RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|255764482|ref|YP_003065169.2| methyltransferase protein [Candidatus Liberibacter asiaticus str. psy62] (225 letters) >gnl|CDD|129627 TIGR00536, hemK_fam, HemK family putative methylases. The gene hemK from E. coli was found to contribute to heme biosynthesis and originally suggested to be protoporphyrinogen oxidase (Medline 95189105). Functional analysis of the nearest homolog in Saccharomyces cerevisiae, YNL063w, finds it is not protoporphyrinogen oxidase and sequence analysis suggests that HemK homologs have S-adenosyl-methionine-dependent methyltransferase activity (Medline 99237242). Homologs are found, usually in a single copy, in nearly all completed genomes, but varying somewhat in apparent domain architecture. Both E. coli and H. influenzae have two members rather than one. The members from the Mycoplasmas have an additional C-terminal domain. Length = 284 Score = 39.3 bits (92), Expect = 8e-04 Identities = 34/122 (27%), Positives = 57/122 (46%), Gaps = 18/122 (14%) Query: 3 LASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANA- 61 LASL++ H+ DLG G+G LA+A A+++ + SP A + NA Sbjct: 106 LASLISQNPILHILDLGTGSGCIALALAYEFPNAEVIAVDISPDALAVAEE------NAE 159 Query: 62 --QISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF-NERIGTMTPDKIKEEAHV 118 Q+ R+ I+ ++ LAG K D ++ NPP+ +E P+ ++ E + Sbjct: 160 KNQLEHRVEFIQSNLF-----EPLAGQK---IDIIVSNPPYIDEEDLADLPNVVRFEPLL 211 Query: 119 ML 120 L Sbjct: 212 AL 213 >gnl|CDD|181780 PRK09328, PRK09328, N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional. Length = 275 Score = 38.2 bits (90), Expect = 0.002 Identities = 23/94 (24%), Positives = 38/94 (40%), Gaps = 16/94 (17%) Query: 8 NATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQIS--K 65 + DLG G+GA LA+A +A++ + SP AR+ NA+ Sbjct: 105 LLKEPLRVLDLGTGSGAIALALAKERPDAEVTAVDISPEALAVARR------NAKHGLGA 158 Query: 66 RISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPP 99 R+ ++ D L +D ++ NPP Sbjct: 159 RVEFLQGDW--------FEPLPGGRFDLIVSNPP 184 >gnl|CDD|163311 TIGR03534, RF_mod_PrmC, protein-(glutamine-N5) methyltransferase, release factor-specific. Members of this protein family are HemK (PrmC), a protein once thought to be involved in heme biosynthesis but now recognized to be a protein-glutamine methyltransferase that modifies the peptide chain release factors. All members of the seed alignment are encoded next to the release factor 1 gene (prfA) and confirmed by phylogenetic analysis. SIMBAL analysis (manuscript in prep.) shows the motif [LIV]PRx[DE]TE (in Escherichia coli, IPRPDTE) confers specificity for the release factors rather than for ribosomal protein L3. Length = 251 Score = 37.1 bits (87), Expect = 0.004 Identities = 34/142 (23%), Positives = 56/142 (39%), Gaps = 26/142 (18%) Query: 11 GSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQIS--KRIS 68 G + DLG G+GA LA+A +A++ + SP ARK NA ++ Sbjct: 87 GPLRVLDLGTGSGAIALALAKERPDARVTAVDISPEALAVARK------NAARLGLDNVT 140 Query: 69 LIEVDVTLVGENRNLAGLKNNFYDHVIMNPP---FNERIGTMTPDKIKEEAHVML---ED 122 ++ D L +D ++ NPP + I + P+ E + L ED Sbjct: 141 FLQSDW--------FEPLPGGKFDLIVSNPPYIPEAD-IHLLDPEVRFHEPRLALFGGED 191 Query: 123 SF---EKWIRTACAIMRSSGQL 141 + I A +++ G L Sbjct: 192 GLDFYRRIIAQAPRLLKPGGWL 213 >gnl|CDD|184963 PRK15001, PRK15001, SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional. Length = 378 Score = 34.2 bits (78), Expect = 0.027 Identities = 21/89 (23%), Positives = 44/89 (49%), Gaps = 9/89 (10%) Query: 15 LADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDV 74 + DLG G G GL + + +A+++ + SP+ +R L + + + E + Sbjct: 232 IVDLGCGNGVIGLTLLDKNPQAKVVFVDESPMAVASSR----LNVETNMPEALDRCEFMI 287 Query: 75 TLVGENRNLAGLKNNFYDHVIMNPPFNER 103 N L+G++ ++ V+ NPPF+++ Sbjct: 288 -----NNALSGVEPFRFNAVLCNPPFHQQ 311 >gnl|CDD|149354 pfam08242, Methyltransf_12, Methyltransferase domain. Members of this family are SAM dependent methyltransferases. Length = 98 Score = 32.0 bits (73), Expect = 0.12 Identities = 16/81 (19%), Positives = 28/81 (34%), Gaps = 10/81 (12%) Query: 17 DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTL 76 D+G G G A+ L + + SP A + LA A + +DV Sbjct: 2 DIGCGTGTLLRALLEALPGLEYTGVDISPAALEAAAERLA----ALGLLDAVRVRLDVLD 57 Query: 77 VGENRNLAGLKNNFYDHVIMN 97 + + +D V+ + Sbjct: 58 AIDLDPGS------FDVVVAS 72 >gnl|CDD|181902 PRK09489, rsmC, 16S ribosomal RNA m2G1207 methyltransferase; Provisional. Length = 342 Score = 31.8 bits (73), Expect = 0.14 Identities = 24/100 (24%), Positives = 40/100 (40%), Gaps = 28/100 (28%) Query: 14 HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVD 73 + D+G GAG +A + ++ L++ S +R TLA AN +E + Sbjct: 199 KVLDVGCGAGVLSAVLARHSPKIRLTLSDVSAAALESSRATLA--ANG--------LEGE 248 Query: 74 VTLVGENRNLAGLKNNFYDHV-------IMNPPFNERIGT 106 V +N + + I NPPF++ I T Sbjct: 249 V-----------FASNVFSDIKGRFDMIISNPPFHDGIQT 277 >gnl|CDD|128898 smart00650, rADc, Ribosomal RNA adenine dimethylases. Length = 169 Score = 30.6 bits (70), Expect = 0.32 Identities = 23/124 (18%), Positives = 45/124 (36%), Gaps = 30/124 (24%) Query: 54 TLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNF----------------YDHVIMN 97 T L + + R++ IE+D L R +N V+ N Sbjct: 28 TEEL---LERAARVTAIEIDPRLAPRLREKFAAADNLTVIHGDALKFDLPKLQPYKVVGN 84 Query: 98 PPFNERIGT------MTPDKIKEEAHVMLEDSF-EKWIRTACAIMRSSGQLSLIARPQSL 150 P+N I T + +A +M++ + A + G+LS++ +P Sbjct: 85 LPYN--ISTPILFKLLEEPPAFRDAVLMVQKEVARR--LAAKPGSKDYGRLSVLLQPYFD 140 Query: 151 IQIV 154 ++I+ Sbjct: 141 VKIL 144 >gnl|CDD|150895 pfam10294, Methyltransf_16, Putative methyltransferase. Length = 171 Score = 30.4 bits (69), Expect = 0.44 Identities = 17/79 (21%), Positives = 28/79 (35%), Gaps = 6/79 (7%) Query: 18 LGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLV 77 LG+G G G+AVA L A + + + +K + L S + V Sbjct: 51 LGSGCGLVGIAVALLLPGASVTITDLEE-AIELMKKNIELNKALS-----SKVTAKVLDW 104 Query: 78 GENRNLAGLKNNFYDHVIM 96 GE + D ++ Sbjct: 105 GEELPDDVFDPHPVDLILA 123 >gnl|CDD|163310 TIGR03533, L3_gln_methyl, protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific. Members of this protein family methylate ribosomal protein L3 on a glutamine side chain. This family is related to HemK, a protein-glutamine methyltranferase for peptide chain release factors. Length = 284 Score = 29.8 bits (68), Expect = 0.56 Identities = 23/87 (26%), Positives = 38/87 (43%), Gaps = 11/87 (12%) Query: 14 HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVD 73 + DL G+G +A A EA++ + SP A + + R++LI+ D Sbjct: 124 RILDLCTGSGCIAIACAYAFPEAEVDAVDISPDALAVAEINI---ERHGLEDRVTLIQSD 180 Query: 74 VTLVGENRNLAGLKNNFYDHVIMNPPF 100 + L G K YD ++ NPP+ Sbjct: 181 LF-----AALPGRK---YDLIVSNPPY 199 >gnl|CDD|177639 PHA03411, PHA03411, putative methyltransferase; Provisional. Length = 279 Score = 28.9 bits (64), Expect = 1.1 Identities = 26/104 (25%), Positives = 40/104 (38%), Gaps = 17/104 (16%) Query: 7 VNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKR 