RPSBLAST alignment for GI: 255764482 and conserved domain: COG2813

>gnl|CDD|32642 COG2813, RsmC, 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis]. Length = 300
 Score = 42.6 bits (100), Expect = 9e-05
 Identities = 27/132 (20%), Positives = 51/132 (38%), Gaps = 26/132 (19%)

Query: 14  HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVD 73
            + DLG G G  GL +A +  +A++ L + +      ARK LA        +   +   +
Sbjct: 161 KVLDLGCGYGVLGLVLAKKSPQAKLTLVDVNARAVESARKNLAANG----VENTEVWASN 216

Query: 74  VTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACA 133
           +    E +         +D +I NPPF+                  +    ++ I  A  
Sbjct: 217 LYEPVEGK---------FDLIISNPPFHAGKAV-------------VHSLAQEIIAAAAR 254

Query: 134 IMRSSGQLSLIA 145
            ++  G+L ++A
Sbjct: 255 HLKPGGELWIVA 266