BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|255764483|ref|YP_003065151.2| hypothetical protein CLIBASIA_03125 [Candidatus Liberibacter asiaticus str. psy62] (135 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|255764483|ref|YP_003065151.2| hypothetical protein CLIBASIA_03125 [Candidatus Liberibacter asiaticus str. psy62] Length = 135 Score = 274 bits (700), Expect = 4e-76, Method: Compositional matrix adjust. Identities = 135/135 (100%), Positives = 135/135 (100%) Query: 1 MHRKRQREIKNETVRKKGIPTTASQKTPEDNSNRIRIAVGQSLILQFDVLPKQVIVGDDK 60 MHRKRQREIKNETVRKKGIPTTASQKTPEDNSNRIRIAVGQSLILQFDVLPKQVIVGDDK Sbjct: 1 MHRKRQREIKNETVRKKGIPTTASQKTPEDNSNRIRIAVGQSLILQFDVLPKQVIVGDDK 60 Query: 61 IVDVLALEKEKTVVITGKNLGSTNIIVLGHNNDILLDTEIATFANEQSTVRVYTPGTLSF 120 IVDVLALEKEKTVVITGKNLGSTNIIVLGHNNDILLDTEIATFANEQSTVRVYTPGTLSF Sbjct: 61 IVDVLALEKEKTVVITGKNLGSTNIIVLGHNNDILLDTEIATFANEQSTVRVYTPGTLSF 120 Query: 121 LSCTPRCLPSSPPVR 135 LSCTPRCLPSSPPVR Sbjct: 121 LSCTPRCLPSSPPVR 135 >gi|254780727|ref|YP_003065140.1| putative pilus assembly protein [Candidatus Liberibacter asiaticus str. psy62] Length = 474 Score = 41.6 bits (96), Expect = 5e-06, Method: Compositional matrix adjust. Identities = 26/74 (35%), Positives = 44/74 (59%), Gaps = 7/74 (9%) Query: 34 RIRIAVGQSLILQFDVLPKQVIVGDDKIVDVLALEKEKTVVITGKNLGSTNIIVLGH--- 90 +I I + + +ILQ V + V+V D DV+ + +T+ + GKN+G N+I++GH Sbjct: 49 KISIGLNKVIILQVPVDVQDVLVSDPTKADVV-VHSPRTMYLFGKNVGQANVILIGHDGK 107 Query: 91 ---NNDILLDTEIA 101 N DIL++ +IA Sbjct: 108 QMLNLDILIERDIA 121 >gi|254780655|ref|YP_003065068.1| transketolase [Candidatus Liberibacter asiaticus str. psy62] Length = 673 Score = 23.5 bits (49), Expect = 1.6, Method: Composition-based stats. Identities = 20/68 (29%), Positives = 33/68 (48%), Gaps = 6/68 (8%) Query: 54 VIVGDDKIVDVLALEKEKTVVITGKNLGSTNIIVLGHNNDILLDTEIATFANEQSTVRVY 113 V+VGD +++ ++ E + +LG + +IVL NN I +D I+ + R Sbjct: 164 VLVGDGCLMEGISQE----AISFAGHLGLSKLIVLWDNNGISIDGPISLADSTDQYARFR 219 Query: 114 TPG--TLS 119 G TLS Sbjct: 220 ASGWNTLS 227 >gi|254780892|ref|YP_003065305.1| probable two-component response regulator protein [Candidatus Liberibacter asiaticus str. psy62] Length = 133 Score = 23.5 bits (49), Expect = 1.6, Method: Compositional matrix adjust. Identities = 13/52 (25%), Positives = 26/52 (50%) Query: 44 ILQFDVLPKQVIVGDDKIVDVLALEKEKTVVITGKNLGSTNIIVLGHNNDIL 95 +L+F +Q+ +G D V L +E + +I G G+ + ++ N + L Sbjct: 59 VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110 >gi|254780662|ref|YP_003065075.1| NAD-glutamate dehydrogenase [Candidatus Liberibacter asiaticus str. psy62] Length = 1576 Score = 22.3 bits (46), Expect = 3.1, Method: Composition-based stats. Identities = 8/15 (53%), Positives = 13/15 (86%) Query: 59 DKIVDVLALEKEKTV 73 D++ D+L++EKE TV Sbjct: 1545 DQVFDILSVEKEVTV 1559 >gi|254780268|ref|YP_003064681.1| acetyl-CoA carboxylase biotin carboxylase subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 443 Score = 21.6 bits (44), Expect = 5.5, Method: Composition-based stats. Identities = 8/24 (33%), Positives = 14/24 (58%) Query: 15 RKKGIPTTASQKTPEDNSNRIRIA 38 ++ GIPT A T + + +R+A Sbjct: 22 KELGIPTVAVHSTADSGAMHVRLA 45 >gi|254780808|ref|YP_003065221.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Candidatus Liberibacter asiaticus str. psy62] Length = 626 Score = 21.2 bits (43), Expect = 6.6, Method: Compositional matrix adjust. Identities = 9/15 (60%), Positives = 13/15 (86%) Query: 71 KTVVITGKNLGSTNI 85 K++V+T KNL ST+I Sbjct: 479 KSLVLTSKNLSSTSI 493 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.316 0.133 0.372 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 83,308 Number of Sequences: 1233 Number of extensions: 3266 Number of successful extensions: 14 Number of sequences better than 100.0: 13 Number of HSP's better than 100.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of query: 135 length of database: 328,796 effective HSP length: 65 effective length of query: 70 effective length of database: 248,651 effective search space: 17405570 effective search space used: 17405570 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 34 (17.7 bits)