66 ++A + + DL AG G + R +I+ E +P A ++ L P I+ Sbjct: 60 IDAHCTGKVLDLCAGIGRLSFCMLHRCKPEKIVCVELNPEFARIGKRLL--PEAEWITSD 117 Query: 67 ISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPD 110 + E N +D VI NPPF + T T D Sbjct: 118 VFEFE---------------SNEKFDVVISNPPFGKINTTDTKD 146 >gnl|CDD|184930 PRK14966, PRK14966, unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional. Length = 423 Score = 28.5 bits (63), Expect = 1.4 Identities = 25/87 (28%), Positives = 40/87 (45%), Gaps = 13/87 (14%) Query: 17 DLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLA-LPANAQISKRISLIEVDVT 75 DLG G+GA + VA +A + ++ SP ARK A L A + + S + D+ Sbjct: 257 DLGTGSGAVAVTVALERPDAFVRASDISPPALETARKNAADLGARVEFAHG-SWFDTDMP 315 Query: 76 LVGENRNLAGLKNNFYDHVIMNPPFNE 102 G+ +D ++ NPP+ E Sbjct: 316 SEGK-----------WDIIVSNPPYIE 331 >gnl|CDD|139246 PRK12814, PRK12814, putative NADPH-dependent glutamate synthase small subunit; Provisional. Length = 652 Score = 28.5 bits (64), Expect = 1.6 Identities = 23/88 (26%), Positives = 30/88 (34%), Gaps = 26/88 (29%) Query: 21 GAGAAGLAVASRL----HEAQILLAERSP-LMAHYARKTLALPANAQISKRISLIEVDV- 74 GAG AGL A L H+ I A M Y LP S+I+ D+ Sbjct: 200 GAGPAGLTAAYYLLRKGHDVTIFDANEQAGGMMRYGIPRFRLPE--------SVIDADIA 251 Query: 75 ------------TLVGENRNLAGLKNNF 90 T+ G + L L+ F Sbjct: 252 PLRAMGAEFRFNTVFGRDITLEELQKEF 279 >gnl|CDD|180899 PRK07233, PRK07233, hypothetical protein; Provisional. Length = 434 Score = 28.3 bits (64), Expect = 1.8 Identities = 14/38 (36%), Positives = 16/38 (42%), Gaps = 10/38 (26%) Query: 21 GAGAAGLAVASRL----HEAQILLAERSP----LMAHY 50 G G AGLA A RL HE + E L A + Sbjct: 6 GGGIAGLAAAYRLAKRGHEVTVF--EADDQLGGLAASF 41 >gnl|CDD|163170 TIGR03169, Nterm_to_SelD, pyridine nucleotide-disulfide oxidoreductase family protein. Members of this protein family include N-terminal sequence regions of (probable) bifunctional proteins whose C-terminal sequences are SelD, or selenide,water dikinase, the selenium donor protein necessary for selenium incorporation into protein (as selenocysteine), tRNA (as 2-selenouridine), or both. However, some members of this family occur in species that do not show selenium incorporation, and the function of this protein family is unknown. Length = 364 Score = 28.0 bits (63), Expect = 2.1 Identities = 16/61 (26%), Positives = 24/61 (39%), Gaps = 10/61 (16%) Query: 2 ILASLVNATGSFHLADLGAGAGAAGLAVASRLHEA--------QILLAERSPLMAHYARK 53 +L S G+ LA G GAAG+ +A L Q+ L + L+ + K Sbjct: 135 LLESADAPPGTKRLA--VVGGGAAGVEIALALRRRLPKRGLRGQVTLIAGASLLPGFPAK 192 Query: 54 T 54 Sbjct: 193 V 193 >gnl|CDD|179629 PRK03673, PRK03673, hypothetical protein; Provisional. Length = 396 Score = 27.7 bits (62), Expect = 2.4 Identities = 19/52 (36%), Positives = 24/52 (46%), Gaps = 5/52 (9%) Query: 17 DLGAGAGAAGLAVASRLHEAQI-----LLAERSPLMAHYARKTLALPANAQI 63 DL A A A LHE + AER +MA RK LPA+A++ Sbjct: 76 DLSALAAATAAGEGLVLHEEWLAEMERFFAERGRVMAPSNRKQAELPASAEM 127 >gnl|CDD|181354 PRK08287, PRK08287, cobalt-precorrin-6Y C(15)-methyltransferase; Validated. Length = 187 Score = 27.7 bits (62), Expect = 2.6 Identities = 13/41 (31%), Positives = 21/41 (51%) Query: 5 SLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSP 45 S + + HL D+GAG G+ + A + Q+ ER+P Sbjct: 25 SKLELHRAKHLIDVGAGTGSVSIEAALQFPSLQVTAIERNP 65 >gnl|CDD|162642 TIGR01988, Ubi-OHases, Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family. This model represents a family of FAD-dependent hydroxylases (monooxygenases) which are all