sbjct: 199 NVADLGAGWGYLAAQCLKYADRIKNIDLYEADYEALEAAHGNLERLGASIP--------I 250

Query: 68  SLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKW 127
           S    DVT    +  +AG+    YD VIMNPPF+E  G +T         V L  SF   
Sbjct: 251 SFNWFDVT----SEKIAGI----YDTVIMNPPFHE--GRVT--------DVSLGQSF--- 289

Query: 128 IRTACAIMRSSGQLSLIARPQ 148
           I  A + ++  G+L ++A  Q
Sbjct: 290 IAAAASRLKPGGRLLVVANRQ 310


>gi|289178306|gb|ADC85552.1| Peptide release factor-glutamine N5-methyltransferase
           [Bifidobacterium animalis subsp. lactis BB-12]
          Length = 319

 Score = 37.7 bits (86), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 44/90 (48%), Gaps = 10/90 (11%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL AG+GA GLA+A+ +  AQ+   E SP  A + R+ +      QIS+    I  + 
Sbjct: 146 IVDLCAGSGALGLALATEIPGAQVWGVELSPQAAVWTRRNI-----TQISRTYPDITANY 200

Query: 75  TLVGENR----NLAGLKNNFYDHVIMNPPF 100
            L   +      LA L     D V+ NPP+
Sbjct: 201 HLEIADATCPITLAHLDGTV-DVVVSNPPY 229


>gi|257437706|ref|ZP_05613461.1| SAM-dependent methyltransferase [Faecalibacterium prausnitzii
           A2-165]
 gi|257200013|gb|EEU98297.1| SAM-dependent methyltransferase [Faecalibacterium prausnitzii
           A2-165]
          Length = 224

 Score = 37.7 bits (86), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 59/157 (37%), Gaps = 18/157 (11%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++LA       ++  ADL +G G   L    R H    L  E  P     A   LA    
Sbjct: 27  LLLARFSEPKRAWRAADLCSGCGIVSLEWHDRGHRGPCLGLELQP----EASALLAAACT 82

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF---NERIGTMTPDKIKEEAH 117
            Q  + I+ +  D+    E           YD    NPP+    E+         + E  
Sbjct: 83  EQGIEHITPVCADLRSFREG-------EGSYDLCACNPPYFTAGEQAADRARATARHETD 135

Query: 118 VMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIV 154
             L+D      + A  +++  G+LSL  RP+ L +++
Sbjct: 136 CTLDDV----CKCAFRLLKDGGRLSLCHRPERLAEVL 168


>gi|282915864|ref|ZP_06323629.1| ribosomal RNA small subunit methyltransferase C [Staphylococcus
           aureus subsp. aureus D139]
 gi|283769697|ref|ZP_06342589.1| ribosomal RNA small subunit methyltransferase C [Staphylococcus
           aureus subsp. aureus H19]
 gi|282320160|gb|EFB50505.1| ribosomal RNA small subunit methyltransferase C [Staphylococcus
           aureus subsp. aureus D139]
 gi|283459844|gb|EFC06934.1| ribosomal RNA small subunit methyltransferase C [Staphylococcus
           aureus subsp. aureus H19]
          Length = 202

 Score = 37.7 bits (86), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 64/144 (44%), Gaps = 21/144 (14%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           +AD+G G G  GL +A        +    S  M     + LAL     + K   L  +D 
Sbjct: 64  IADVGCGYGPIGLMIAK-------VSPHHSITMLDVNHRALAL-----VEKNKKLNGIDN 111

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAI 134
            +V E+  L+ +++  +D ++ NPP   R G  T  +I E+A   L+ + E ++     I
Sbjct: 112 VIVKESDALSAVEDKSFDFILTNPPI--RAGKETVHRIFEQALHRLDSNGELFV----VI 165

Query: 135 MRSSGQLSLIARPQSL---IQIVN 155
            +  G  S   R   L   +++VN
Sbjct: 166 QKKQGMPSAKKRMNELFGNVEVVN 189


>gi|171320170|ref|ZP_02909232.1| methyltransferase [Burkholderia ambifaria MEX-5]
 gi|171094584|gb|EDT39636.1| methyltransferase [Burkholderia ambifaria MEX-5]
          Length = 204

 Score = 37.7 bits (86), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 37/86 (43%), Gaps = 10/86 (11%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DL AG GA G   ASR     +++ ER P  A   R          I  ++    V+V  
Sbjct: 67  DLFAGTGALGFEAASR-GATSVVMVERHPRAAQQLRA---------IKDKLGARAVEVAE 116

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNE 102
               R  AGL    +D V ++PPF E
Sbjct: 117 ADALRLAAGLTPGAFDVVFLDPPFGE 142


>gi|283469833|emb|CAQ49044.1| methyltransferase small domain superfamily [Staphylococcus aureus
           subsp. aureus ST398]
          Length = 202

 Score = 37.7 bits (86), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 64/144 (44%), Gaps = 21/144 (14%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           +AD+G G G  GL +A        +    S  M     + LAL     + K   L  +D 
Sbjct: 64  IADVGCGYGPIGLMIAK-------VSPHHSITMLDVNHRALAL-----VEKNKKLNGIDN 111

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAI 134
            +V E+  L+ +++  +D ++ NPP   R G  T  +I E+A   L+ + E ++     I
Sbjct: 112 VIVKESDALSAVEDKSFDFILTNPPI--RAGKETVHRIFEQALHRLDSNGELFV----VI 165

Query: 135 MRSSGQLSLIARPQSL---IQIVN 155
            +  G  S   R   L   +++VN
Sbjct: 166 QKKQGMPSAKKRMNELFGNVEVVN 189


>gi|282903129|ref|ZP_06311020.1| 16S rRNA M(2)G 1207 methyltransferase [Staphylococcus aureus subsp.
           aureus C160]
 gi|282596084|gb|EFC01045.1| 16S rRNA M(2)G 1207 methyltransferase [Staphylococcus aureus subsp.
           aureus C160]
          Length = 202

 Score = 37.7 bits (86), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 64/144 (44%), Gaps = 21/144 (14%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           +AD+G G G  GL +A        +    S  M     + LAL     + K   L  +D 
Sbjct: 64  IADVGCGYGPIGLMIAK-------VSPHHSITMLDVNHRALAL-----VEKNKKLNGIDN 111

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAI 134
            +V E+  L+ +++  +D ++ NPP   R G  T  +I E+A   L+ + E ++     I
Sbjct: 112 VIVKESDALSAVEDKSFDFILTNPPI--RAGKETVHRIFEQALHRLDSNGELFV----VI 165

Query: 135 MRSSGQLSLIARPQSL---IQIVN 155
            +  G  S   R   L   +++VN
Sbjct: 166 QKKQGMPSAKKRMNELFGNVEVVN 189


>gi|170701093|ref|ZP_02892069.1| methyltransferase [Burkholderia ambifaria IOP40-10]
 gi|170133994|gb|EDT02346.1| methyltransferase [Burkholderia ambifaria IOP40-10]
          Length = 204

 Score = 37.7 bits (86), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 37/86 (43%), Gaps = 10/86 (11%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DL AG GA G   ASR     +++ ER P  A   R          I  ++    V+V  
Sbjct: 67  DLFAGTGALGFEAASR-GATSVVMVERHPRAAQQLRA---------IKDKLGARAVEVAE 116

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNE 102
               R  AGL    +D V ++PPF E
Sbjct: 117 ADALRLAAGLTPGAFDVVFLDPPFGE 142


>gi|167749302|ref|ZP_02421429.1| hypothetical protein EUBSIR_00253 [Eubacterium siraeum DSM 15702]
 gi|167657747|gb|EDS01877.1| hypothetical protein EUBSIR_00253 [Eubacterium siraeum DSM 15702]
          Length = 245

 Score = 37.7 bits (86), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 41/194 (21%), Positives = 82/194 (42%), Gaps = 18/194 (9%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVA---SRLHEAQILLAERSPLMAHYARKTLAL 57
            +LA   +      + DL  G G   L +    S+    +I   E  P       K++A 
Sbjct: 28  FLLADFADPAPHHKVCDLCTGCGIVPLIMCRNISKKPPKEIYGIEIMPEAVELFDKSVA- 86

Query: 58  PANAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNER-IGTMTPDKIKEEA 116
                +S RI  +  D+      ++  G+   ++D V +NPP+ ++  G      ++  A
Sbjct: 87  --ENNLSDRIKPVLCDL------KDPQGIPREYFDIVTVNPPYWKKGSGEERLSDVQAAA 138

Query: 117 HVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLH---PRE 173
              +  + +  ++TA ++++  G L L   P  L  ++  C+ R   +E   +     R+
Sbjct: 139 RHEILCNIDDVMKTASSLLKFGGSLKLCQIPLRLADVI--CSMRSHGIEPKVMQNVVNRK 196

Query: 174 GECASRILVTGRKG 187
           G     +L++G+KG
Sbjct: 197 GGKPWLVLISGKKG 210


>gi|15923531|ref|NP_371065.1| hypothetical protein SAV0541 [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|15926219|ref|NP_373752.1| hypothetical protein SA0499 [Staphylococcus aureus subsp. aureus
           N315]
 gi|49482771|ref|YP_039995.1| hypothetical protein SAR0546 [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|57651417|ref|YP_185473.1| hypothetical protein SACOL0587 [Staphylococcus aureus subsp. aureus
           COL]
 gi|87161944|ref|YP_493229.1| methyltransferase small subunit [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|88194303|ref|YP_499095.1| hypothetical protein SAOUHSC_00523 [Staphylococcus aureus subsp.
           aureus NCTC 8325]
 gi|148267001|ref|YP_001245944.1| hypothetical protein SaurJH9_0564 [Staphylococcus aureus subsp.
           aureus JH9]
 gi|150393048|ref|YP_001315723.1| hypothetical protein SaurJH1_0578 [Staphylococcus aureus subsp.
           aureus JH1]
 gi|151220715|ref|YP_001331537.1| hypothetical protein NWMN_0503 [Staphylococcus aureus subsp. aureus
           str. Newman]
 gi|156978870|ref|YP_001441129.1| hypothetical protein SAHV_0539 [Staphylococcus aureus subsp. aureus
           Mu3]
 gi|161508781|ref|YP_001574440.1| hypothetical protein USA300HOU_0535 [Staphylococcus aureus subsp.
           aureus USA300_TCH1516]
 gi|221141022|ref|ZP_03565515.1| hypothetical protein SauraJ_05208 [Staphylococcus aureus subsp.
           aureus str. JKD6009]
 gi|253315651|ref|ZP_04838864.1| methyltransferase small subunit [Staphylococcus aureus subsp.
           aureus str. CF-Marseille]
 gi|253732549|ref|ZP_04866714.1| 16S rRNA methyltransferase [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|255005335|ref|ZP_05143936.2| methyltransferase small subunit [Staphylococcus aureus subsp.
           aureus Mu50-omega]
 gi|257424655|ref|ZP_05601082.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257427323|ref|ZP_05603722.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257429959|ref|ZP_05606343.1| methyltransferase small domain-containing protein [Staphylococcus
           aureus subsp. aureus 68-397]
 gi|257432661|ref|ZP_05609021.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257435565|ref|ZP_05611613.1| methyltransferase small domain-containing protein [Staphylococcus
           aureus subsp. aureus M876]
 gi|257795360|ref|ZP_05644339.1| methyltransferase [Staphylococcus aureus A9781]
 gi|258408953|ref|ZP_05681234.1| methyltransferase [Staphylococcus aureus A9763]
 gi|258420409|ref|ZP_05683352.1| 16S rRNA m(2)G 1207 methyltransferase [Staphylococcus aureus A9719]
 gi|258439330|ref|ZP_05690262.1| methyltransferase small domain-containing protein [Staphylococcus
           aureus A9299]
 gi|258444070|ref|ZP_05692407.1| methyltransferase small subunit [Staphylococcus aureus A8115]
 gi|258446338|ref|ZP_05694496.1| methyltransferase small domain-containing protein [Staphylococcus
           aureus A6300]
 gi|258448431|ref|ZP_05696546.1| methyltransferase small domain-containing protein [Staphylococcus
           aureus A6224]
 gi|258452726|ref|ZP_05700724.1| conserved hypothetical protein [Staphylococcus aureus A5948]
 gi|258453787|ref|ZP_05701761.1| methyltransferase small subunit [Staphylococcus aureus A5937]
 gi|262049584|ref|ZP_06022453.1| hypothetical protein SAD30_0378 [Staphylococcus aureus D30]
 gi|269202164|ref|YP_003281433.1| hypothetical protein SAAV_0504 [Staphylococcus aureus subsp. aureus
           ED98]
 gi|282894976|ref|ZP_06303199.1| ribosomal RNA small subunit methyltransferase C [Staphylococcus
           aureus A8117]
 gi|282904919|ref|ZP_06312777.1| ribosomal RNA small subunit methyltransferase C [Staphylococcus
           aureus subsp. aureus Btn1260]
 gi|282907869|ref|ZP_06315704.1| methyltransferase small subunit [Staphylococcus aureus subsp.
           aureus WW2703/97]
 gi|282910182|ref|ZP_06317986.1| methyltransferase small subunit [Staphylococcus aureus subsp.
           aureus WBG10049]
 gi|282913374|ref|ZP_06321163.1| 16S rRNA M(2)G 1207 methyltransferase [Staphylococcus aureus subsp.
           aureus M899]
 gi|282918329|ref|ZP_06326066.1| ribosomal RNA small subunit methyltransferase C [Staphylococcus
           aureus subsp. aureus C427]
 gi|282923291|ref|ZP_06330971.1| ribosomal RNA small subunit methyltransferase C [Staphylococcus
           aureus subsp. aureus C101]
 gi|282924455|ref|ZP_06332127.1| ribosomal RNA small subunit methyltransferase C [Staphylococcus
           aureus A9765]
 gi|282928878|ref|ZP_06336469.1| ribosomal RNA small subunit methyltransferase C [Staphylococcus
           aureus A10102]
 gi|283957339|ref|ZP_06374792.1| 16S rRNA M(2)G 1207 methyltransferase [Staphylococcus aureus subsp.
           aureus A017934/97]
 gi|284023551|ref|ZP_06377949.1| hypothetical protein Saura13_03137 [Staphylococcus aureus subsp.
           aureus 132]
 gi|293500420|ref|ZP_06666271.1| ribosomal RNA small subunit methyltransferase C [Staphylococcus
           aureus subsp. aureus 58-424]
 gi|293509365|ref|ZP_06668076.1| ribosomal RNA small subunit methyltransferase C [Staphylococcus
           aureus subsp. aureus M809]
 gi|293523952|ref|ZP_06670639.1| 16S rRNA M(2)G 1207 methyltransferase [Staphylococcus aureus subsp.
           aureus M1015]
 gi|294850317|ref|ZP_06791051.1| ribosomal RNA small subunit methyltransferase C [Staphylococcus
           aureus A9754]
 gi|295406918|ref|ZP_06816721.1| ribosomal RNA small subunit methyltransferase C [Staphylococcus
           aureus A8819]
 gi|295427079|ref|ZP_06819715.1| ribosomal RNA small subunit methyltransferase C [Staphylococcus
           aureus subsp. aureus EMRSA16]
 gi|296275787|ref|ZP_06858294.1| hypothetical protein SauraMR_05547 [Staphylococcus aureus subsp.
           aureus MR1]
 gi|297246258|ref|ZP_06930107.1| ribosomal RNA small subunit methyltransferase C [Staphylococcus
           aureus A8796]
 gi|297590568|ref|ZP_06949207.1| methyltransferase domain protein [Staphylococcus aureus subsp.
           aureus MN8]
 gi|304381860|ref|ZP_07364507.1| methyltransferase domain protein [Staphylococcus aureus subsp.
           aureus ATCC BAA-39]
 gi|677850|emb|CAA45511.1| hypothetical protein [Staphylococcus aureus RN4220]
 gi|13700432|dbj|BAB41730.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           N315]
 gi|14246309|dbj|BAB56703.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|49240900|emb|CAG39567.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|57285603|gb|AAW37697.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           COL]
 gi|87127918|gb|ABD22432.1| Methyltransferase small domain [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|87201861|gb|ABD29671.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           NCTC 8325]
 gi|147740070|gb|ABQ48368.1| 16S rRNA m(2)G 1207 methyltransferase [Staphylococcus aureus subsp.
           aureus JH9]
 gi|149945500|gb|ABR51436.1| methyltransferase small [Staphylococcus aureus subsp. aureus JH1]
 gi|150373515|dbj|BAF66775.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           str. Newman]
 gi|156721005|dbj|BAF77422.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           Mu3]
 gi|160367590|gb|ABX28561.1| hypothetical protein USA300HOU_0535 [Staphylococcus aureus subsp.
           aureus USA300_TCH1516]
 gi|253729478|gb|EES98207.1| 16S rRNA methyltransferase [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|257272225|gb|EEV04348.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257275516|gb|EEV06989.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257279156|gb|EEV09757.1| methyltransferase small domain-containing protein [Staphylococcus
           aureus subsp. aureus 68-397]
 gi|257282076|gb|EEV12211.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257284756|gb|EEV14875.1| methyltransferase small domain-containing protein [Staphylococcus
           aureus subsp. aureus M876]
 gi|257789332|gb|EEV27672.1| methyltransferase [Staphylococcus aureus A9781]
 gi|257840304|gb|EEV64767.1| methyltransferase [Staphylococcus aureus A9763]
 gi|257843599|gb|EEV68005.1| 16S rRNA m(2)G 1207 methyltransferase [Staphylococcus aureus A9719]
 gi|257847667|gb|EEV71666.1| methyltransferase small domain-containing protein [Staphylococcus
           aureus A9299]
 gi|257850740|gb|EEV74685.1| methyltransferase small subunit [Staphylococcus aureus A8115]
 gi|257854932|gb|EEV77877.1| methyltransferase small domain-containing protein [Staphylococcus
           aureus A6300]
 gi|257858300|gb|EEV81187.1| methyltransferase small domain-containing protein [Staphylococcus
           aureus A6224]
 gi|257859599|gb|EEV82449.1| conserved hypothetical protein [Staphylococcus aureus A5948]
 gi|257864043|gb|EEV86797.1| methyltransferase small subunit [Staphylococcus aureus A5937]
 gi|259162324|gb|EEW46897.1| hypothetical protein SAD30_0378 [Staphylococcus aureus D30]
 gi|262074454|gb|ACY10427.1| hypothetical protein SAAV_0504 [Staphylococcus aureus subsp. aureus
           ED98]
 gi|269940114|emb|CBI48490.1| putative methyltransferase [Staphylococcus aureus subsp. aureus
           TW20]
 gi|282314159|gb|EFB44549.1| ribosomal RNA small subunit methyltransferase C [Staphylococcus
           aureus subsp. aureus C101]
 gi|282317463|gb|EFB47835.1| ribosomal RNA small subunit methyltransferase C [Staphylococcus
           aureus subsp. aureus C427]
 gi|282322406|gb|EFB52728.1| 16S rRNA M(2)G 1207 methyltransferase [Staphylococcus aureus subsp.
           aureus M899]
 gi|282325574|gb|EFB55882.1| methyltransferase small subunit [Staphylococcus aureus subsp.
           aureus WBG10049]
 gi|282328253|gb|EFB58531.1| methyltransferase small subunit [Staphylococcus aureus subsp.
           aureus WW2703/97]
 gi|282331744|gb|EFB61255.1| ribosomal RNA small subunit methyltransferase C [Staphylococcus
           aureus subsp. aureus Btn1260]
 gi|282589486|gb|EFB94575.1| ribosomal RNA small subunit methyltransferase C [Staphylococcus
           aureus A10102]
 gi|282592866|gb|EFB97870.1| ribosomal RNA small subunit methyltransferase C [Staphylococcus
           aureus A9765]
 gi|282762658|gb|EFC02795.1| ribosomal RNA small subunit methyltransferase C [Staphylococcus
           aureus A8117]
 gi|283790790|gb|EFC29605.1| 16S rRNA M(2)G 1207 methyltransferase [Staphylococcus aureus subsp.
           aureus A017934/97]
 gi|285816242|gb|ADC36729.1| hypothetical protein SA2981_0518 [Staphylococcus aureus 04-02981]
 gi|290920915|gb|EFD97976.1| 16S rRNA M(2)G 1207 methyltransferase [Staphylococcus aureus subsp.
           aureus M1015]
 gi|291095425|gb|EFE25686.1| ribosomal RNA small subunit methyltransferase C [Staphylococcus
           aureus subsp. aureus 58-424]
 gi|291467462|gb|EFF09977.1| ribosomal RNA small subunit methyltransferase C [Staphylococcus
           aureus subsp. aureus M809]
 gi|294822829|gb|EFG39264.1| ribosomal RNA small subunit methyltransferase C [Staphylococcus
           aureus A9754]
 gi|294968149|gb|EFG44175.1| ribosomal RNA small subunit methyltransferase C [Staphylococcus
           aureus A8819]
 gi|295128867|gb|EFG58497.1| ribosomal RNA small subunit methyltransferase C [Staphylococcus
           aureus subsp. aureus EMRSA16]
 gi|297176856|gb|EFH36114.1| ribosomal RNA small subunit methyltransferase C [Staphylococcus
           aureus A8796]
 gi|297576867|gb|EFH95582.1| methyltransferase domain protein [Staphylococcus aureus subsp.
           aureus MN8]
 gi|302750432|gb|ADL64609.1| methyltransferase small domain protein [Staphylococcus aureus
           subsp. aureus str. JKD6008]
 gi|304339646|gb|EFM05593.1| methyltransferase domain protein [Staphylococcus aureus subsp.
           aureus ATCC BAA-39]
 gi|312439039|gb|ADQ78110.1| methyltransferase domain protein [Staphylococcus aureus subsp.
           aureus TCH60]
 gi|312829037|emb|CBX33879.1| uncharacterized protein ybxB (P23) (ORF23) [Staphylococcus aureus
           subsp. aureus ECT-R 2]
 gi|315128834|gb|EFT84833.1| hypothetical protein CGSSa03_13117 [Staphylococcus aureus subsp.
           aureus CGS03]
 gi|315193905|gb|EFU24299.1| hypothetical protein CGSSa00_12767 [Staphylococcus aureus subsp.
           aureus CGS00]
 gi|315196647|gb|EFU26994.1| hypothetical protein CGSSa01_14540 [Staphylococcus aureus subsp.
           aureus CGS01]
 gi|320141594|gb|EFW33433.1| methyltransferase small domain protein [Staphylococcus aureus
           subsp. aureus MRSA131]
 gi|320141777|gb|EFW33605.1| methyltransferase small domain protein [Staphylococcus aureus
           subsp. aureus MRSA177]
 gi|329313261|gb|AEB87674.1| 16S rRNA m(2)G 1207 methyltransferase [Staphylococcus aureus subsp.
           aureus T0131]
 gi|329727940|gb|EGG64389.1| methyltransferase small domain protein [Staphylococcus aureus
           subsp. aureus 21172]
 gi|329731023|gb|EGG67396.1| methyltransferase small domain protein [Staphylococcus aureus
           subsp. aureus 21189]
 gi|1094969|prf||2107219A rpoB upstream ORF
 gi|1096953|prf||2113202A ORF 202
          Length = 202

