BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|255764482|ref|YP_003065169.2| methyltransferase protein [Candidatus Liberibacter asiaticus str. psy62] (225 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|255764482|ref|YP_003065169.2| methyltransferase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 225 Score = 461 bits (1187), Expect = e-132, Method: Compositional matrix adjust. Identities = 225/225 (100%), Positives = 225/225 (100%) Query: 1 MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60 MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN Sbjct: 1 MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN 60 Query: 61 AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120 AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML Sbjct: 61 AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML 120 Query: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI 180 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI Sbjct: 121 EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI 180 Query: 181 LVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSLTRL 225 LVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSLTRL Sbjct: 181 LVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSLTRL 225 >gi|254780395|ref|YP_003064808.1| organic solvent tolerance protein [Candidatus Liberibacter asiaticus str. psy62] Length = 762 Score = 25.4 bits (54), Expect = 0.82, Method: Composition-based stats. Identities = 10/17 (58%), Positives = 12/17 (70%) Query: 98 PPFNERIGTMTPDKIKE 114 PP NE+ T TP KIK+ Sbjct: 27 PPSNEQTTTSTPSKIKK 43 >gi|254780402|ref|YP_003064815.1| 3-deoxy-D-manno-octulosonic-acid transferase [Candidatus Liberibacter asiaticus str. psy62] Length = 440 Score = 23.5 bits (49), Expect = 3.4, Method: Compositional matrix adjust. Identities = 14/44 (31%), Positives = 18/44 (40%) Query: 13 FHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLA 56 FH + +G GL A R +LL + A ARK L Sbjct: 61 FHASSVGETMALIGLIPAIRSRHVNVLLTTMTATSAKVARKYLG 104 >gi|255764501|ref|YP_003064973.2| thiamine transporter membrane protein [Candidatus Liberibacter asiaticus str. psy62] Length = 535 Score = 23.1 bits (48), Expect = 4.7, Method: Compositional matrix adjust. Identities = 12/34 (35%), Positives = 14/34 (41%) Query: 82 NLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEE 115 NL G+K HV N P R+ D I E Sbjct: 135 NLYGIKGILLVHVFFNMPLAIRMLLQALDSISIE 168 >gi|254781017|ref|YP_003065430.1| GHMP kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 324 Score = 22.3 bits (46), Expect = 7.5, Method: Compositional matrix adjust. Identities = 11/31 (35%), Positives = 16/31 (51%) Query: 141 LSLIARPQSLIQIVNACARRIGSLEITPLHP 171 L L R LI I ++ + GSL++ HP Sbjct: 41 LYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71 >gi|254780545|ref|YP_003064958.1| metalloprotease [Candidatus Liberibacter asiaticus str. psy62] Length = 647 Score = 21.9 bits (45), Expect = 8.4, Method: Compositional matrix adjust. Identities = 12/40 (30%), Positives = 21/40 (52%) Query: 161 IGSLEITPLHPREGECASRILVTGRKGMRGQLRFRYPIVL 200 +GS + L ++ E +SR + G G+ L +P+VL Sbjct: 68 VGSKLLDKLQSKDIEISSRPVNDGSPGLLSYLGSWFPLVL 107 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.322 0.136 0.392 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 131,582 Number of Sequences: 1233 Number of extensions: 4894 Number of successful extensions: 15 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 9 Number of HSP's gapped (non-prelim): 8 length of query: 225 length of database: 328,796 effective HSP length: 71 effective length of query: 154 effective length of database: 241,253 effective search space: 37152962 effective search space used: 37152962 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 37 (18.9 bits)