believed to act in the aerobic ubiquinone biosynthesis pathway. A separate set of hydroxylases, as yet undiscovered, are believed to be active under anaerobic conditions. In E. coli three enzyme activities have been described, UbiB (which acts first at position 6, see TIGR01982), UbiH (which acts at position 4, ) and UbiF (which acts at position 5). UbiH and UbiF are similar to one another and form the basis of this subfamily. Interestingly, E. coli contains another hydroxylase gene, called visC, that is highly similar to UbiF, adjacent to UbiH and, when mutated, results in a phenotype similar to that of UbiH (which has also been named visB). Several other species appear to have three homologs in this family, although they assort themselves differently on phylogenetic trees (e.g. Xylella and Mesorhizobium) making it difficult to ascribe a specific activity to each one. Eukaryotes appear to have only a single homolog in this subfamily (COQ6) which complements UbiH, but also possess a non-orthologous gene, COQ7 which complements UbiF. Length = 385 Score = 27.6 bits (62), Expect = 2.6 Identities = 15/55 (27%), Positives = 25/55 (45%), Gaps = 7/55 (12%) Query: 20 AGAGAAGLAVASRL--HEAQILLAERSPLMAHYA----RKTLAL-PANAQISKRI 67 G G GLA+A L +I L E +P A + AL A+ ++ +++ Sbjct: 5 VGGGMVGLALALALARSGLKIALIEATPAEAAATPGFDNRVSALSAASIRLLEKL 59 >gnl|CDD|181663 PRK09126, PRK09126, hypothetical protein; Provisional. Length = 392 Score = 27.2 bits (61), Expect = 3.3 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 8/41 (19%) Query: 21 GAGAAGLAVASRLHEAQ--ILLAERSPLMAHYARKTLALPA 59 GAG AGL+ A L + + L ER PL LA PA Sbjct: 10 GAGPAGLSFARSLAGSGLKVTLIERQPL------AALADPA 44 >gnl|CDD|136070 PRK06823, PRK06823, ornithine cyclodeaminase; Validated. Length = 315 Score = 26.7 bits (59), Expect = 4.6 Identities = 11/32 (34%), Positives = 15/32 (46%) Query: 25 AGLAVASRLHEAQILLAERSPLMAHYARKTLA 56 AGL L E + LA+ P + + TLA Sbjct: 262 AGLLAHHNLTELGLALAQGIPFRENDQQITLA 293 >gnl|CDD|183358 PRK11883, PRK11883, protoporphyrinogen oxidase; Reviewed. Length = 451 Score = 26.7 bits (60), Expect = 4.8 Identities = 13/29 (44%), Positives = 15/29 (51%), Gaps = 4/29 (13%) Query: 21 GAGAAGLAVASRLHE----AQILLAERSP 45 G G GL+ A RLH+ A I L E S Sbjct: 7 GGGITGLSAAYRLHKKGPDADITLLEASD 35 >gnl|CDD|114555 pfam05834, Lycopene_cycl, Lycopene cyclase protein. This family consists of lycopene beta and epsilon cyclase proteins. Carotenoids with cyclic end groups are essential components of the photosynthetic membranes in all plants, algae, and cyanobacteria. These lipid-soluble compounds protect against photo-oxidation, harvest light for photosynthesis, and dissipate excess light energy absorbed by the antenna pigments. The cyclisation of lycopene (psi, psi-carotene) is a key branch point in the pathway of carotenoid biosynthesis. Two types of cyclic end groups are found in higher plant carotenoids: the beta and epsilon rings. Carotenoids with two beta rings are ubiquitous, and those with one beta and one epsilon ring are common; however, carotenoids with two epsilon rings are rare. Length = 374 Score = 26.5 bits (59), Expect = 5.6 Identities = 13/30 (43%), Positives = 18/30 (60%), Gaps = 4/30 (13%) Query: 20 AGAGAAGLAVASRLHEAQ----ILLAERSP 45 GAG AGL +A RL +A+ +LL + P Sbjct: 5 VGAGLAGLLLALRLRQARPGLRVLLIDAGP 34 >gnl|CDD|185348 PRK15451, PRK15451, tRNA cmo(5)U34 methyltransferase; Provisional. Length = 247 Score = 26.5 bits (58), Expect = 6.2 