 Score = 37.7 bits (86), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 64/144 (44%), Gaps = 21/144 (14%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           +AD+G G G  GL +A        +    S  M     + LAL     + K   L  +D 
Sbjct: 64  IADVGCGYGPIGLMIAK-------VSPHHSITMLDVNHRALAL-----VEKNKKLNGIDN 111

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAI 134
            +V E+  L+ +++  +D ++ NPP   R G  T  +I E+A   L+ + E ++     I
Sbjct: 112 VIVKESDALSAVEDKSFDFILTNPPI--RAGKETVHRIFEQALHRLDSNGELFV----VI 165

Query: 135 MRSSGQLSLIARPQSL---IQIVN 155
            +  G  S   R   L   +++VN
Sbjct: 166 QKKQGMPSAKKRMNELFGNVEVVN 189


>gi|298693872|gb|ADI97094.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           ED133]
          Length = 202

 Score = 37.7 bits (86), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 64/144 (44%), Gaps = 21/144 (14%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           +AD+G G G  GL +A        +    S  M     + LAL     + K   L  +D 
Sbjct: 64  IADVGCGYGPIGLMIAK-------VSPHHSITMLDVNHRALAL-----VEKNQKLNGIDN 111

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAI 134
            +V E+  L+ +++  +D ++ NPP   R G  T  +I E+A   L+ + E ++     I
Sbjct: 112 VIVKESDALSAVEDKSFDFILTNPPI--RAGKETVHRIFEQALHRLDSNGELFV----VI 165

Query: 135 MRSSGQLSLIARPQSL---IQIVN 155
            +  G  S   R   L   +++VN
Sbjct: 166 QKKQGMPSAKKRMNELFGNVEVVN 189


>gi|183602494|ref|ZP_02963859.1| possible methylase protein [Bifidobacterium animalis subsp. lactis
           HN019]
 gi|219683537|ref|YP_002469920.1| methylase protein [Bifidobacterium animalis subsp. lactis AD011]
 gi|241190568|ref|YP_002967962.1| methylase of polypeptide chain release factor [Bifidobacterium
           animalis subsp. lactis Bl-04]
 gi|241195974|ref|YP_002969529.1| methylase of polypeptide chain release factor [Bifidobacterium
           animalis subsp. lactis DSM 10140]
 gi|183218135|gb|EDT88781.1| possible methylase protein [Bifidobacterium animalis subsp. lactis
           HN019]
 gi|219621187|gb|ACL29344.1| possible methylase protein [Bifidobacterium animalis subsp. lactis
           AD011]
 gi|240248960|gb|ACS45900.1| Methylase of polypeptide chain release factor [Bifidobacterium
           animalis subsp. lactis Bl-04]
 gi|240250528|gb|ACS47467.1| Methylase of polypeptide chain release factor [Bifidobacterium
           animalis subsp. lactis DSM 10140]
 gi|295793555|gb|ADG33090.1| Methylase of polypeptide chain release factor [Bifidobacterium
           animalis subsp. lactis V9]
          Length = 304

 Score = 37.7 bits (86), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 44/90 (48%), Gaps = 10/90 (11%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL AG+GA GLA+A+ +  AQ+   E SP  A + R+ +      QIS+    I  + 
Sbjct: 131 IVDLCAGSGALGLALATEIPGAQVWGVELSPQAAVWTRRNI-----TQISRTYPDITANY 185

Query: 75  TLVGENR----NLAGLKNNFYDHVIMNPPF 100
            L   +      LA L     D V+ NPP+
Sbjct: 186 HLEIADATCPITLAHLDGTV-DVVVSNPPY 214


>gi|323439811|gb|EGA97528.1| methyltransferase small subunit [Staphylococcus aureus O11]
          Length = 202

 Score = 37.7 bits (86), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 64/144 (44%), Gaps = 21/144 (14%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           +AD+G G G  GL +A        +    S  M     + LAL     + K   L  +D 
Sbjct: 64  IADVGCGYGPIGLMIAK-------VSPHHSITMLDVNHRALAL-----VKKNQKLNGIDN 111

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAI 134
            +V E+  L+ +++  +D ++ NPP   R G  T  +I E+A   L+ + E ++     I
Sbjct: 112 VIVKESDALSAVEDKSFDFILTNPPI--RAGKETVHRIFEQALHRLDSNGELFV----VI 165

Query: 135 MRSSGQLSLIARPQSL---IQIVN 155
            +  G  S   R   L   +++VN
Sbjct: 166 QKKQGMPSAKKRMNELFGNVEVVN 189


>gi|163844183|ref|YP_001628588.1| methyltransferase small [Brucella suis ATCC 23445]
 gi|163674906|gb|ABY39017.1| methyltransferase small [Brucella suis ATCC 23445]
          Length = 340

 Score = 37.7 bits (86), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 62/138 (44%), Gaps = 29/138 (21%)

Query: 14  HLADLGAGAG---AAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLI 70
           ++ADLGAG G   A  L  A R+    +  A+   L A  AR  L        S  IS  
Sbjct: 199 NVADLGAGWGYLAAQCLKYADRIKNIDLYEADYEALEA--ARGNLE---RLGASIPISFN 253

Query: 71  EVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRT 130
             DVT    +  +AG+    YD VIMNPPF E  G +T         V L  SF   I  
Sbjct: 254 WFDVT----SEKIAGI----YDTVIMNPPFYE--GRVT--------DVSLGQSF---IAA 292

Query: 131 ACAIMRSSGQLSLIARPQ 148
           A + ++  G+L ++A  Q
Sbjct: 293 AASRLKPGGRLLMVANRQ 310


>gi|110834309|ref|YP_693168.1| ribosomal ribonucleate guanine-2-methyltransferase [Alcanivorax
           borkumensis SK2]
 gi|110647420|emb|CAL16896.1| ribosomal ribonucleate guanine-2-methyltransferase [Alcanivorax
           borkumensis SK2]
          Length = 416

 Score = 37.7 bits (86), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 41/88 (46%), Gaps = 12/88 (13%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           +ADLG G G  G+AV      A++   + S L    AR          +S+  S  E   
Sbjct: 268 VADLGCGNGVIGMAVLKANPAARVTFCDESWLALESARDN--------VSRYFSDAESHF 319

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNE 102
            L      LAGL+  F D +++NPPF++
Sbjct: 320 HL---GDGLAGLEQRF-DCILLNPPFHD 343


>gi|146313175|ref|YP_001178249.1| rRNA (guanine-N(2)-)-methyltransferase [Enterobacter sp. 638]
 gi|229564328|sp|A4WER8|RLMG_ENT38 RecName: Full=Ribosomal RNA large subunit methyltransferase G;
           AltName: Full=23S rRNA m2G1835 methyltransferase;
           AltName: Full=rRNA (guanine-N(2)-)-methyltransferase
           rlmG
 gi|145320051|gb|ABP62198.1| 23S rRNA m(2)G-1835 methyltransferase / 16S rRNA m(2)G 1207
           methyltransferase [Enterobacter sp. 638]
          Length = 378

 Score = 37.7 bits (86), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 43/89 (48%), Gaps = 9/89 (10%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DLG G G  GL +  +  EA +L  + SP+    +R    L     + + +   E  +
Sbjct: 232 IVDLGCGNGVVGLTLLEKNPEASVLFTDESPMAVASSR----LNVETNMPEALDRCEFMI 287

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNER 103
                N  L+G++   ++ V+ NPPF+++
Sbjct: 288 -----NNALSGVEPFRFNAVLCNPPFHQQ 311


>gi|283455531|ref|YP_003360095.1| hemK Peptide release factor-glutamine N5-methyltransferase
           [Bifidobacterium dentium Bd1]
 gi|283102165|gb|ADB09271.1| hemK Peptide release factor-glutamine N5-methyltransferase
           [Bifidobacterium dentium Bd1]
          Length = 298

 Score = 37.7 bits (86), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 46/98 (46%), Gaps = 4/98 (4%)

Query: 5   SLVNATGSFH--LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQ 62
             +   G +H  + DL AG+GA GLAV + +  +++   E+S   A + R+ L   A A 
Sbjct: 112 DWITRNGGYHARVVDLCAGSGAIGLAVVTEVPGSEVWAVEKSERTAEWTRRNLNETAQAH 171

Query: 63  ISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF 100
            S  I    +++    +   L  L     D V+ NPP+
Sbjct: 172 PSI-IGNYHLEIGDATQMPTLHQLDGTI-DIVLTNPPY 207


>gi|332184656|gb|AEE26910.1| modification methylase, HemK family [Francisella cf. novicida 3523]
          Length = 284

 Score = 37.7 bits (86), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 52/113 (46%), Gaps = 12/113 (10%)

Query: 2   ILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANA 61
           +L  +V+      + DLG G GA GLA+A+ L  +QI+  +         +++L +  N 
Sbjct: 106 VLDDIVDKNAKLKILDLGTGTGAIGLALAAELVNSQIVAVD-------LYQQSLDVAKNN 158

Query: 62  QISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKE 114
             +  I+    +V  + ++     L    +D ++ NPP+ +   T     +KE
Sbjct: 159 AQANNIT----NVKFI-QSSWYTSLDTGKFDIIVSNPPYIDLADTNIEQSVKE 206


>gi|330975578|gb|EGH75644.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Pseudomonas syringae pv. aptata str. DSM 50252]
          Length = 277

 Score = 37.7 bits (86), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 42/96 (43%), Gaps = 12/96 (12%)

Query: 5   SLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQIS 64
            LV A     + DLG G GA  LA+A+   + ++   +R P     A +           
Sbjct: 103 ELVPAFAPAQVLDLGTGTGAIALALANERQQWKVTAVDRVPEAVALAERN---------R 153

Query: 65  KRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF 100
           +R+ L   +V    E+    GL+   +D +I NPP+
Sbjct: 154 QRLQLNNAEVF---ESHWFGGLQGRQFDLIISNPPY 186


>gi|319399710|gb|EFV87959.1| uncharacterized protein ybxB [Staphylococcus epidermidis FRI909]
          Length = 202

 Score = 37.7 bits (86), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 36/153 (23%), Positives = 72/153 (47%), Gaps = 30/153 (19%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           +AD+G G G  GLA+       QI + + +        + LAL   A+++K  +  +VD 
Sbjct: 64  IADVGCGYGPIGLAIGKASPHHQITMLDIN-------NRALAL---AEMNKTKN--QVDN 111

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAI 134
             + E+  L+ + +  +D+++ NPP   R G       K+  H + E +F++        
Sbjct: 112 VTIMESNCLSAVNHQCFDYILTNPPI--RAG-------KDIVHRIFEQAFDR-------- 154

Query: 135 MRSSGQLS-LIARPQSLIQIVNACARRIGSLEI 166
           ++++G+L  +I + Q +           G++EI
Sbjct: 155 LKTTGELYVVIQKKQGMPSAKKKIEELFGNVEI 187


>gi|159036817|ref|YP_001536070.1| putative methyltransferase [Salinispora arenicola CNS-205]
 gi|157915652|gb|ABV97079.1| putative methyltransferase [Salinispora arenicola CNS-205]
          Length = 187

 Score = 37.7 bits (86), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 46/101 (45%), Gaps = 19/101 (18%)

