>gi|255764484|ref|YP_003065144.2| hypothetical protein CLIBASIA_03090 [Candidatus Liberibacter asiaticus str. psy62]
MQRLIEILLLSSFAVIAIIFLWADIREKSISAFFRDIPIALVK