RPSBLAST alignment for GI: 255764482 and conserved domain: PRK09328

>gnl|CDD|181780 PRK09328, PRK09328, N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional. Length = 275
 Score = 38.2 bits (90), Expect = 0.002
 Identities = 23/94 (24%), Positives = 38/94 (40%), Gaps = 16/94 (17%)

Query: 8   NATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQIS--K 65
                  + DLG G+GA  LA+A    +A++   + SP     AR+      NA+     
Sbjct: 105 LLKEPLRVLDLGTGSGAIALALAKERPDAEVTAVDISPEALAVARR------NAKHGLGA 158

Query: 66  RISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPP 99
           R+  ++ D            L    +D ++ NPP
Sbjct: 159 RVEFLQGDW--------FEPLPGGRFDLIVSNPP 184