Query: 14  HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTL----ALPANAQISKRISL 69
             ADL AG+GA GL   SR     +LL E +P  A   R  +    A PA   ++ +++ 
Sbjct: 47  RFADLYAGSGAVGLEALSR-GATHVLLVESNPRAARVIRANMTALRAGPAAQLVTGKVAT 105

Query: 70  IEVDVTLVGENRNLAGLKNNFYDHVIMNPPF---NERIGTM 107
           +             AG + + YD V  +PP+   +E + TM
Sbjct: 106 VLA-----------AGPEGDPYDAVFADPPYAVSDEEVSTM 135


>gi|320174522|gb|EFW49658.1| putative enzyme [Shigella dysenteriae CDC 74-1112]
          Length = 378

 Score = 37.4 bits (85), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/89 (22%), Positives = 44/89 (49%), Gaps = 9/89 (10%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DLG G G  GL +  +  +A+++  + SP+   ++R  +       + +   +I    
Sbjct: 232 IVDLGCGNGVIGLTLLDKNPQAKVVFVDESPMAVAFSRLNVETNMPEALDRSEFMI---- 287

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNER 103
                N  L+G++   ++ V+ NPPF+++
Sbjct: 288 -----NNALSGVEPFRFNAVLCNPPFHQQ 311


>gi|288957889|ref|YP_003448230.1| adenine-specific DNA-methyltransferase [Azospirillum sp. B510]
 gi|288910197|dbj|BAI71686.1| adenine-specific DNA-methyltransferase [Azospirillum sp. B510]
          Length = 310

 Score = 37.4 bits (85), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 45/96 (46%), Gaps = 13/96 (13%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DL  G+G   +  A    EAQ+   + SP     A++ +   A++    RI+L + D+  
Sbjct: 146 DLCTGSGCLAILAARIFPEAQVDAVDLSPDALEVAKRNV---ADSGFEDRITLHQGDL-- 200

Query: 77  VGENRNLAGLKNNFYDHVIMNPPF--NERIGTMTPD 110
                  A LK   YD +I NPP+   E +G + P+
Sbjct: 201 ------FAPLKTRKYDVIITNPPYVDAEAMGALPPE 230


>gi|289678405|ref|ZP_06499295.1| modification methylase HemK [Pseudomonas syringae pv. syringae FF5]
          Length = 277

 Score = 37.4 bits (85), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 42/96 (43%), Gaps = 12/96 (12%)

Query: 5   SLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQIS 64
            LV A     + DLG G GA  LA+A+   + ++   +R P     A +           
Sbjct: 103 ELVPAFAPAQVLDLGTGTGAIALALANERQQWKVTAVDRVPEAVALAERN---------R 153

Query: 65  KRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF 100
           +R+ L   +V    E+    GL+   +D +I NPP+
Sbjct: 154 QRLQLNNAEVF---ESHWFGGLQGRQFDLIISNPPY 186


>gi|253568320|ref|ZP_04845731.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
 gi|251842393|gb|EES70473.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
          Length = 237

 Score = 37.4 bits (85), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 30/146 (20%), Positives = 70/146 (47%), Gaps = 15/146 (10%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASR-LHEAQILLAERSPLMAHYARKTLALPA 59
           ++L +  +  G++ + D+G G G   L +A R L +A I+  E     A  A++ +   A
Sbjct: 27  VLLGAWASVQGAYRILDIGTGTGLVALMLAQRSLPDANIVALEIDEAAAGQAKENV---A 83

Query: 60  NAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMT-PDKIKEEAHV 118
            +    RI +++ D         L+    + +D ++ NPP+   + +++ PD+ +  A  
Sbjct: 84  RSPWKDRIEVVKQDF--------LSYQSPDKFDVIVSNPPY--FVDSLSCPDQQRSMARH 133

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLI 144
               ++EK ++    +++  G  +++
Sbjct: 134 NDSLTYEKLLKGVADLLKKEGTFTIV 159


>gi|328881226|emb|CCA54465.1| Ribosomal RNA small subunit methyltransferase C [Streptomyces
           venezuelae ATCC 10712]
          Length = 387

 Score = 37.4 bits (85), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 56/130 (43%), Gaps = 12/130 (9%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
            +LA+L    G   +ADLG G G  GLA+A    +A+++  + S      A +      +
Sbjct: 231 FLLANLPGHLGRARVADLGCGNGVVGLAIALHEPDAELVFTDESYQAVASAEENFR--TH 288

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTM--TPDKIKEEAHV 118
               ++         LVG+   LA L +   D V+ NPPF+    T   T  ++  +A  
Sbjct: 289 VGDGRKAEF------LVGD--GLADLPDGSVDLVLNNPPFHSHQATTDRTARRMFTDARR 340

Query: 119 MLEDSFEKWI 128
            L    E W+
Sbjct: 341 ALRPGGELWV 350


>gi|301168613|emb|CBW28203.1| 16S rRNA m2G1207 methylase [Haemophilus influenzae 10810]
          Length = 330

 Score = 37.4 bits (85), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 38/93 (40%), Gaps = 20/93 (21%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLA---LPANAQISKRISLIEVD 73
           DLG GAG  G  +  R   AQI + +   +    ARKTL+   L      S   S IE  
Sbjct: 196 DLGCGAGVIGSMIKKRAPNAQITMTDIHAMALESARKTLSENQLQGEVYASDVFSDIEEK 255

Query: 74  VTLVGENRNLAGLKNNFYDHVIMNPPFNERIGT 106
                            +D +I NPPF++ I T
Sbjct: 256 -----------------FDLIISNPPFHDGIDT 271


>gi|213964542|ref|ZP_03392742.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Corynebacterium amycolatum SK46]
 gi|213952735|gb|EEB64117.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Corynebacterium amycolatum SK46]
          Length = 314

 Score = 37.4 bits (85), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 50/106 (47%), Gaps = 9/106 (8%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL  G+GA  LA+A  + EA ++  E S     +A K +    +     R+ LI  DV
Sbjct: 142 IVDLCTGSGALALAIADAVPEADVVAVELSERARAWAAKNIETYGDG----RVRLIAGDV 197

Query: 75  T---LVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAH 117
           T   L+ +   LA       D V+ NPP+      +TP +++ + H
Sbjct: 198 TDDQLIDDGGELADWVGE-TDIVVSNPPYVPEDTEVTP-EVRADPH 241


>gi|171741091|ref|ZP_02916898.1| hypothetical protein BIFDEN_00157 [Bifidobacterium dentium ATCC
           27678]
 gi|171276705|gb|EDT44366.1| hypothetical protein BIFDEN_00157 [Bifidobacterium dentium ATCC
           27678]
          Length = 317

 Score = 37.4 bits (85), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 46/98 (46%), Gaps = 4/98 (4%)

Query: 5   SLVNATGSFH--LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQ 62
             +   G +H  + DL AG+GA GLAV + +  +++   E+S   A + R+ L   A A 
Sbjct: 131 DWITRNGGYHARVVDLCAGSGAIGLAVVTEVPGSEVWAVEKSERTAEWTRRNLNETAQAH 190

Query: 63  ISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF 100
            S  I    +++    +   L  L     D V+ NPP+
Sbjct: 191 PSI-IGNYHLEIGDATQMPTLHQLDGTI-DIVLTNPPY 226


>gi|269103477|ref|ZP_06156174.1| hypothetical 16S RNA G1207 methylase RsmC [Photobacterium damselae
           subsp. damselae CIP 102761]
 gi|268163375|gb|EEZ41871.1| hypothetical 16S RNA G1207 methylase RsmC [Photobacterium damselae
           subsp. damselae CIP 102761]
          Length = 339

 Score = 37.4 bits (85), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 60/151 (39%), Gaps = 29/151 (19%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           D G GAG  G  + ++  E  + L + S L    A++T  +     ++   +  +V  TL
Sbjct: 205 DFGCGAGVIGAVMKAKYPEIDVELCDISALAIESAKETFKV---NNLTGSFTATDVYKTL 261

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMR 136
            G            Y  +I NPPF+  + T                + E +I  A   + 
Sbjct: 262 TGP-----------YQFLISNPPFHAGLKTFYA-------------ATENFIAQAPEYLA 297

Query: 137 SSGQLSLIARPQSLIQIVNACARRIGSLEIT 167
            +GQL ++A   S +Q      + +G  E+T
Sbjct: 298 ENGQLVIVAN--SFLQYPPLIEQSLGQCEVT 326


>gi|226307403|ref|YP_002767363.1| protein methyltransferase [Rhodococcus erythropolis PR4]
 gi|226186520|dbj|BAH34624.1| protein methyltransferase [Rhodococcus erythropolis PR4]
          Length = 310

 Score = 37.4 bits (85), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 46/104 (44%), Gaps = 5/104 (4%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DL  G+G   L++A    +A +   E+ P    +AR+  A    A   K I L + DVT 
Sbjct: 121 DLCTGSGVLALSIAEARPDAVVHAVEKEPAALAWARRN-AADREAAGDKPIHLHQGDVT- 178

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120
              +RNL        D V+ NPP+      + P+ +  + H  L
Sbjct: 179 ---DRNLLPGLEGGVDLVVSNPPYIPEGAQLQPEVMDYDPHTAL 219


>gi|227529624|ref|ZP_03959673.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Lactobacillus vaginalis ATCC 49540]
 gi|227350414|gb|EEJ40705.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Lactobacillus vaginalis ATCC 49540]
          Length = 286

 Score = 37.4 bits (85), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 46/104 (44%), Gaps = 13/104 (12%)

Query: 8   NATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRI 67
           N +    + DLG G+G  G+ +A    +  + L++ SP     A+K +      + +  +
Sbjct: 109 NTSTPLKVLDLGTGSGVIGITLALERPQWNVTLSDVSPAALMVAQKNM-----QRFNLNL 163

Query: 68  SLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDK 111
            L++ D+         A L N  YD ++ NPP+     T   D+
Sbjct: 164 RLVQSDL--------FANLTNEKYDLIVTNPPYISHDATALMDR 199


>gi|319790287|ref|YP_004151920.1| methyltransferase small [Thermovibrio ammonificans HB-1]
 gi|317114789|gb|ADU97279.1| methyltransferase small [Thermovibrio ammonificans HB-1]
          Length = 249

 Score = 37.4 bits (85), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 64/146 (43%), Gaps = 10/146 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
            +L   V   G   LADLG G G   + +  +  + + +  +        A K   L   
Sbjct: 31  FLLTDFVKLKGKERLADLGTGCGVIPILLLLKHPKVEAVGIDVLEENVKLALKNAEL--- 87

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNE--RIGTMTPDKIKEEAHV 118
            ++++R   + ++VT V E+      + + +D V+ NPPF E  R  T T    +  A  
Sbjct: 88  NKVAERFQAVTLNVTQVKEH-----FRPSSFDVVVSNPPFIEVGRGSTSTRSMHRAVARQ 142

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLI 144
            L+   E +I+ A  +++  G+  L+
Sbjct: 143 ELKAKLEDFIKAASYLLKDRGRFFLL 168


>gi|149182681|ref|ZP_01861148.1| hypothetical protein BSG1_10608 [Bacillus sp. SG-1]
 gi|148849591|gb|EDL63774.1| hypothetical protein BSG1_10608 [Bacillus sp. SG-1]
          Length = 248

 Score = 37.4 bits (85), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 43/211 (20%), Positives = 89/211 (42%), Gaps = 19/211 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL +G G   L +++R     I   E    +   A +++      ++  +IS+I  D+
Sbjct: 49  IIDLCSGNGVIPLMLSNRT-SVPITGVEIQERLFEMANRSIEY---NKLGNQISMIHGDI 104

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLED-----SFEKWIR 129
             +      A   N+ +D V  NPP+         +KI    H  +       + E  ++
Sbjct: 105 KDMP-----ARFGNDKFDAVTCNPPY---FSKGEKEKINSNEHYAIARHELLCTLEDVVK 156

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRKGM 188
               +++  G+ S + RP   + ++      RI    I  ++P + + A+ +LV G K  
Sbjct: 157 AVGLLLKQGGKASFVHRPGRGVDLLTLMREYRIEPKRIRFVYPNKHKEANTVLVEGIKDG 216

Query: 189 RGQLRFRYPIVLHKPNGQPYSRFVTDLINGK 219
              L+   P++++  +   Y   V +++ GK
Sbjct: 217 SPDLKVLQPLIVYNEDNS-YGNEVHEMLYGK 246


>gi|300715112|ref|YP_003739915.1| ribosomal RNA small subunit methyltransferase D [Erwinia billingiae
           Eb661]
 gi|299060948|emb|CAX58055.1| ribosomal RNA small subunit methyltransferase D [Erwinia billingiae
           Eb661]
          Length = 375

 Score = 37.4 bits (85), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 56/111 (50%), Gaps = 16/111 (14%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISL-IEVD 73
           +ADLG G G  GL    +   A++          H+  ++    A+++++  ++   ++D
Sbjct: 232 IADLGCGNGVIGLTALDQNPAAEV----------HFIDESWMAVASSEMNVEVNRPDDLD 281

Query: 74  VTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSF 124
                 N +LAG  +N +  V+ NPPF+++  T+T D I   A  M+ DS+
Sbjct: 282 RCHFSVNHSLAGFPSNTFHAVLCNPPFHQQ-NTLT-DYI---AWQMMRDSY 327


>gi|257464823|ref|ZP_05629194.1| HemK-like protein/protein-glutamine N-methyl transferase
           [Actinobacillus minor 202]
 gi|257450483|gb|EEV24526.1| HemK-like protein/protein-glutamine N-methyl transferase
           [Actinobacillus minor 202]
          Length = 289

 Score = 37.4 bits (85), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 50/101 (49%), Gaps = 19/101 (18%)

Query: 7   VNATGSFHLADLGAGAGAAGLAVASRLHE-AQILLAERSP---LMAHYARKTLALPANAQ 62
           +N+  +  + DLG G GA  LA+AS L E AQI+  ++      +A   R+ L       
Sbjct: 116 LNSQETLQILDLGTGTGAIALALASELGEKAQIIGVDKQAEAVQLAEQNRQNLGF----- 170

Query: 63  ISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNER 103
             +++  ++ D   V        L+N+ +D ++ NPP+ ++
Sbjct: 171 --EQVRFLQSDWFSV--------LENHCFDLIVSNPPYIDK 201


>gi|330972815|gb|EGH72881.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Pseudomonas syringae pv. aceris str. M302273PT]
          Length = 277

 Score = 37.4 bits (85), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 43/96 (44%), Gaps = 12/96 (12%)

Query: 5   SLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQIS 64
            LV A     + DLG G GA  LA+A+   + ++   +R P     A +           
Sbjct: 103 ELVPAFAPAQVLDLGTGTGAIALALANDRQQWKVTAVDRVPEAVALAERN---------R 153

Query: 65  KRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF 100
           +R+ L   +V    E+   +GL+   +D +I NPP+
Sbjct: 154 QRLQLNNAEVF---ESHWFSGLQGRQFDLIISNPPY 186


>gi|152977707|ref|YP_001343336.1| methyltransferase type 12 [Actinobacillus succinogenes 130Z]
 gi|262827845|sp|A6VKA4|TRMN6_ACTSZ RecName: Full=tRNA (adenine-N(6)-)-methyltransferase; AltName:
           Full=tRNA m6A37 methyltransferase
 gi|150839430|gb|ABR73401.1| Methyltransferase type 12 [Actinobacillus succinogenes 130Z]
          Length = 236

 Score = 37.4 bits (85), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 44/192 (22%), Positives = 83/192 (43%), Gaps = 23/192 (11%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHE-AQILLAERSPLMAHYARKTL-ALP 58
           ++L +  +   S  + DLG G+G   L +A R  E  QI   ER P  A  A++   A P
Sbjct: 28  ILLGAWADLANSRSILDLGTGSGLIALMLAQRSDEDVQIHGVERDPAAARQAQENFRASP 87

Query: 59  ANAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHV 118
                + R+ L   D+    +     G K   +D+++ NPP+  + G    +  +  A  
Sbjct: 88  ----WAHRLYLHFGDIADFAQK---CGQK---FDNIVANPPYFAQ-GVDCRNHARNAARY 136

Query: 119 MLEDSFEKWIRTACAIMRSSGQLSLI---ARPQSLIQIVN-ACARRIGSLEITPLHPREG 174
               S  +W+  A +++   G +  +    + ++L Q     C R+   +       ++G
Sbjct: 137 TAALSHAQWLEIASSLLTEQGTIHFVLPAEQGKTLKQSTALYCVRQCDVI------SKQG 190

Query: 175 ECASRILVTGRK 186
           + A R+L++  K
Sbjct: 191 KAAQRVLLSFMK 202


>gi|242094784|ref|XP_002437882.1| hypothetical protein SORBIDRAFT_10g004380 [Sorghum bicolor]
 gi|241916105|gb|EER89249.1| hypothetical protein SORBIDRAFT_10g004380 [Sorghum bicolor]
          Length = 209

 Score = 37.4 bits (85), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 45/100 (45%), Gaps = 16/100 (16%)

Query: 5   SLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLA-ERSPLMAHYARKTLALPANAQI 63
           S  + TG   +AD G G G   LAV S L EA+ +L  +  P     A++  A       
Sbjct: 43  SFDDITGKV-VADFGCGCGT--LAVGSALLEAEHVLGIDIDPQSLELAQENAAD------ 93