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Query: 17 DLGAGAGAAGLAVASRLHEA--QILLAERSPLMAHYARK 53 DLG GAA L+V +H +I+ + SP M R+ Sbjct: 62 DLGCSLGAATLSVRRNIHHDNCKIIAIDNSPAMIERCRR 100 >gnl|CDD|183320 PRK11805, PRK11805, N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional. Length = 307 Score = 26.3 bits (59), Expect = 6.3 Identities = 23/98 (23%), Positives = 39/98 (39%), Gaps = 11/98 (11%) Query: 3 LASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQ 62 A + + DL G+G +A A +A++ + SP A + Sbjct: 125 FAPWLEDPPVTRILDLCTGSGCIAIACAYAFPDAEVDAVDISPDALAVAEINIE---RHG 181 Query: 63 ISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPF 100 + R++LIE D+ A L YD ++ NPP+ Sbjct: 182 LEDRVTLIESDL--------FAALPGRRYDLIVSNPPY 211 >gnl|CDD|180546 PRK06370, PRK06370, mercuric reductase; Validated. Length = 463 Score = 26.3 bits (59), Expect = 7.2 Identities = 11/28 (39%), Positives = 15/28 (53%), Gaps = 2/28 (7%) Query: 21 GAGAAGLAVASRLHEA--QILLAERSPL 46 GAG AG +A+R ++ L ER L Sbjct: 12 GAGQAGPPLAARAAGLGMKVALIERGLL 39 >gnl|CDD|185595 PTZ00396, PTZ00396, Casein kinase II subunit beta; Provisional. Length = 251 Score = 26.1 bits (58), Expect = 8.1 Identities = 11/29 (37%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Query: 69 LIEVDVTLVGENRNLAGLKN--NFYDHVI 95 L EVD + + NL GLK+ FY+ + Sbjct: 36 LCEVDEDFIRDEFNLYGLKSKFPFYNEAL 64 >gnl|CDD|183826 PRK12904, PRK12904, preprotein translocase subunit SecA; Reviewed. Length = 830 Score = 25.8 bits (58), Expect = 8.3 Identities = 13/58 (22%), Positives = 19/58 (32%), Gaps = 13/58 (22%) Query: 88 NNF--------YDHVIMNPP----FNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACA 133 NF YD V MN + +R + + + E M ED E + Sbjct: 619 RNFDIRKQLLEYDDV-MNDQRKVIYAQRNEILEGEDLSETILDMREDVIEDLVDAYIP 675 >gnl|CDD|184644 PRK14357, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional. Length = 448 Score = 25.9 bits (57), Expect = 8.4 Identities = 10/29 (34%), Positives = 17/29 (58%) Query: 187 GMRGQLRFRYPIVLHKPNGQPYSRFVTDL 215 G +++ + P VLHK +G+P +V D Sbjct: 9 GKGTRMKSKIPKVLHKISGKPMINWVIDT 37 >gnl|CDD|182113 PRK09853, PRK09853, putative selenate reductase subunit YgfK; Provisional. Length = 1019 Score = 26.1 bits (58), Expect = 8.4 Identities = 23/88 (26%), Positives = 35/88 (39%), Gaps = 18/88 (20%) Query: 21 GAGAAGLAVASRL----HEAQILLAERSP--LMAHYA---RKTLALPANAQISKRISLIE 71 GAG AGLA A L H + E + ++ + R +PA I I ++ Sbjct: 546 GAGPAGLAAAYFLARAGHPVTVFEREENAGGVVKNIIPQFR----IPAEL-IQHDIEFVK 600 Query: 72 ---VDVTL-VGENRNLAGLKNNFYDHVI 95 V + + LKN YD+V+ Sbjct: 601 AHGVKFEFGCSPDLTVEQLKNEGYDYVV 628 >gnl|CDD|183312 PRK11783, rlmL, 23S rRNA m(2)G2445 methyltransferase; Provisional. Length = 702 Score = 25.9 bits (58), Expect = 9.7 Identities = 8/15 (53%), Positives = 10/15 (66%) Query: 94 VIMNPPFNERIGTMT 108 VI NPP+ ER+G Sbjct: 307 VISNPPYGERLGEEP 321 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.322 0.136 0.392 Gapped Lambda K H 0.267 0.0650 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 3,723,387 Number of extensions: 239198 Number of successful extensions: 627 Number of sequences better than 10.0: 1 Number of HSP's gapped: 624 Number of HSP's successfully gapped: 46 Length of query: 225 Length of database: 5,994,473 Length adjustment: 90 Effective length of query: 135 Effective length of database: 4,049,753 Effective search space: 546716655 Effective search space used: 546716655 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 55 (25.1 bits)