Query: 64  SKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNER 103
                 +E+D+ LV  +     LK    D V+MNPPF  R
Sbjct: 94  ------LELDIDLVWSDIKNLNLKGVHVDTVVMNPPFGTR 127


>gi|66044203|ref|YP_234044.1| modification methylase HemK [Pseudomonas syringae pv. syringae
           B728a]
 gi|63254910|gb|AAY36006.1| Modification methylase HemK [Pseudomonas syringae pv. syringae
           B728a]
          Length = 277

 Score = 37.4 bits (85), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 43/96 (44%), Gaps = 12/96 (12%)

Query: 5   SLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQIS 64
            LV A     + DLG G GA  LA+A+   + ++   +R P     A +           
Sbjct: 103 ELVPAFAPAQVLDLGTGTGAIALALANDRQQWKVTAVDRVPEAVALAERN---------R 153

Query: 65  KRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF 100
           +R+ L   +V    E+   +GL+   +D +I NPP+
Sbjct: 154 QRLQLNNAEVF---ESHWFSGLQGRQFDLIISNPPY 186


>gi|229470502|sp|Q0VPK2|RLMG_ALCBS RecName: Full=Ribosomal RNA large subunit methyltransferase G;
           AltName: Full=23S rRNA m2G1835 methyltransferase;
           AltName: Full=rRNA (guanine-N(2)-)-methyltransferase
           rlmG
          Length = 390

 Score = 37.4 bits (85), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 41/88 (46%), Gaps = 12/88 (13%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           +ADLG G G  G+AV      A++   + S L    AR          +S+  S  E   
Sbjct: 242 VADLGCGNGVIGMAVLKANPAARVTFCDESWLALESARDN--------VSRYFSDAESHF 293

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNE 102
            L      LAGL+  F D +++NPPF++
Sbjct: 294 HL---GDGLAGLEQRF-DCILLNPPFHD 317


>gi|82750249|ref|YP_415990.1| hypothetical protein SAB0492 [Staphylococcus aureus RF122]
 gi|82655780|emb|CAI80180.1| conserved hypothetical protein [Staphylococcus aureus RF122]
          Length = 202

 Score = 37.4 bits (85), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 62/148 (41%), Gaps = 18/148 (12%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           +AD+G G G  GL +A        +    S  M     + LAL     + K   L  +D 
Sbjct: 64  IADVGCGYGPIGLMIAK-------VSPHHSITMLDVNHRALAL-----VEKNKKLNGIDN 111

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAI 134
            +V E+  L+ +++  +D ++ NPP   R G  T  +I E+A   L+ + E ++     I
Sbjct: 112 VIVKESDALSAVEDKSFDFILTNPPI--RAGKETVHRIFEQALHRLDSNGELFV----VI 165

Query: 135 MRSSGQLSLIARPQSLIQIVNACARRIG 162
            +  G  S   R   L   V    +  G
Sbjct: 166 QKKQGMPSAKKRMNELFGNVEVANKDKG 193


>gi|56479090|ref|YP_160679.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Aromatoleum aromaticum EbN1]
 gi|56315133|emb|CAI09778.1| Adenine specific methylase, HemK family [Aromatoleum aromaticum
           EbN1]
          Length = 311

 Score = 37.4 bits (85), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 47/100 (47%), Gaps = 13/100 (13%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DL  G+G   + +A     AQI+ A+ S      AR  ++   +  +  R+ L++ DV  
Sbjct: 149 DLCTGSGCLAILMAHAFPNAQIVGADLSDEALQVARANVS---DYDLDDRVELLKSDV-- 203

Query: 77  VGENRNLAGLKNNFYDHVIMNPPF--NERIGTMTPDKIKE 114
                  AGL    +D +I NPP+   + + T+ P+ + E
Sbjct: 204 ------FAGLAGRRFDLIISNPPYVTADAMATLPPEYLHE 237


>gi|332289730|ref|YP_004420582.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Gallibacterium anatis UMN179]
 gi|330432626|gb|AEC17685.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Gallibacterium anatis UMN179]
          Length = 276

 Score = 37.4 bits (85), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 39/187 (20%), Positives = 83/187 (44%), Gaps = 14/187 (7%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASR-LHEAQILLAERSPLMAHYARKTLALPA 59
           ++L +  +  G+  + DLG G G   L +A R   + QI+  E        A   +A+  
Sbjct: 61  VLLGAWADVAGANRILDLGCGTGLIALMLAQRSAADCQIVGVEIEENAYCQALDNVAI-- 118

Query: 60  NAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVM 119
            +  S R+++    +      +      +  +D ++ NPP+ E   +   D+ +E A  +
Sbjct: 119 -SPWSARVTIYHQSM------QQFCRETSQRFDLIVANPPYFES-ASQCRDQSRETARYV 170

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLIARPQS---LIQIVNACARRIGSLEITPLHPREGEC 176
            + S   W+  A   +   G++  +   Q+   L Q ++A + ++   E+  +  +EG+ 
Sbjct: 171 GDLSHLDWLLAAENCLSVKGKIQFVLPFQAGICLQQQLSATSSKLCCTEVCHVITKEGKM 230

Query: 177 ASRILVT 183
             R+L+T
Sbjct: 231 PQRMLLT 237


>gi|300858257|ref|YP_003783240.1| methylase of peptide chain release factors [Corynebacterium
           pseudotuberculosis FRC41]
 gi|300685711|gb|ADK28633.1| methylase of peptide chain release factors [Corynebacterium
           pseudotuberculosis FRC41]
 gi|302205978|gb|ADL10320.1| Putative protein-(glutamine-N5) methyltransferase, release
           factor-specific [Corynebacterium pseudotuberculosis
           C231]
 gi|302330531|gb|ADL20725.1| Putative protoporphyrinogen oxidase HemK [Corynebacterium
           pseudotuberculosis 1002]
 gi|308276213|gb|ADO26112.1| methylase of peptide chain release factors [Corynebacterium
           pseudotuberculosis I19]
          Length = 272

 Score = 37.4 bits (85), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 47/107 (43%), Gaps = 12/107 (11%)

Query: 10  TGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISL 69
           +G   + DL  G+GA    VA+ +   ++   E SP  AHYA++ L           ++L
Sbjct: 104 SGGETVVDLCTGSGALAAYVATLVPTTKVTAVELSPSAAHYAQENL--------PPSVNL 155

Query: 70  IEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEA 116
           I  D T     R L G      D ++ NPP+      +TP+   + A
Sbjct: 156 IIGDATDPNVLRPLMGT----VDVLVSNPPYVPETPDLTPEVYYDPA 198


>gi|283458331|ref|YP_003362952.1| methylase of polypeptide chain release factor [Rothia mucilaginosa
           DY-18]
 gi|283134367|dbj|BAI65132.1| methylase of polypeptide chain release factor [Rothia mucilaginosa
           DY-18]
          Length = 308

 Score = 37.4 bits (85), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 42/93 (45%), Gaps = 13/93 (13%)

Query: 8   NATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRI 67
           +ATG   + DL  G+GA   AV S L +AQ+   E S     Y R+ L  P    + +  
Sbjct: 131 SATGGLRIVDLCTGSGAIAAAVKSELPDAQVFAVELSEDAIPYTRRNLE-PLGVHLVQGD 189

Query: 68  SLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF 100
           +L  +          LAG     +D V+ NPP+
Sbjct: 190 ALTSL--------SELAGT----FDAVLSNPPY 210


>gi|260494056|ref|ZP_05814187.1| methyltransferase [Fusobacterium sp. 3_1_33]
 gi|260198202|gb|EEW95718.1| methyltransferase [Fusobacterium sp. 3_1_33]
          Length = 243

 Score = 37.4 bits (85), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 27/121 (22%), Positives = 57/121 (47%), Gaps = 4/121 (3%)

Query: 90  FYDHVIMNPPF---NERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIAR 146
           F+D ++ NPPF   N  I  +   K    A   +E + E+ I+ +  +++  G   L+ R
Sbjct: 113 FFDIIVSNPPFFKVNRDINFLNNLKQLSIARHEIEITLEELIKISSELIKDRGYFYLVHR 172

Query: 147 PQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNG 205
              L +I+    + + G+ +I   +  + + A  +L+   K  +  L     ++++K NG
Sbjct: 173 SDRLSEILCILEKYKFGAKKIKFCYTTKYKNAKIVLIEAIKNGKTGLTILPSLIINKENG 232

Query: 206 Q 206
           +
Sbjct: 233 E 233


>gi|306842721|ref|ZP_07475364.1| methyltransferase small [Brucella sp. BO2]
 gi|306287167|gb|EFM58669.1| methyltransferase small [Brucella sp. BO2]
          Length = 340

 Score = 37.4 bits (85), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 45/141 (31%), Positives = 64/141 (45%), Gaps = 35/141 (24%)

Query: 14  HLADLGAGAG---AAGLAVASRLHEAQILLAERSPLMA---HYARKTLALPANAQISKRI 67
           ++ADLGAG G   A  L  A R+    +  A+   L A   +  R   ++P        I
Sbjct: 199 NVADLGAGWGYLAAQCLKYADRIKNIDLYEADYEALEAAGGNLERLGASIP--------I 250

Query: 68  SLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKW 127
           S    DVT    +  +AG+    YD VIMNPPF+E  G +T         V L  SF   
Sbjct: 251 SFNWFDVT----SEKIAGI----YDTVIMNPPFHE--GRVT--------DVSLGQSF--- 289

Query: 128 IRTACAIMRSSGQLSLIARPQ 148
           I  A + ++  G+L ++A  Q
Sbjct: 290 IAAAASRLKPGGRLLVVANRQ 310


>gi|327479477|gb|AEA82787.1| nucleotide methyltransferase, putative [Pseudomonas stutzeri DSM
           4166]
          Length = 375

 Score = 37.4 bits (85), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 54/129 (41%), Gaps = 13/129 (10%)

Query: 2   ILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANA 61
            L  L  A G+  +ADLG G G  G+  A    +A++ L + S +    AR+       A
Sbjct: 222 FLPHLPKALGALRVADLGCGNGVLGIVYALGNPQAELTLVDESYMAVQSARENW----QA 277

Query: 62  QISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNER--IGTMTPDKIKEEAHVM 119
            + +R + I            LA       D V+ NPPF+++  +G     ++  +A   
Sbjct: 278 ILGERPADIRA-------GDGLAEQSPGSLDLVLCNPPFHQQQVVGDFLAWRMFTQAKAA 330

Query: 120 LEDSFEKWI 128
           L    E WI
Sbjct: 331 LTKGGELWI 339


>gi|170751295|ref|YP_001757555.1| methyltransferase small [Methylobacterium radiotolerans JCM 2831]
 gi|170657817|gb|ACB26872.1| methyltransferase small [Methylobacterium radiotolerans JCM 2831]
          Length = 324

 Score = 37.4 bits (85), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 38/84 (45%), Gaps = 13/84 (15%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           D+G G+GAAG+ VA R   A+++L + +P     AR    L     +  R S +  DV  
Sbjct: 147 DIGCGSGAAGICVAKRAPGAEVVLVDINPAAMRAARVNARLAGTDGVDVRRSDMLRDV-- 204

Query: 77  VGENRNLAGLKNNFYDHVIMNPPF 100
                         +D ++ NPPF
Sbjct: 205 -----------EGQFDLIVSNPPF 217


>gi|150401069|ref|YP_001324835.1| methyltransferase small [Methanococcus aeolicus Nankai-3]
 gi|150013772|gb|ABR56223.1| methyltransferase small [Methanococcus aeolicus Nankai-3]
          Length = 201

 Score = 37.4 bits (85), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 48/99 (48%), Gaps = 8/99 (8%)

Query: 2   ILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANA 61
           IL   +    ++ + D+G G G  G+++A+ ++   I + + +    + A+K L L    
Sbjct: 46  ILVEALQLGKNYDILDIGCGYGVVGISIANEVN--SITMTDINNRAVNLAKKNLKLN--- 100

Query: 62  QISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF 100
            I K +   E  +T+V  N     +KN  YD +I NPP 
Sbjct: 101 NIDKYLE--EDKITIVQGNL-YQNVKNKKYDLIISNPPI 136


>gi|237744391|ref|ZP_04574872.1| methyltransferase [Fusobacterium sp. 7_1]
 gi|229431620|gb|EEO41832.1| methyltransferase [Fusobacterium sp. 7_1]
          Length = 243

 Score = 37.4 bits (85), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 27/121 (22%), Positives = 57/121 (47%), Gaps = 4/121 (3%)

Query: 90  FYDHVIMNPPF---NERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIAR 146
           F+D ++ NPPF   N  +  +   K    A   +E + E+ I+ +  +++  G   L+ R
Sbjct: 113 FFDIIVSNPPFFKVNRDVNFLNNLKQLSIARHEIEITLEELIKISSELIKDRGYFYLVHR 172

Query: 147 PQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNG 205
              L +I+    + + G+ +I   +  + + A  IL+   K  +  L     ++++K NG
Sbjct: 173 ADRLSEILCILEKYKFGAKKIKFCYTTKYKNAKIILIEAIKNGKTGLTILPSLIINKENG 232

Query: 206 Q 206
           +
Sbjct: 233 E 233


>gi|257095184|ref|YP_003168825.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Candidatus Accumulibacter phosphatis clade IIA str.
           UW-1]
 gi|257047708|gb|ACV36896.1| protein-(glutamine-N5) methyltransferase, ribosomal protein
           L3-specific [Candidatus Accumulibacter phosphatis clade
           IIA str. UW-1]
          Length = 297

 Score = 37.4 bits (85), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 47/105 (44%), Gaps = 12/105 (11%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DL  G+    +  A     A+I   + SP     AR+ +    +  ++ RI L+E D+  
Sbjct: 136 DLCTGSACLAIIAAHAFPAARIDAVDVSPDALVVARRNVE---DYDLATRIRLVEGDL-- 190

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNERIGTMT-PDKIKEEAHVML 120
                  AGLK   YD +I NPP+ +     T PD+ + E  + L
Sbjct: 191 ------FAGLKQRRYDLIIANPPYVKASSMATLPDEYRREPELAL 229


>gi|311745306|ref|ZP_07719091.1| putative methyltransferase YbiN [Algoriphagus sp. PR1]
 gi|126577839|gb|EAZ82059.1| putative methyltransferase YbiN [Algoriphagus sp. PR1]
          Length = 319

 Score = 37.4 bits (85), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 47/90 (52%), Gaps = 12/90 (13%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DLG GA      + +R++    + +E  P   H A++ L   +N QI K+++L       
Sbjct: 117 DLGTGANCIYPLLGTRIYNWNFVGSEIDPKAIHSAQQNLN--SNPQILKKVNL------R 168

Query: 77  VGENRN--LAGL--KNNFYDHVIMNPPFNE 102
           + EN    L+G+   ++ +D V+ NPPF+E
Sbjct: 169 LQENPKEILSGIIRSDDVFDLVLCNPPFHE 198


>gi|309802546|ref|ZP_07696650.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Bifidobacterium dentium JCVIHMP022]
 gi|308220610|gb|EFO76918.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Bifidobacterium dentium JCVIHMP022]
          Length = 298

 Score = 37.4 bits (85), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 46/98 (46%), Gaps = 4/98 (4%)

Query: 5   SLVNATGSFH--LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQ 62
             +   G +H  + DL AG+GA GLAV + +  +++   E+S   A + R+ L   A A 
Sbjct: 112 DWITRNGGYHARVVDLCAGSGAIGLAVVTEVPGSEVWAVEKSERTAEWTRRNLNETARAH 171

Query: 63  ISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF 100
            S  I    +++    +   L  L     D V+ NPP+
Sbjct: 172 PSI-IGNYHLEIGDATQMPTLHQLDGTI-DIVLTNPPY 207


>gi|288941148|ref|YP_003443388.1| protein-(glutamine-N5) methyltransferase, ribosomal protein
           L3-specific [Allochromatium vinosum DSM 180]
 gi|288896520|gb|ADC62356.1| protein-(glutamine-N5) methyltransferase, ribosomal protein
           L3-specific [Allochromatium vinosum DSM 180]
          Length = 310

 Score = 37.4 bits (85), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 50/117 (42%), Gaps = 15/117 (12%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DL  G+G  G+A A  L +A + L + SP     AR  +       +  R+ + E D+  
Sbjct: 137 DLCTGSGCIGIAAAVYLPDADVDLVDISPEALVIARDNV---ERHGVGDRVHIFESDL-- 191

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNERIG-TMTPDKIKEEAHVML---EDSFEKWIR 129
                  A L +  YD ++ NPP+  R      P +   E H+ L   ED  +  +R
Sbjct: 192 ------FAALGDQRYDVIVSNPPYVSRAEFEALPTEYHNEPHLGLLAGEDGLDIVLR 242


>gi|239636940|ref|ZP_04677938.1| methyltransferase small domain protein [Staphylococcus warneri
           L37603]
 gi|239597488|gb|EEQ79987.1| methyltransferase small domain protein [Staphylococcus warneri
           L37603]
          Length = 202

 Score = 37.4 bits (85), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 59/150 (39%), Gaps = 22/150 (14%)

Query: 15  LADLGAGAGAAGLAVA--SRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEV 72
           +AD+G G G  GL +A  S  H+  +L   R  L      K      NA I +   + +V
Sbjct: 64  IADVGCGYGPIGLMIAKVSPHHQITMLDVNRRALELAKKNKKKNHIENADIFESDGMTQV 123

Query: 73  DVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTAC 132
           D              +N +D V+ NPP   R G     +I EEA+  L+ + E ++    
Sbjct: 124 D--------------DNQFDFVLTNPPI--RAGKAVVHRIFEEAYQKLKSNGELYV---- 163

Query: 133 AIMRSSGQLSLIARPQSLIQIVNACARRIG 162
            I +  G  S   +   L   V    +  G
Sbjct: 164 VIQKKQGMPSAKKKMDELFNNVEVVNKSKG 193


>gi|239618399|ref|YP_002941721.1| Methyltransferase type 11 [Kosmotoga olearia TBF 19.5.1]
 gi|239507230|gb|ACR80717.1| Methyltransferase type 11 [Kosmotoga olearia TBF 19.5.1]
          Length = 235

 Score = 37.4 bits (85), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 34/187 (18%), Positives = 81/187 (43%), Gaps = 10/187 (5%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           +LG G+GA  + +A R ++ +I   +    +   A K   +     ++ ++  +++   +
Sbjct: 55  ELGTGSGAISIYLA-RKYDVEITAIDVDEELIEIAHKNARVN---NVTDKVKFMQLSSAM 110

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMR 136
             E  +        +D V+ NPP     G  +P + +  +  +  +  +++ +    +++
Sbjct: 111 AVEKFSAGS-----FDVVVSNPPHFAHEGIESPSQRRNSSRRLTIEGIKEFAQATGRLLK 165

Query: 137 SSGQLSLIARPQSLIQIVNACA-RRIGSLEITPLHPREGECASRILVTGRKGMRGQLRFR 195
           S G    I  P+ L + ++A     +G   +  +     + +  +LV GRK    ++   
Sbjct: 166 SRGAFFFILHPRDLTRWLSAFEMNNLGVHRLRFVFGTANKQSQLVLVKGRKNSTSEVVVE 225

Query: 196 YPIVLHK 202
            PI+L K
Sbjct: 226 PPIILRK 232


>gi|237799728|ref|ZP_04588189.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331022583|gb|EGI02640.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 277

 Score = 37.4 bits (85), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 43/96 (44%), Gaps = 12/96 (12%)

Query: 5   SLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQIS 64
            LV A  S  + DLG G GA  LA+A+   + ++   +R P     A +           
Sbjct: 103 ELVPAFASAQVLDLGTGTGAIALALANERQQWKVTAVDRVPEAVALAERN---------R 153

Query: 65  KRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF 100
           KR+ L   +V    ++   + L+   +D +I NPP+
Sbjct: 154 KRLHLDNAEVL---DSNWFSALQGRQFDLIISNPPY 186


>gi|295108645|emb|CBL22598.1| Predicted O-methyltransferase [Ruminococcus obeum A2-162]
          Length = 250

 Score = 37.0 bits (84), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 39/209 (18%), Positives = 89/209 (42%), Gaps = 14/209 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++L+   N   +  + D+G G G   + + S+     +   E     A  AR+++     
Sbjct: 39  VLLSGFANIRKNETVLDMGTGTGIIPILLKSKGKGGHLTGLEIQEECADMARRSV----- 93

Query: 61  AQISKRISLIEVDVTLV-GENRNLAG-LKNNFYDHVIMNPPFN-ERIGTMTPDKIKEEAH 117
                R + +E D+ ++ G+ +  A       +D V  NPP+   + G   P   K  A 
Sbjct: 94  -----RYNSLESDIDIICGDIKEAAATFGAASFDVVTSNPPYMIGQHGIQNPYMAKAIAR 148

Query: 118 VMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGEC 176
             +  + E  +  A  +++  G+  ++ RP  L +I     + ++    +  ++P   + 
Sbjct: 149 HEILCTLEDVVSQAANVLKDRGRFFMVHRPFRLAEIFQVLMKYKLEPKRMQLVYPYVNKE 208

Query: 177 ASRILVTGRKGMRGQLRFRYPIVLHKPNG 205
            + +L+  RKG   ++    P+++++  G
Sbjct: 209 PNMVLIEARKGCNSRISVEPPLIVYEKPG 237


>gi|306823421|ref|ZP_07456796.1| protein-(glutamine-N5) methyltransferase [Bifidobacterium dentium
           ATCC 27679]
 gi|304553128|gb|EFM41040.1| protein-(glutamine-N5) methyltransferase [Bifidobacterium dentium
           ATCC 27679]
          Length = 317

 Score = 37.0 bits (84), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 46/98 (46%), Gaps = 4/98 (4%)

Query: 5   SLVNATGSFH--LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQ 62
             +   G +H  + DL AG+GA GLAV + +  +++   E+S   A + R+ L   A A 
Sbjct: 131 DWITRNGGYHARVVDLCAGSGAIGLAVVTEVPGSEVWAVEKSERTAEWTRRNLNETARAH 190

Query: 63  ISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF 100
            S  I    +++    +   L  L     D V+ NPP+
Sbjct: 191 PSI-IGNYHLEIGDATQMPTLHQLDGTI-DIVLTNPPY 226


>gi|219850518|ref|YP_002464951.1| methyltransferase small [Chloroflexus aggregans DSM 9485]
 gi|219544777|gb|ACL26515.1| methyltransferase small [Chloroflexus aggregans DSM 9485]
          Length = 202

 Score = 37.0 bits (84), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 25/51 (49%)

Query: 14  HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQIS 64
           H+ DLG G G  G+ +A R   A + L ++  L   YAR    L A   ++
Sbjct: 59  HILDLGCGCGVIGICLARRFPNAHVTLVDKDLLAVRYARHNAILNATPNVT 109


>gi|188581630|ref|YP_001925075.1| methyltransferase small [Methylobacterium populi BJ001]
 gi|179345128|gb|ACB80540.1| methyltransferase small [Methylobacterium populi BJ001]
          Length = 341

 Score = 37.0 bits (84), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 13/86 (15%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + D+G G+GA G+ VA RL EA+++L + +P     AR       NA+++   ++  V  
Sbjct: 162 VVDIGCGSGATGILVAKRLPEAEVVLVDINPAALRAAR------INARLAGVPNVHPVHS 215

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPF 100
            +      L G++  F D ++ NPPF
Sbjct: 216 DM------LQGVEGAF-DLIVSNPPF 234


>gi|119486657|ref|ZP_01620707.1| Modification methylase HemK [Lyngbya sp. PCC 8106]
 gi|119456274|gb|EAW37406.1| Modification methylase HemK [Lyngbya sp. PCC 8106]
          Length = 304

 Score = 37.0 bits (84), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 59/138 (42%), Gaps = 25/138 (18%)

Query: 14  HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALP-ANAQ---ISKRISL 69
           H  DLG G+GA  L +AS L EA I   + S       R+ LA+   NAQ    + RI+ 
Sbjct: 135 HWVDLGTGSGAIALGLASVLTEASIHAVDCS-------REALAIAQKNAQDLGFADRIAF 187

Query: 70  IEVDVTLVGENRNLAGLKNNFYDHVIMNPPF--NERIGTMTPDKIKEEAHVMLE------ 121
            +      G               ++ NPP+     + T+ P+  + E H+ L+      
Sbjct: 188 YQ------GRWWEPLDCLRGKVSGMVSNPPYIPTAMLSTLQPEVARHEPHLALDGGESGL 241

Query: 122 DSFEKWIRTACAIMRSSG 139
           D  +  ++TA A + S G
Sbjct: 242 DCIQHLVQTAPAYLHSGG 259


>gi|115466582|ref|NP_001056890.1| Os06g0162600 [Oryza sativa Japonica Group]
 gi|55296080|dbj|BAD67642.1| putative early nodule-specific-like protein ENOD8 [Oryza sativa
           Japonica Group]
 gi|113594930|dbj|BAF18804.1| Os06g0162600 [Oryza sativa Japonica Group]
 gi|215694922|dbj|BAG90113.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|218197644|gb|EEC80071.1| hypothetical protein OsI_21788 [Oryza sativa Indica Group]
          Length = 227

 Score = 37.0 bits (84), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 48/97 (49%), Gaps = 16/97 (16%)

Query: 5   SLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLA-ERSPLMAHYARKTLALPANAQI 63
           S  + TG   +AD G G G   L+VAS L +A+ ++  +  P     A++  A      +
Sbjct: 43  SFDDITGKV-VADFGCGCGT--LSVASSLLDAEHVVGIDIDPQSLELAQENAA-----DL 94

Query: 64  SKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF 100
              I LI+ D+    +N NL GL     D V+MNPPF
Sbjct: 95  ELDIDLIQCDI----KNLNLRGL---LVDTVVMNPPF 124


>gi|240169514|ref|ZP_04748173.1| modification methylase HemK [Mycobacterium kansasii ATCC 12478]
          Length = 282

 Score = 37.0 bits (84), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 49/101 (48%), Gaps = 11/101 (10%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DL  G+GA  +A+A     A+I+  + S     YAR+      NA+ S  + LI  DV
Sbjct: 115 IVDLCTGSGALAVALARHRPAARIIGLDDSEAALEYARR------NAEGSN-VELIRADV 167

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEE 115
           T +G   +L    +   D VI NPP+     T+ P+  + +
Sbjct: 168 TTLGLRPDL----DRRVDLVIANPPYVPDNATVEPEVAQHD 204


>gi|294634559|ref|ZP_06713094.1| ribosomal RNA small subunit methyltransferase D [Edwardsiella tarda
           ATCC 23685]
 gi|291092073|gb|EFE24634.1| ribosomal RNA small subunit methyltransferase D [Edwardsiella tarda
           ATCC 23685]
          Length = 385

 Score = 37.0 bits (84), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 43/89 (48%), Gaps = 9/89 (10%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           +ADLG G G  GL V  R  +A++L A+ S +    A   L +  N     R   +E   
Sbjct: 238 VADLGCGNGVLGLMVLHRCPQARVLFADESYMAV--ASSHLNVQHN-----RPQDLERSE 290

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNER 103
             VG    LAG +    D V+ NPPF+++
Sbjct: 291 FWVGN--GLAGREGGSLDAVLCNPPFHQQ 317


>gi|330961729|gb|EGH61989.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
           [Pseudomonas syringae pv. maculicola str. ES4326]
          Length = 277

 Score = 37.0 bits (84), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 47/99 (47%), Gaps = 18/99 (18%)

Query: 5   SLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAER---SPLMAHYARKTLALPANA 61
            LV A  S  + DLG G GA GLA+A+   + ++   +R   +  +A   R+ L L  NA
Sbjct: 103 ELVPAFASAQVLDLGTGTGAIGLALANERKQWKVTAVDRVAEAVALAERNRQRLHL-NNA 161

Query: 62  QISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF 100
           +I               E+   +GL+   +D +I NPP+
Sbjct: 162 EIF--------------ESHWFSGLQGRQFDLIISNPPY 186


>gi|217034302|ref|ZP_03439719.1| hypothetical protein HP9810_885g33 [Helicobacter pylori 98-10]
 gi|216943274|gb|EEC22739.1| hypothetical protein HP9810_885g33 [Helicobacter pylori 98-10]
          Length = 238

 Score = 37.0 bits (84), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 40/191 (20%), Positives = 75/191 (39%), Gaps = 17/191 (8%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           D+G+G G  GL  A     A + L E+   MA +++K      NAQ+ +    ++ +  +
Sbjct: 40  DIGSGCGVLGLLCARDNPLASVHLVEKDSKMAFFSQKNALKFPNAQVFES-DFLDFNPPI 98

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMR 136
           +             YD ++ NPPF   +G++   K K  A    E  F   +      ++
Sbjct: 99  L-------------YDAIVCNPPF-YALGSIK-SKNKGHARHQSELDFASLVAKVKKCLK 143

Query: 137 SSGQLSLIARPQSLIQIVNACARRIGSLE-ITPLHPREGECASRILVTGRKGMRGQLRFR 195
             G         SL  ++ +      +LE +  +   + + A  +L   R   +  L+  
Sbjct: 144 PKGYFIFCYEALSLCLVIESLKSAKLTLETLRFVQSFKDKNAHLMLGLARNNSKSALKVL 203

Query: 196 YPIVLHKPNGQ 206
            P++ H    Q
Sbjct: 204 PPLITHNSKNQ 214


>gi|147836353|emb|CAN77729.1| hypothetical protein VITISV_027411 [Vitis vinifera]
          Length = 538

 Score = 37.0 bits (84), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 57/115 (49%), Gaps = 15/115 (13%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISL----I 70
           + D+GAG+G   L  A     A+ + A  +  MA YARK +A   N  + KRI++    +
Sbjct: 217 VVDVGAGSGILSLFAAQA--GAKHVYAVEASEMAEYARKLIA--GNPSLGKRITVDGVHL 272

Query: 71  EVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERI-GTMTPDKIKEEAHVMLEDSF 124
           +   +L  EN + AG+  NF      N  +   I GT+  ++   E++V+  D F
Sbjct: 273 DGKASLSNENTSAAGIMENF------NKIYGLEIKGTLLVNERMLESYVIARDRF 321


>gi|311694730|gb|ADP97603.1| protein-(glutamine-N5) methyltransferase, ribosomal protein
           L3-specific [marine bacterium HP15]
          Length = 300

 Score = 37.0 bits (84), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 50/106 (47%), Gaps = 15/106 (14%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DL  G+G  G+  AS   EA++ L++ SP     A   + L     + +R+  ++ DV  
Sbjct: 134 DLCTGSGCIGIGAASVFGEAEVDLSDISPDALEVAESNIDLHG---VRERVRTVQSDVFD 190

Query: 77  VGENRNLAGLKNNFYDHVIMNPPF--NERIGTMTPDKIKEEAHVML 120
             E R         YD ++ NPP+   + + +M PD+ + E  + L
Sbjct: 191 NIEGR---------YDVIVSNPPYVDADDLSSM-PDEYRHEPELGL 226


>gi|325276436|ref|ZP_08142205.1| trans-aconitate 2-methyltransferase [Pseudomonas sp. TJI-51]
 gi|324098430|gb|EGB96507.1| trans-aconitate 2-methyltransferase [Pseudomonas sp. TJI-51]
          Length = 258

 Score = 37.0 bits (84), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 45/115 (39%), Gaps = 6/115 (5%)

Query: 14  HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYA--RKTLALP----ANAQISKRI 67
           H  DLG G G +   +  R  +AQ++  +  P M   A  RK L +P      A IS   
Sbjct: 33  HATDLGCGPGNSTEVLLQRYPDAQVMALDSDPDMIAKARERKRLCIPRVRTVVADISGWS 92

Query: 68  SLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLED 122
           +    D+ L   +          Y H++        +   TPD + E AH  L +
Sbjct: 93  APEPQDLILANASLQWVPEHAKLYPHLVRQLSEGASLAVQTPDNLDEPAHRQLRE 147


>gi|127511702|ref|YP_001092899.1| methyltransferase small [Shewanella loihica PV-4]
 gi|262828704|sp|A3QAZ2|TRMN6_SHELP RecName: Full=tRNA (adenine-N(6)-)-methyltransferase; AltName:
           Full=tRNA m6A37 methyltransferase
 gi|126636997|gb|ABO22640.1| methyltransferase small [Shewanella loihica PV-4]
          Length = 243

 Score = 37.0 bits (84), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 68/145 (46%), Gaps = 9/145 (6%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           ++L +    T +  + D+GAG+G   L  A R  EA I   E  PL A   +  +     
Sbjct: 24  VLLGAWAPLTQAKTILDIGAGSGLLSLMAAQR-SEAVIQALEIDPLAAQDCQHNI---DQ 79

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLK-NNFYDHVIMNPPFNERIGTMTPDKIKEEAHVM 119
           +  S RI+LI+ D+    +   LA  +    +DH++ NPP+ +  G  +    + +A   
Sbjct: 80  SPWSDRITLIQADLL---QWYPLAQTQAQTQFDHILCNPPYFDN-GPQSQCSKRAQARHT 135

Query: 120 LEDSFEKWIRTACAIMRSSGQLSLI 144
              +F++ +     ++  +G+ SLI
Sbjct: 136 DSLAFDQLLSAIKQLLAPTGKASLI 160


>gi|330831275|ref|YP_004394227.1| ribosomal RNA small subunit methyltransferase C [Aeromonas veronii
           B565]
 gi|328806411|gb|AEB51610.1| Ribosomal RNA small subunit methyltransferase C [Aeromonas veronii
           B565]
          Length = 342

 Score = 37.0 bits (84), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 50/107 (46%), Gaps = 16/107 (14%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           M+LA++    G   L D G GAG  G  +A R  E Q+ + + S L    +R+TLA    
Sbjct: 194 MLLAAVPPMKG--ELLDFGCGAGVIGSVLAKRNPELQVNMVDISALALESSRRTLA---- 247

Query: 61  AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTM 107
                 I+ ++  VT      +L    +  + H++ NPPF+  + T 
Sbjct: 248 ------INGLQGKVTASDVYSDL----STRFQHIVSNPPFHAGLKTF 284


>gi|88810846|ref|ZP_01126103.1| HemK protein [Nitrococcus mobilis Nb-231]
 gi|88792476|gb|EAR23586.1| HemK protein [Nitrococcus mobilis Nb-231]
          Length = 283

 Score = 37.0 bits (84), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 72/168 (42%), Gaps = 40/168 (23%)

Query: 3   LASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQ 62
           LASL   T    L DLG G+GA GLA+A+   +A ++  +  P     AR       NA 
Sbjct: 108 LASLTGITQPMVL-DLGTGSGAVGLAIATERPDATVVAVDTCPRALAVAR------CNA- 159

Query: 63  ISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLED 122
             +R+ L  V   L+G+    AG +   +  ++ NPP+                     D
Sbjct: 160 --RRLGLQRVQF-LLGDWLEPAGERR--FHLIVANPPYV--------------------D 194

Query: 123 SFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLH 170
             E  +R  CA +R     +L+A  Q L ++     RRI S  +T LH
Sbjct: 195 PAEPELR--CASLRFEPPTALLAPEQGLAEL-----RRIVSGALTNLH 235


>gi|251809958|ref|ZP_04824431.1| 16S rRNA methyltransferase [Staphylococcus epidermidis BCM-HMP0060]
 gi|282875008|ref|ZP_06283883.1| methyltransferase small domain protein [Staphylococcus epidermidis
           SK135]
 gi|251806501|gb|EES59158.1| 16S rRNA methyltransferase [Staphylococcus epidermidis BCM-HMP0060]
 gi|281296336|gb|EFA88855.1| methyltransferase small domain protein [Staphylococcus epidermidis
           SK135]
 gi|329734650|gb|EGG70957.1| methyltransferase small domain protein [Staphylococcus epidermidis
           VCU028]
          Length = 244

 Score = 37.0 bits (84), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 70/153 (45%), Gaps = 30/153 (19%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           +AD+G G G  GLA+       QI        M     + LAL   A+++K  +  +VD 
Sbjct: 106 IADVGCGYGPIGLAIGKASPHHQIT-------MLDINNRALAL---AEMNKTKN--QVDN 153

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAI 134
             + E+  L+ + +  +D+++ NPP   R G       K+  H + E +F++        
Sbjct: 154 VTIMESDCLSAVNHQCFDYILTNPPI--RAG-------KDIVHRIFEQAFDR-------- 196

Query: 135 MRSSGQLS-LIARPQSLIQIVNACARRIGSLEI 166
           ++++G+L  +I + Q +           G++EI
Sbjct: 197 LKTTGELYVVIQKKQGMPSAKKKIEELFGNVEI 229


>gi|209519637|ref|ZP_03268427.1| methyltransferase [Burkholderia sp. H160]
 gi|209499923|gb|EDZ99988.1| methyltransferase [Burkholderia sp. H160]
          Length = 204

 Score = 37.0 bits (84), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 43/88 (48%), Gaps = 10/88 (11%)

Query: 14  HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVD 73
           H  DL AG+GA G   ASR   A++L+ ER+      AR    L AN Q   R+    ++
Sbjct: 65  HCLDLFAGSGALGFEAASR-RAARVLMVERN------ARAAGQLRANQQ---RLDARMIE 114

Query: 74  VTLVGENRNLAGLKNNFYDHVIMNPPFN 101
           +      R  A L    +D V ++PPF+
Sbjct: 115 IAEADGLRLAASLAPGSFDVVFLDPPFD 142


>gi|145593832|ref|YP_001158129.1| putative methyltransferase [Salinispora tropica CNB-440]
 gi|145303169|gb|ABP53751.1| putative methyltransferase [Salinispora tropica CNB-440]
          Length = 187

 Score = 37.0 bits (84), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 46/101 (45%), Gaps = 19/101 (18%)

Query: 14  HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLAL----PANAQISKRISL 69
             ADL AG+GA GL   SR   A +LL E +P  A   R  +A     PA   ++ +++ 
Sbjct: 47  RFADLYAGSGAVGLEALSR-GAAHVLLVESNPRAARTIRANVAALRAGPAARLVAGKVAT 105

Query: 70  IEVDVTLVGENRNLAGLKNNFYDHVIMNPPF---NERIGTM 107
           +  D           G +   YD V  +PP+   +E + +M
Sbjct: 106 VLAD-----------GPEEGPYDVVFADPPYSVSDEEVSSM 135


>gi|109039399|ref|XP_001098011.1| PREDICTED: hemK methyltransferase family member 1 isoform 2 [Macaca
           mulatta]
          Length = 338

 Score = 37.0 bits (84), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 55/109 (50%), Gaps = 14/109 (12%)

Query: 7   VNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPL---MAHYARKTLALPANAQI 63
           V + GS  + ++G G+GA  L++ S+L +++++  ++      + H   + L      Q+
Sbjct: 155 VGSPGSPLILEVGCGSGAISLSLLSQLPQSRVIAVDKGEAAISLTHENAQRL------QL 208

Query: 64  SKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPP--FNERIGTMTPD 110
             RI +I +D+T     R+   L     D VI NPP  F++ +  + P+
Sbjct: 209 QDRIWIIHLDMT---SERSWTHLPWGPVDLVISNPPYIFHQDMEQLAPE 254


>gi|87122988|ref|ZP_01078848.1| putative HemK protein, Methylase of polypeptide chain release
           factors [Marinomonas sp. MED121]
 gi|86161725|gb|EAQ63030.1| putative HemK protein, Methylase of polypeptide chain release
           factors [Marinomonas sp. MED121]
          Length = 234

 Score = 37.0 bits (84), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 13/95 (13%)

Query: 6   LVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISK 65
           L+    S  + DLG G GA  LA+AS  H+A +   +  P     AR         Q ++
Sbjct: 112 LIADVKSPSIVDLGTGTGAVALALASERHDANVSAVDLIPEAVELAR---------QNNQ 162

Query: 66  RISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF 100
           +++L  VD+       N+A      +D ++ NPP+
Sbjct: 163 KLNL-NVDIQQSSWFDNVATTD---FDLIVSNPPY 193


>gi|330447421|ref|ZP_08311070.1| S-adenosyl-L-methionine-dependent methyltransferase [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
 gi|328491612|dbj|GAA05567.1| S-adenosyl-L-methionine-dependent methyltransferase [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
          Length = 236

 Score = 37.0 bits (84), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 39/86 (45%), Gaps = 8/86 (9%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           L D+G G+G   L  A R     I   E  P  A+ AR+     A +   +R+  IE D+
Sbjct: 40  LLDIGTGSGLLALIAAQRAPMLSIEAIEIDPQAANAARQNF---AASPWHERLHCIEQDI 96

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPF 100
           TL      L    +N  D +I NPP+
Sbjct: 97  TLW-----LQSQPSNSVDGIICNPPY 117


>gi|294496974|ref|YP_003560674.1| 16S rRNA m(2)G 1207 methyltransferase [Bacillus megaterium QM
           B1551]
 gi|294346911|gb|ADE67240.1| 16S rRNA m(2)G 1207 methyltransferase [Bacillus megaterium QM
           B1551]
          Length = 200

 Score = 37.0 bits (84), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 66/149 (44%), Gaps = 20/149 (13%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALP-ANAQISKRISLIEVD 73
           L D+G G G  GLA+A          ++R+  M     + LAL   NA+++  +S + + 
Sbjct: 62  LLDVGCGYGPIGLALAKE-------DSQRNVHMVDVNERALALAQKNAEVNS-VSNVSIY 113

Query: 74  VTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACA 133
            +   EN     +K   +  ++ NPP   R G     +I E++   L D  E WI     
Sbjct: 114 QSSCYEN-----VKETNFAAILSNPPI--RAGKKVVHEILEKSLDHLADQGELWI----V 162

Query: 134 IMRSSGQLSLIARPQSLIQIVNACARRIG 162
           I +  G  S +A+ +SL   V    ++ G
Sbjct: 163 IQKKQGAPSALAKLESLFNEVEVVEKKKG 191


>gi|92116090|ref|YP_575819.1| HemK family modification methylase [Nitrobacter hamburgensis X14]
 gi|91798984|gb|ABE61359.1| [protein release factor]-glutamine N5-methyltransferase
           [Nitrobacter hamburgensis X14]
          Length = 317

 Score = 37.0 bits (84), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 60/125 (48%), Gaps = 19/125 (15%)

Query: 13  FHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLI-E 71
             +ADLG G+GA  LA+ S L +A  +  + S      A+      ANAQ   R+ L   
Sbjct: 148 LRIADLGTGSGAILLALLSELPDATGVGTDLSAAALDTAK------ANAQ---RLGLAPR 198

Query: 72  VDVTLVGENRNLAGLKNNFYDHVIMNPPF--NERIGTMTPDKIKEEAHVMLE---DSFEK 126
            D T+     + AG  ++ +D ++ NPP+  +  I ++ P+    + H+ L+   D  E 
Sbjct: 199 ADFTV----SDYAGGLSDPFDLIVSNPPYIRSADIASLAPEVRDHDPHLALDGGSDGLEA 254

Query: 127 WIRTA 131
           + R A
Sbjct: 255 YRRIA 259


>gi|295702341|ref|YP_003595416.1| 16S rRNA m(2)G 1207 methyltransferase [Bacillus megaterium DSM 319]
 gi|294800000|gb|ADF37066.1| 16S rRNA m(2)G 1207 methyltransferase [Bacillus megaterium DSM 319]
          Length = 200

 Score = 37.0 bits (84), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 66/149 (44%), Gaps = 20/149 (13%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALP-ANAQISKRISLIEVD 73
           L D+G G G  GLA+A          ++R+  M     + LAL   NA+++  +S + + 
Sbjct: 62  LLDVGCGYGPIGLALAKE-------DSQRNVHMVDVNERALALAQKNAEVNS-VSNVSIY 113

Query: 74  VTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACA 133
            +   EN     +K   +  ++ NPP   R G     +I E++   L D  E WI     
Sbjct: 114 QSSCYEN-----VKETNFAAILSNPPI--RAGKKVVHEILEKSLDHLADQGELWI----V 162

Query: 134 IMRSSGQLSLIARPQSLIQIVNACARRIG 162
           I +  G  S +A+ +SL   V    ++ G
Sbjct: 163 IQKKQGAPSALAKLESLFNEVEVVEKKKG 191


>gi|241855543|ref|XP_002416030.1| n6-DNA-methyltransferase, putative [Ixodes scapularis]
 gi|215510244|gb|EEC19697.1| n6-DNA-methyltransferase, putative [Ixodes scapularis]
          Length = 222

 Score = 37.0 bits (84), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 34/153 (22%), Positives = 69/153 (45%), Gaps = 16/153 (10%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAV--ASRLHEAQILLAERSPLMAHYARKTLALP 58
           ++L+ L     S  + D+G G GA  LA+  A+++H   +   +++P     +++     
Sbjct: 41  IVLSHLKRTPKSSTVLDIGCGTGAICLALGNAAQIHCTGV---DKNPKAVKLSKENAT-- 95

Query: 59  ANAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF--NERIGTMTPDKIKEEA 116
            N  ++   +  E +++  G +   + L N  YD ++ NPP+   E    + P+ ++ E 
Sbjct: 96  -NLNLAHCATFHEAEISSHGIDTAYSPLLNQVYDVIVSNPPYISTEEAKDLEPEVLRYED 154

Query: 117 HVMLE------DSFEKWIRTACAIMRSSGQLSL 143
           H  L       D  +  +R +   +R  G L L
Sbjct: 155 HGALFAGPRGLDMVQNILRYSRTNLRVGGHLFL 187


>gi|317506167|ref|ZP_07963988.1| protein-(glutamine-N5) methyltransferase [Segniliparus rugosus ATCC
           BAA-974]
 gi|316255512|gb|EFV14761.1| protein-(glutamine-N5) methyltransferase [Segniliparus rugosus ATCC
           BAA-974]
          Length = 297

 Score = 37.0 bits (84), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 50/98 (51%), Gaps = 6/98 (6%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DL +G+G+ GL++A  + E+ + L E  P    +  K +   A++  +  + ++E DVT 
Sbjct: 129 DLCSGSGSLGLSIAHSVPESAVTLVENDPKALVWTHKNVQAGASSGRAP-VRVVEGDVT- 186

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKE 114
              ++ L        D V+ NPP+    GT TP ++ +
Sbjct: 187 ---DQALLPDGAGTVDLVVANPPYVPS-GTPTPPEVAD 220


>gi|194364468|ref|YP_002027078.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Stenotrophomonas maltophilia R551-3]
 gi|194347272|gb|ACF50395.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Stenotrophomonas maltophilia R551-3]
          Length = 285

 Score = 37.0 bits (84), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 12  SFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIE 71
           +  LADLG G+GA  LA+AS   +AQ+L  + SP          AL   A+ + R  L  
Sbjct: 116 ALQLADLGTGSGAIALALASERPQAQVLATDASP---------GALTVAARNAARHELGN 166

Query: 72  VDVTLVGENRNLAGLKNNFYDHVIMNPPF 100
           V     G +   A L+   +D +  NPP+
Sbjct: 167 VRFAEGGHDW-YAPLQGARFDLIASNPPY 194


>gi|330964404|gb|EGH64664.1| hypothetical protein PSYAC_07090 [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 301

 Score = 37.0 bits (84), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 43/87 (49%), Gaps = 17/87 (19%)

Query: 16  ADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQIS--KRISLIEVD 73
           AD+G G GA  L +A    +AQ+   + +P   H+A+      ANA ++  + +     D
Sbjct: 126 ADIGCGTGAGALLIAVARPDAQVYAVDINPKALHFAQ------ANAVVAGLQNMECCHSD 179

Query: 74  VTLVGENRNLAGLKNNFYDHVIMNPPF 100
           +        L+GL  NF D ++ NPP+
Sbjct: 180 I--------LSGLTGNF-DLIVANPPY 197


>gi|330878207|gb|EGH12356.1| hypothetical protein PSYMP_20644 [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 301

 Score = 37.0 bits (84), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 43/87 (49%), Gaps = 17/87 (19%)

Query: 16  ADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQIS--KRISLIEVD 73
           AD+G G GA  L +A    +AQ+   + +P   H+A+      ANA ++  + +     D
Sbjct: 126 ADIGCGTGAGALLIAVARPDAQVYAVDINPKALHFAQ------ANAVVAGLQNMECCHSD 179

Query: 74  VTLVGENRNLAGLKNNFYDHVIMNPPF 100
           +        L+GL  NF D ++ NPP+
Sbjct: 180 I--------LSGLTGNF-DLIVANPPY 197


>gi|237801726|ref|ZP_04590187.1| hypothetical protein POR16_23066 [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331024585|gb|EGI04641.1| hypothetical protein POR16_23066 [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 314

 Score = 37.0 bits (84), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 40/84 (47%), Gaps = 13/84 (15%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           D+G G GA GL +A    +AQ+   + +P   H+A+   AL       + +   + D+  
Sbjct: 140 DIGCGTGAGGLLIAVARPDAQVFAVDINPKALHFAQTNAALAG----LENVECCQSDI-- 193

Query: 77  VGENRNLAGLKNNFYDHVIMNPPF 100
                 L+G+   F D ++ NPP+
Sbjct: 194 ------LSGVTGTF-DLIVANPPY 210


>gi|221211186|ref|ZP_03584165.1| RNA methyltransferase, RsmD family [Burkholderia multivorans CGD1]
 gi|221168547|gb|EEE01015.1| RNA methyltransferase, RsmD family [Burkholderia multivorans CGD1]
          Length = 204

 Score = 37.0 bits (84), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 38/86 (44%), Gaps = 10/86 (11%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DL AG GA G   ASR   A +++ ER P  A   R          I  ++    V++  
Sbjct: 67  DLFAGTGALGFEAASR-GAANVVMVERHPRAAQQLRA---------IKDKLGARTVEIAE 116

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNE 102
               R  AGL    +D V ++PPF +
Sbjct: 117 ADALRLAAGLAPRSFDVVFLDPPFGD 142


>gi|294785502|ref|ZP_06750790.1| ribosomal RNA small subunit methyltransferase C [Fusobacterium sp.
           3_1_27]
 gi|294487216|gb|EFG34578.1| ribosomal RNA small subunit methyltransferase C [Fusobacterium sp.
           3_1_27]
          Length = 223

 Score = 37.0 bits (84), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 41/187 (21%), Positives = 83/187 (44%), Gaps = 21/187 (11%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           L D+G G G   + +++    ++++  +      +  R  +AL  N +I K I    +D+
Sbjct: 48  LLDIGTGNGILPILLSNNEFLSELIGIDIQK--ENIDRANMALELN-KIEKNIQFECMDI 104

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLED-----SFEKWIR 129
               E +N     +N++D +I NPP+ +  G     KI E  H  +       S  + I 
Sbjct: 105 R---EYKN-----SNYFDVIISNPPYMDDNGK----KINENEHKAISRHEIKLSLSELIS 152

Query: 130 TACAIMRSSGQLSLIARPQSLIQIVNACARRIGSL-EITPLHPREGECASRILVTGRKGM 188
            A  +++  G L  I R   L++I+    +   S+ +I  ++  +   ++ + V   KG 
Sbjct: 153 NAKRLLKPIGSLYFIHRTHRLVEIIKTLDKNNFSVKKIIFIYSAQNNKSTMMFVEAIKGK 212

Query: 189 RGQLRFR 195
           + +L  +
Sbjct: 213 KVKLEIQ 219


>gi|28872664|ref|NP_795283.1| hypothetical protein PSPTO_5559 [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|28855920|gb|AAO58978.1| conserved hypothetical protein [Pseudomonas syringae pv. tomato
           str. DC3000]
          Length = 324

 Score = 37.0 bits (84), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 43/87 (49%), Gaps = 17/87 (19%)

Query: 16  ADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQIS--KRISLIEVD 73
           AD+G G GA  L +A    +AQ+   + +P   H+A+      ANA ++  + +     D
Sbjct: 149 ADIGCGTGAGALLIAVARPDAQVYAVDINPKALHFAQ------ANAVVAGLQNMECCHSD 202

Query: 74  VTLVGENRNLAGLKNNFYDHVIMNPPF 100
           +        L+GL  NF D ++ NPP+
Sbjct: 203 I--------LSGLTGNF-DLIVANPPY 220


>gi|157157132|ref|YP_001464546.1| methyltransferase family protein [Escherichia coli E24377A]
 gi|229470500|sp|A7ZRW7|RLMG_ECO24 RecName: Full=Ribosomal RNA large subunit methyltransferase G;
           AltName: Full=23S rRNA m2G1835 methyltransferase;
           AltName: Full=rRNA (guanine-N(2)-)-methyltransferase
           rlmG
 gi|157079162|gb|ABV18870.1| methyltransferase family protein [Escherichia coli E24377A]
          Length = 378

 Score = 37.0 bits (84), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 45/89 (50%), Gaps = 9/89 (10%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DLG G G  GL +  +  +A+++  + SP+    +R       N + +   +L   + 
Sbjct: 232 IVDLGCGNGVIGLTLLDKNPQAKVVFVDESPMAVASSR------MNVETNMPEALDRCEF 285

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNER 103
            +   N  L+G+K   ++ V+ NPPF+++
Sbjct: 286 MI---NNALSGVKPFRFNAVLCNPPFHQQ 311


>gi|71894204|ref|YP_278312.1| protoporphirogen oxidase HemK [Mycoplasma synoviae 53]
 gi|71850992|gb|AAZ43601.1| Protoporphirogen oxidase HemK [Mycoplasma synoviae 53]
          Length = 241

 Score = 37.0 bits (84), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 49/112 (43%), Gaps = 21/112 (18%)

Query: 7   VNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKR 66
           +    SF + DL  G+G   LA+  +   A+I  ++ S +    A K      NAQI+K 
Sbjct: 70  IKNDSSFKVLDLATGSGFIALAIKKKFSSAKIYASDISKIALRQASK------NAQINK- 122

Query: 67  ISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF-------NERIGTMTPDK 111
                +D+ L+  N   + +   F + +I NPP+       +E I    P K
Sbjct: 123 -----LDIGLIHSNW-FSNVNQKF-NLIICNPPYIGKYEELSESIKKYEPKK 167


>gi|229496584|ref|ZP_04390298.1| SmtA protein [Porphyromonas endodontalis ATCC 35406]
 gi|229316481|gb|EEN82400.1| SmtA protein [Porphyromonas endodontalis ATCC 35406]
          Length = 256

 Score = 37.0 bits (84), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 44/204 (21%), Positives = 85/204 (41%), Gaps = 14/204 (6%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           D+G G G   L +A R   A++   E  P     A       A +  S R+ +++ D + 
Sbjct: 58  DVGCGTGLIALMLAQRYPRAEVTALEIEPTAVERATYNA---AQSPFSSRVRVVQADFST 114

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMR 136
               + L       YD ++ NPP+ +        +++  A  +   S ++ +R A A++ 
Sbjct: 115 WQAPQAL-------YDLIVSNPPYYKNT-LQARSEVRHTARAIGFLSPKEVLRRASALLS 166

Query: 137 SSGQLSLIARPQSLIQI-VNACARRIGSLEITPLHPREGECASRIL--VTGRKGMRGQLR 193
             G ++L+     L ++ + A  + +  + +  +H   G+   R+L   T R G   Q  
Sbjct: 167 PQGVVALVTPYDQLEELRMFAFTQGLIPIRLAAVHTTPGKPPKRLLSEWTRRDGQLLQPA 226

Query: 194 FRYPIVLHKPNGQPYSRFVTDLIN 217
               +V+H      YS    DL++
Sbjct: 227 SLQTLVIHGDTIASYSPEYLDLVH 250


>gi|222635010|gb|EEE65142.1| hypothetical protein OsJ_20224 [Oryza sativa Japonica Group]
          Length = 772

 Score = 37.0 bits (84), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 48/97 (49%), Gaps = 16/97 (16%)

Query: 5   SLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLA-ERSPLMAHYARKTLALPANAQI 63
           S  + TG   +AD G G G   L+VAS L +A+ ++  +  P     A++  A      +
Sbjct: 43  SFDDITGKV-VADFGCGCGT--LSVASSLLDAEHVVGIDIDPQSLELAQENAA-----DL 94

Query: 64  SKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF 100
              I LI+ D+    +N NL GL     D V+MNPPF
Sbjct: 95  ELDIDLIQCDI----KNLNLRGL---LVDTVVMNPPF 124


>gi|295097604|emb|CBK86694.1| 16S rRNA m(2)G 1207 methyltransferase /23S rRNA m(2)G-1835
           methyltransferase [Enterobacter cloacae subsp. cloacae
           NCTC 9394]
          Length = 378

 Score = 36.6 bits (83), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 44/89 (49%), Gaps = 9/89 (10%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DLG G G  GL + ++  EA ++ ++ SP+    +R    L     + + +   E  +
Sbjct: 232 IVDLGCGNGVIGLTLLAKNPEASVVFSDESPMAVASSR----LNVETNLPEALDRCEFMI 287

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNER 103
                N  L+G++   ++ V  NPPF+++
Sbjct: 288 -----NNALSGVEPFRFNAVFCNPPFHQK 311


>gi|161523673|ref|YP_001578685.1| methyltransferase [Burkholderia multivorans ATCC 17616]
 gi|189351558|ref|YP_001947186.1| putative N6-adenine-specific methylase [Burkholderia multivorans
           ATCC 17616]
 gi|160341102|gb|ABX14188.1| methyltransferase [Burkholderia multivorans ATCC 17616]
 gi|189335580|dbj|BAG44650.1| putative N6-adenine-specific methylase [Burkholderia multivorans
           ATCC 17616]
          Length = 204

 Score = 36.6 bits (83), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 38/86 (44%), Gaps = 10/86 (11%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DL AG GA G   ASR   A +++ ER P  A   R          I  ++    V++  
Sbjct: 67  DLFAGTGALGFEAASR-GAANVVMVERHPRAAQQLRA---------IKDKLGARTVEIAE 116

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNE 102
               R  AGL    +D V ++PPF +
Sbjct: 117 ADALRLAAGLAPRSFDVVFLDPPFGD 142


>gi|104782146|ref|YP_608644.1| DNA methylase [Pseudomonas entomophila L48]
 gi|95111133|emb|CAK15853.1| putative DNA methylase [Pseudomonas entomophila L48]
          Length = 317

 Score = 36.6 bits (83), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 39/87 (44%), Gaps = 13/87 (14%)

Query: 14  HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVD 73
           H  D+G G G   L++A    +AQ+   + +PL   Y     AL   A +S + S +   
Sbjct: 140 HAVDIGCGTGVGALSIARAAPQAQVTAVDINPLALRYTAVNAALAGVANVSPQASDL--- 196

Query: 74  VTLVGENRNLAGLKNNFYDHVIMNPPF 100
                    L G+  +F D ++ NPP+
Sbjct: 197 ---------LNGVSGHF-DLIVANPPY 213


>gi|21282225|ref|NP_645313.1| hypothetical protein MW0496 [Staphylococcus aureus subsp. aureus
           MW2]
 gi|49485406|ref|YP_042627.1| hypothetical protein SAS0499 [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|297208745|ref|ZP_06925173.1| methyltransferase domain protein [Staphylococcus aureus subsp.
           aureus ATCC 51811]
 gi|300912835|ref|ZP_07130277.1| methyltransferase domain protein [Staphylococcus aureus subsp.
           aureus TCH70]
 gi|21203661|dbj|BAB94361.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           MW2]
 gi|49243849|emb|CAG42274.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|296886690|gb|EFH25595.1| methyltransferase domain protein [Staphylococcus aureus subsp.
           aureus ATCC 51811]
 gi|300885939|gb|EFK81142.1| methyltransferase domain protein [Staphylococcus aureus subsp.
           aureus TCH70]
          Length = 202

 Score = 36.6 bits (83), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 37/144 (25%), Positives = 64/144 (44%), Gaps = 21/144 (14%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           +AD+G G G  GL +A        +    S  M     + LAL     + K   +  +D 
Sbjct: 64  IADVGCGYGPIGLMIAK-------VSPHHSITMLDVNHRALAL-----VEKNKKINGIDN 111

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAI 134
            +V E+  L+ +++  +D ++ NPP   R G  T  +I E+A   L+ + E ++     I
Sbjct: 112 AIVKESDALSAVEDKSFDFILTNPPI--RAGKETVHRIFEQALHRLDSNGELFV----VI 165

Query: 135 MRSSGQLSLIARPQSL---IQIVN 155
            +  G  S   R   L   +++VN
Sbjct: 166 QKKQGMPSAKKRMNELFGNVEVVN 189


>gi|291524150|emb|CBK89737.1| Predicted O-methyltransferase [Eubacterium rectale DSM 17629]
          Length = 252

 Score = 36.6 bits (83), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 40/192 (20%), Positives = 85/192 (44%), Gaps = 11/192 (5%)

Query: 16  ADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVT 75
            DL  G G   + + ++ +       E  P  A  AR+++       +  ++++ E DV 
Sbjct: 50  VDLCTGNGVIPILLEAKNNGEHYSGLELQPQCADLARRSVKY---NHLEDKVTIEEGDVC 106

Query: 76  LVGENRNLAGLKNNFYDHVIMNPPFN-ERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAI 134
              E   L G ++   + V +NPP+   + G    D     A   +  + +  +R +  +
Sbjct: 107 NASE---LFGRES--VEVVTVNPPYMIGQHGIKNADDAMTIARHEVRCTLDDIVRESAKM 161

Query: 135 MRSSGQLSLIARPQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRKGMRGQLR 193
           ++ +G+  ++ RP  L +I +   +  I    +  +HP      + +L+ G KG + ++ 
Sbjct: 162 LKFNGRFYMVHRPFRLAEIFSTMMKYHIEPKRMRLVHPYADREPNMVLIEGLKGGKSRIT 221

Query: 194 FRYPIVLHK-PN 204
              P+V++K PN
Sbjct: 222 IEKPLVVYKEPN 233


>gi|237729269|ref|ZP_04559750.1| 16S ribosomal RNA methyltransferase [Citrobacter sp. 30_2]
 gi|226908998|gb|EEH94916.1| 16S ribosomal RNA methyltransferase [Citrobacter sp. 30_2]
          Length = 343

 Score = 36.6 bits (83), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 57/129 (44%), Gaps = 27/129 (20%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           D+G GAG   +A+AS   + ++ L + S      +R TLA  AN         IE DV  
Sbjct: 202 DVGCGAGVLSVALASHSPKVRLTLCDVSAAAVEASRATLA--ANG--------IEGDVIA 251

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMR 136
                ++ G     +D +I NPPF++ + T               D+ +  IR A   + 
Sbjct: 252 SNVFSDVTGR----FDMIISNPPFHDGMQTSL-------------DAAQTLIRGAVRHLN 294

Query: 137 SSGQLSLIA 145
           S G+L ++A
Sbjct: 295 SGGELRIVA 303


>gi|194705956|gb|ACF87062.1| unknown [Zea mays]
 gi|195638364|gb|ACG38650.1| S-adenosylmethionine-dependent methyltransferase [Zea mays]
          Length = 211

 Score = 36.6 bits (83), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 46/100 (46%), Gaps = 16/100 (16%)

Query: 5   SLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLA-ERSPLMAHYARKTLALPANAQI 63
           S  + TG   +AD G G G   LAVAS L +A+ +L  +  P     A++  A       
Sbjct: 43  SFNDITGKV-VADFGCGCGT--LAVASALLDAEHVLGIDIDPQSLELAQENAAD------ 93

Query: 64  SKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNER 103
                 +E+D+ LV  +     LK    D V+MNPPF  R
Sbjct: 94  ------LELDIDLVWSDIKNLNLKGVHVDTVVMNPPFGTR 127


>gi|289765141|ref|ZP_06524519.1| methyltransferase [Fusobacterium sp. D11]
 gi|289716696|gb|EFD80708.1| methyltransferase [Fusobacterium sp. D11]
          Length = 142

 Score = 36.6 bits (83), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 27/121 (22%), Positives = 57/121 (47%), Gaps = 4/121 (3%)

Query: 90  FYDHVIMNPPF---NERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIAR 146
           F+D ++ NPPF   N  I  +   K    A   +E + E+ I+ +  +++  G   L+ R
Sbjct: 12  FFDIIVSNPPFFKVNRDINFLNNLKQLSIARHEIEITLEELIKISSELIKDRGYFYLVHR 71

Query: 147 PQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNG 205
              L +I+    + + G+ +I   +  + + A  +L+   K  +  L     ++++K NG
Sbjct: 72  ADRLSEILCILEKYKFGAKKIKFCYTTKYKNAKIVLIEAIKNGKTGLTILPSLIINKENG 131

Query: 206 Q 206
           +
Sbjct: 132 E 132


>gi|270284379|ref|ZP_05966016.2| protein-(glutamine-N5) methyltransferase [Bifidobacterium gallicum
           DSM 20093]
 gi|270276760|gb|EFA22614.1| protein-(glutamine-N5) methyltransferase [Bifidobacterium gallicum
           DSM 20093]
          Length = 365

 Score = 36.6 bits (83), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 44/94 (46%), Gaps = 12/94 (12%)

Query: 12  SFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTL-----ALPANAQISKR 66
           S  + DL AG+GA GL+VA+ + ++ +   E     A + R+ L      +P    ++ R
Sbjct: 187 SPRVVDLCAGSGAIGLSVATEVPDSCVWAVEMDATAASWTRRNLDRVGATMP---DLASR 243

Query: 67  ISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF 100
             L+  D T       LA L     D VI NPP+
Sbjct: 244 YRLMRADATC---ELTLADLDGTV-DVVISNPPY 273


>gi|212275358|ref|NP_001130238.1| hypothetical protein LOC100191332 [Zea mays]
 gi|194688642|gb|ACF78405.1| unknown [Zea mays]
          Length = 176

 Score = 36.6 bits (83), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 46/100 (46%), Gaps = 16/100 (16%)

Query: 5   SLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLA-ERSPLMAHYARKTLALPANAQI 63
           S  + TG   +AD G G G   LAVAS L +A+ +L  +  P     A++  A       
Sbjct: 8   SFNDITGKV-VADFGCGCGT--LAVASALLDAEHVLGIDIDPQSLELAQENAAD------ 58

Query: 64  SKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNER 103
                 +E+D+ LV  +     LK    D V+MNPPF  R
Sbjct: 59  ------LELDIDLVWSDIKNLNLKGVHVDTVVMNPPFGTR 92


>gi|221199978|ref|ZP_03573021.1| RNA methyltransferase, RsmD family [Burkholderia multivorans CGD2M]
 gi|221206867|ref|ZP_03579879.1| RNA methyltransferase, RsmD family [Burkholderia multivorans CGD2]
 gi|221173522|gb|EEE05957.1| RNA methyltransferase, RsmD family [Burkholderia multivorans CGD2]
 gi|221180217|gb|EEE12621.1| RNA methyltransferase, RsmD family [Burkholderia multivorans CGD2M]
          Length = 204

 Score = 36.6 bits (83), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 38/86 (44%), Gaps = 10/86 (11%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DL AG GA G   ASR   A +++ ER P  A   R          I  ++    V++  
Sbjct: 67  DLFAGTGALGFEAASR-GAANVVMVERHPRAAQQLRA---------IKDKLGARTVEIAE 116

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNE 102
               R  AGL    +D V ++PPF +
Sbjct: 117 ADALRLAAGLAPRSFDVVFLDPPFGD 142


>gi|301770295|ref|XP_002920605.1| PREDICTED: hemK methyltransferase family member 1-like [Ailuropoda
           melanoleuca]
          Length = 358

 Score = 36.6 bits (83), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 48/94 (51%), Gaps = 5/94 (5%)

Query: 7   VNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKR 66
           + A G   + ++G G+GA  L++ S+L +++++  ++        ++        Q+  R
Sbjct: 155 MGAQGGPLILEVGCGSGAIALSLLSQLPQSRVIAVDKGEAAICLTQENA---QRLQLLDR 211

Query: 67  ISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF 100
           I ++ +DVTL G   +L  L     D V+ NPP+
Sbjct: 212 IQIVPLDVTLEGSWAHL--LTWGPMDLVVSNPPY 243


>gi|295398609|ref|ZP_06808640.1| O-methyltransferase [Aerococcus viridans ATCC 11563]
 gi|294973149|gb|EFG48945.1| O-methyltransferase [Aerococcus viridans ATCC 11563]
          Length = 252

 Score = 36.6 bits (83), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 38/181 (20%), Positives = 88/181 (48%), Gaps = 24/181 (13%)

Query: 17  DLGAGAGAAGLAVASRLHE-AQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVT 75
           D  +G G   L ++++  +  QI   E  P +A  A++++A   +  ++ +I++ ++D+ 
Sbjct: 54  DFCSGNGVIPLLLSAKTSDKTQIHGIEIQPQVADMAKRSMA---HNDLADKITVHQMDLK 110

Query: 76  LVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKI------KEEAHVMLEDSFEKWIR 129
            V ++      K +  D V  NPP+ ++      + +      + E  +  +D F++   
Sbjct: 111 SVRDH-----FKKDSVDVVTCNPPYFKKYDESKVNLLDAKTLARHEVAMTAKDIFQQ--- 162

Query: 130 TACAIMRSSGQLSLIARPQSLIQIV---NACARRIGSLEITPLHPREGECASRILVTGRK 186
            A  ++R+ G+L ++ RP+ L +++   N     +  L+   ++P+ G+ A  IL+   K
Sbjct: 163 -AQFVLRNRGKLYIVHRPERLSELIVLGNQYHLTLKRLQF--IYPKPGKEAKTILLEFMK 219

Query: 187 G 187
            
Sbjct: 220 D 220


>gi|256027162|ref|ZP_05440996.1| methyltransferase [Fusobacterium sp. D11]
          Length = 148

 Score = 36.6 bits (83), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 27/121 (22%), Positives = 57/121 (47%), Gaps = 4/121 (3%)

Query: 90  FYDHVIMNPPF---NERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIAR 146
           F+D ++ NPPF   N  I  +   K    A   +E + E+ I+ +  +++  G   L+ R
Sbjct: 18  FFDIIVSNPPFFKVNRDINFLNNLKQLSIARHEIEITLEELIKISSELIKDRGYFYLVHR 77

Query: 147 PQSLIQIVNACAR-RIGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVLHKPNG 205
              L +I+    + + G+ +I   +  + + A  +L+   K  +  L     ++++K NG
Sbjct: 78  ADRLSEILCILEKYKFGAKKIKFCYTTKYKNAKIVLIEAIKNGKTGLTILPSLIINKENG 137

Query: 206 Q 206
           +
Sbjct: 138 E 138


>gi|63109084|gb|AAY33698.1| SbfI modification methyltransferase [Streptomyces sp. Bf-61]
          Length = 486

 Score = 36.6 bits (83), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 41/98 (41%), Gaps = 12/98 (12%)

Query: 11  GSFHLADLGAGAGAAGLAVASRLHE------AQILLAERSPLMAHYARKTLALPANAQIS 64
           G+  + D GAG G+   A+  RLH         ++  E  P +  Y R TL    NA   
Sbjct: 50  GTVRVLDPGAGVGSLTAALVDRLHTERPDVAVHVVAVETDPFVVPYLRATLEECRNA-YG 108

Query: 65  KRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNE 102
               L+E D  L     N     +  +D VI NPP+ +
Sbjct: 109 ISYDLVEGDYLL-----NQGAKLDGPFDLVIANPPYGK 141


>gi|255326262|ref|ZP_05367348.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Rothia mucilaginosa ATCC 25296]
 gi|255296716|gb|EET76047.1| protein-(glutamine-N5) methyltransferase, release factor-specific
           [Rothia mucilaginosa ATCC 25296]
          Length = 302

 Score = 36.6 bits (83), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 47/101 (46%), Gaps = 16/101 (15%)

Query: 2   ILASLVN-ATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60
           +LA   N ATG   + DL  G+GA   A+ S L  AQ+   E S     Y RK L     
Sbjct: 118 VLAPRTNSATGQLRIVDLCTGSGAIAAAIKSELPNAQVFAVELSEDAIPYTRKNLE---- 173

Query: 61  AQISKRISLIEVD-VTLVGENRNLAGLKNNFYDHVIMNPPF 100
                 + L++ D +T + E   LAG     +D V+ NPP+
Sbjct: 174 ---PLGVHLVQGDALTALPE---LAGT----FDAVLSNPPY 204


>gi|152978607|ref|YP_001344236.1| 16S ribosomal RNA m2G1207 methyltransferase [Actinobacillus
           succinogenes 130Z]
 gi|226712985|sp|A6VMV4|RSMC_ACTSZ RecName: Full=Ribosomal RNA small subunit methyltransferase C;
           AltName: Full=16S rRNA m2G1207 methyltransferase;
           AltName: Full=rRNA (guanine-N(2)-)-methyltransferase
           rsmC
 gi|150840330|gb|ABR74301.1| rRNA (guanine-N(2)-)-methyltransferase [Actinobacillus succinogenes
           130Z]
          Length = 333

 Score = 36.6 bits (83), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 58/124 (46%), Gaps = 17/124 (13%)

Query: 2   ILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANA 61
           +L S +N      + DLG GAG  G  V  +  +A+++L +   +    A +TL   A  
Sbjct: 184 LLLSTINTHIRGDVLDLGCGAGVLGAYVKQQNPQARVMLTDIHAMALASAERTL---AEN 240

Query: 62  QISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGT---MTPDKIKEEAHV 118
           +++ ++   +V   + G+           +D +I NPPF++ IGT      + IKE    
Sbjct: 241 RLAGKVLASDVFSHIQGK-----------FDLIISNPPFHDGIGTAYRAVSELIKEARWR 289

Query: 119 MLED 122
           + ED
Sbjct: 290 LKED 293


>gi|121997790|ref|YP_001002577.1| HemK family modification methylase [Halorhodospira halophila SL1]
 gi|121589195|gb|ABM61775.1| [protein release factor]-glutamine N5-methyltransferase
           [Halorhodospira halophila SL1]
          Length = 281

 Score = 36.6 bits (83), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 40/84 (47%), Gaps = 12/84 (14%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           +LG G+GA  LAVA    +A+I   ERS         T AL    +   R+ L EV +T 
Sbjct: 120 ELGTGSGAIALAVAHERPDARITATERS---------TAALAVAQENRHRLGLSEVHLTP 170

Query: 77  VGENRNLAGLKNNFYDHVIMNPPF 100
              N    G+    +D ++ NPP+
Sbjct: 171 GDWNE---GIPPGPFDVIVSNPPY 191


>gi|270263189|ref|ZP_06191459.1| hypothetical protein SOD_d02060 [Serratia odorifera 4Rx13]
 gi|270042877|gb|EFA15971.1| hypothetical protein SOD_d02060 [Serratia odorifera 4Rx13]
          Length = 379

 Score = 36.6 bits (83), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 43/90 (47%), Gaps = 9/90 (10%)

Query: 14  HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVD 73
           H+ DLG G G  GLA   +  +AQ+   + S    + A  +  L     + + +   + +
Sbjct: 232 HIVDLGCGNGVIGLAALVQNPQAQMSFVDES----YMAVASSELNVEHNLPQELDRCQFE 287

Query: 74  VTLVGENRNLAGLKNNFYDHVIMNPPFNER 103
           V     N +LAG++      V+ NPPF+++
Sbjct: 288 V-----NNSLAGIERESVQAVLCNPPFHQQ 312


>gi|195941222|ref|ZP_03086604.1| hypothetical protein EscherichcoliO157_33337 [Escherichia coli
           O157:H7 str. EC4024]
          Length = 336

 Score = 36.6 bits (83), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 45/89 (50%), Gaps = 9/89 (10%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           + DLG G G  GL + ++  EA ++ ++ SP+    +R       N + +   +L   + 
Sbjct: 232 IVDLGCGNGVIGLTLLAKNPEASVVFSDESPMAVASSR------LNVETNMPDALDRCEF 285

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNER 103
            +   N  L+G++   ++ V  NPPF+++
Sbjct: 286 MI---NNALSGVEPFRFNAVFCNPPFHQK 311


>gi|28493401|ref|NP_787562.1| protoporphyrinogen oxidase [Tropheryma whipplei str. Twist]
 gi|28572488|ref|NP_789268.1| peptide chain release factor methyltransferase [Tropheryma whipplei
           TW08/27]
 gi|28410620|emb|CAD67006.1| putative peptide chain release factor methyltransferase [Tropheryma
           whipplei TW08/27]
 gi|28476442|gb|AAO44531.1| protoporphyrinogen oxidase [Tropheryma whipplei str. Twist]
          Length = 285

 Score = 36.6 bits (83), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 40/86 (46%), Gaps = 11/86 (12%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DLG G G   LA+ASR  + + L  ++S     +A K L    N  I K       D T+
Sbjct: 120 DLGTGTGCITLALASRATDIEYLAVDKSNSAIQWAEKNLRHLRNVTIRK------ADFTV 173

Query: 77  VGENRNLAGLKNNF--YDHVIMNPPF 100
              + +L  L + F   D V+ NPP+
Sbjct: 174 ---DSDLLALLSEFGPPDVVVANPPY 196


>gi|170679644|ref|YP_001746740.1| hypothetical protein EcSMS35_4829 [Escherichia coli SMS-3-5]
 gi|170517362|gb|ACB15540.1| conserved hypothetical protein [Escherichia coli SMS-3-5]
          Length = 1640

 Score = 36.6 bits (83), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 45/98 (45%), Gaps = 9/98 (9%)

Query: 67   ISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMT-----PDKIKEE----AH 117
            + L+EV      +++ L+ +KNN+Y  V+ +  F +R GT       P  I +      H
Sbjct: 1212 VQLLEVLRKFDVKSKKLSSIKNNYYSTVMFDETFAQRDGTTKRKTEFPSGISQWILSGPH 1271

Query: 118  VMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVN 155
              + +++ K  RT C +      + L+  P + +  VN
Sbjct: 1272 FFVGNAYYKTPRTLCKLNSDYDSIDLMTIPDNYMPRVN 1309


>gi|290508240|ref|ZP_06547611.1| O-methyltransferase [Klebsiella sp. 1_1_55]
 gi|289777634|gb|EFD85631.1| O-methyltransferase [Klebsiella sp. 1_1_55]
          Length = 245

 Score = 36.6 bits (83), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 46/102 (45%), Gaps = 12/102 (11%)

Query: 1   MILASLVNATGSFHLADLGAGAGAAGLAVASRL-HEAQILLAERSPLMAHYARK-TLALP 58
           ++L +     G  H+ D+GAG+G   L +A R  H+ Q+   E     A  AR+  LA P
Sbjct: 34  ILLGAWAPIAGVKHVLDIGAGSGLLALMLAQRTGHDVQVDAVELDEEAAAQARENALASP 93

Query: 59  ANAQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF 100
                S RI + + D+            +   Y+ +I NPPF
Sbjct: 94  ----WSSRIEICQADI------HQWQPSQTRRYELIISNPPF 125


>gi|223995553|ref|XP_002287450.1| hemk-like sam-dependent methylase protein [Thalassiosira pseudonana
           CCMP1335]
 gi|220976566|gb|EED94893.1| hemk-like sam-dependent methylase protein [Thalassiosira pseudonana
           CCMP1335]
          Length = 294

 Score = 36.6 bits (83), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 48/95 (50%), Gaps = 16/95 (16%)

Query: 9   ATGSFHLADLGAGAGAAGLAVASRL-HEAQILLAERSPLMAHYARKTLALPANAQ--ISK 65
           + G   + D+GAG GA G+A+A +L H  Q+L  +  P     + +      NAQ  +SK
Sbjct: 113 SNGRIRILDVGAGTGAIGIAIAHQLPHHVQVLALDVLPEAVELSNE------NAQQFLSK 166

Query: 66  RISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF 100
              L++ DV  V  ++       NF D V+ NPP+
Sbjct: 167 ---LVDSDVGDVSSSQQYP---MNF-DLVVSNPPY 194


>gi|27467223|ref|NP_763860.1| hypothetical protein SE0305 [Staphylococcus epidermidis ATCC 12228]
 gi|57866133|ref|YP_187778.1| hypothetical protein SERP0182 [Staphylococcus epidermidis RP62A]
 gi|27314766|gb|AAO03902.1|AE016745_1 conserved hypothetical protein [Staphylococcus epidermidis ATCC
           12228]
 gi|57636791|gb|AAW53579.1| conserved hypothetical protein [Staphylococcus epidermidis RP62A]
          Length = 202

 Score = 36.6 bits (83), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 36/153 (23%), Positives = 72/153 (47%), Gaps = 30/153 (19%)

Query: 15  LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74
           +AD+G G G  GLA+       QI + + +        + LAL   A+++K  +  +VD 
Sbjct: 64  IADVGCGYGPIGLAIGKVSPHHQITMLDIN-------NRALAL---AEMNKTKN--QVDN 111

Query: 75  TLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAI 134
             + E+  L+ + +  +D+++ NPP   R G       K+  H + E +F++        
Sbjct: 112 VTIIESDCLSAVNHQCFDYILTNPPI--RAG-------KDIVHRIFEQAFDR-------- 154

Query: 135 MRSSGQLS-LIARPQSLIQIVNACARRIGSLEI 166
           ++++G+L  +I + Q +           G++EI
Sbjct: 155 LKTTGELYVVIQKKQGMPSAKKKIEELFGNVEI 187


>gi|89093217|ref|ZP_01166167.1| Modification methylase HemK [Oceanospirillum sp. MED92]
 gi|89082513|gb|EAR61735.1| Modification methylase HemK [Oceanospirillum sp. MED92]
          Length = 309

 Score = 36.6 bits (83), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 39/84 (46%), Gaps = 11/84 (13%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DL  G+G  G+A A    EA++ LA+ S      A   +      ++++R+  IE D+  
Sbjct: 141 DLCTGSGCIGIACAYAFAEAEVDLADISKDAIDVAHMNI---EKHEMAERVHAIESDL-- 195

Query: 77  VGENRNLAGLKNNFYDHVIMNPPF 100
                    LK   YD ++ NPP+
Sbjct: 196 ------FCNLKGKKYDLIVSNPPY 213


>gi|281338315|gb|EFB13899.1| hypothetical protein PANDA_009308 [Ailuropoda melanoleuca]
          Length = 338

 Score = 36.6 bits (83), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 48/94 (51%), Gaps = 5/94 (5%)

Query: 7   VNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKR 66
           + A G   + ++G G+GA  L++ S+L +++++  ++        ++        Q+  R
Sbjct: 155 MGAQGGPLILEVGCGSGAIALSLLSQLPQSRVIAVDKGEAAICLTQENA---QRLQLLDR 211

Query: 67  ISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF 100
           I ++ +DVTL G   +L  L     D V+ NPP+
Sbjct: 212 IQIVPLDVTLEGSWAHL--LTWGPMDLVVSNPPY 243


>gi|149909422|ref|ZP_01898077.1| 16S RNA G1207 methylase RsmC [Moritella sp. PE36]
 gi|149807532|gb|EDM67481.1| 16S RNA G1207 methylase RsmC [Moritella sp. PE36]
          Length = 344

 Score = 36.6 bits (83), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 58/130 (44%), Gaps = 27/130 (20%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           DLG GAG  G  +A R   +++ + + S L    ++ TLA  AN +++ +  L +V   +
Sbjct: 210 DLGCGAGIIGSYIAKRFPASKVEMTDVSALAVKSSQLTLA--AN-ELAGQAYLSDVYSDI 266

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMR 136
            G+           +D++I NPPF+  + T                S E +++ A   + 
Sbjct: 267 SGK-----------FDYIISNPPFHAGLKTHYA-------------STETFLKEANGYIN 302

Query: 137 SSGQLSLIAR 146
             G L L+A 
Sbjct: 303 PRGHLVLVAN 312


>gi|317010122|gb|ADU80702.1| hypothetical protein HPIN_07590 [Helicobacter pylori India7]
          Length = 238

 Score = 36.6 bits (83), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 41/191 (21%), Positives = 75/191 (39%), Gaps = 17/191 (8%)

Query: 17  DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76
           D+G+G G  GL  A     A + L E+   MA  ++K      NAQ+ +    ++ +  +
Sbjct: 40  DIGSGCGILGLLCARDNPLASVHLVEKDSKMAFCSQKNALKFPNAQVFEG-DFLDFNPPI 98

Query: 77  VGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMR 136
           +             YD ++ NPPF   +G++   KIK  A    E  F   +      ++
Sbjct: 99  L-------------YDAIVCNPPF-YALGSIK-SKIKGHARHQSELDFASLVAKVKKCLK 143

Query: 137 SSGQLSLIARPQSLIQIVNACARRIGSLE-ITPLHPREGECASRILVTGRKGMRGQLRFR 195
             G         SL  ++ +      +LE +  +   + + A  +L   R   +  L+  
Sbjct: 144 PKGYFIFCYEALSLCLVIESLKSVKLTLETLRFVQSFKDKNAHLMLGAARNNSKSALKVL 203

Query: 196 YPIVLHKPNGQ 206
            P++ H    Q
Sbjct: 204 PPLITHNSKNQ 214


>gi|148657852|ref|YP_001278057.1| methyltransferase small [Roseiflexus sp. RS-1]
 gi|148569962|gb|ABQ92107.1| methyltransferase small [Roseiflexus sp. RS-1]
          Length = 198

 Score = 36.6 bits (83), Expect = 2.7,   Method: Comp