RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|255764485|ref|YP_003065139.2| hypothetical protein CLIBASIA_03065 [Candidatus Liberibacter asiaticus str. psy62] (243 letters) >2ffj_A Conserved hypothetical protein; 2649480, structural genomics, joint center for structural genomics, JCSG; 2.45A {Archaeoglobus fulgidus dsm 4304} (A:81-300) Length = 220 Score = 29.1 bits (65), Expect = 0.56 Identities = 8/29 (27%), Positives = 9/29 (31%), Gaps = 3/29 (10%) Query: 14 VCFKGLANMRSLISCLKTIFWKNFFLRTL 42 + KG AN L FL T Sbjct: 173 IVAKGXANYECLSDGSL---KPIAFLLTA 198 >2g8l_A 287AA long hypothetical protein; 3258004, structural genomics, PSI, protein structure initiative, joint center for structural genomics; 2.04A {Pyrococcus horikoshii} (A:81-299) Length = 219 Score = 28.6 bits (64), Expect = 0.77 Identities = 7/29 (24%), Positives = 10/29 (34%), Gaps = 3/29 (10%) Query: 14 VCFKGLANMRSLISCLKTIFWKNFFLRTL 42 + KG N +L + FFL Sbjct: 169 IIAKGQGNFETLSEIND---SRIFFLLKA 194 >1dzf_A DNA-directed RNA polymerases I, II, and III 27 KD polypeptide; RNA polymerase subunit; 1.9A {Saccharomyces cerevisiae} (A:53-144) Length = 92 Score = 28.2 bits (63), Expect = 1.1 Identities = 7/43 (16%), Positives = 15/43 (34%), Gaps = 2/43 (4%) Query: 101 TIRGFLEKYKNDSASVLFLLIPSPTVSSASIRRAVKDIRKIII 143 T++ F+ + + + + SA + V I I Sbjct: 40 TMKTFVIHIQEKNFQTGIFVYQNNITPSA--MKLVPSIPPATI 80 >2ov6_A V-type ATP synthase subunit F; F subunit, A1AO ATP synthase, structure, hydrolase; NMR {Methanosarcina mazei GO1} (A:) Length = 101 Score = 28.1 bits (63), Expect = 1.1 Identities = 8/43 (18%), Positives = 15/43 (34%) Query: 94 IKYPIHDTIRGFLEKYKNDSASVLFLLIPSPTVSSASIRRAVK 136 + + L K N+S + + S S+R +K Sbjct: 50 MHNDDIGNLPEVLRKNLNESVQPTVVALGGSGSGSTSLREKIK 92 >2pz4_A Protein GBS052; SPAB, GRAM-positive pilins, adhesions, IGG-like domain, cell adhesion; 1.80A {Streptococcus agalactiae} (A:1-121) Length = 121 Score = 27.2 bits (60), Expect = 2.3 Identities = 18/93 (19%), Positives = 35/93 (37%), Gaps = 8/93 (8%) Query: 144 SSGIPVSSISERIYDADYGMDVDTI----RLSYFASKPSAGKCGFWPEDMLGNAKGNR-- 197 G P+ + ++Y D D + L+ K A + + G A N+ Sbjct: 27 KEGTPIEGVLYQLYQLKSTEDGDLLAHWNSLTITELKKQAQQVFEATTNQQGKATFNQLP 86 Query: 198 NWTNYGCAYQNNLAAQVVNP--LDLFSPRMVTP 228 + YG A + + V+ +DL +++ P Sbjct: 87 DGIYYGLAVKAGEKNRNVSAFLVDLSEDKVIYP 119 >3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, protein structure initiative; 1.90A {Bacteroides uniformis atcc 8492} (A:1-83,A:268-328) Length = 144 Score = 26.5 bits (58), Expect = 3.3 Identities = 7/56 (12%), Positives = 18/56 (32%), Gaps = 3/56 (5%) Query: 146 GIPVSSISERIYDADYGMDVDTIRLSYFASKPSAGK---CGFWPEDMLGNAKGNRN 198 G+ V+ + +Y AD + ++ + G P + + + Sbjct: 87 GLTVNPNNGEVYVADAIDYQQQGIVYRYSPQGKLIDEFYVGIIPGAFCWKLEHHHH 142 >3k25_A SLR1438 protein; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG, SGR112, P73504_SYNY3; 2.55A {Synechocystis SP} (A:) Length = 289 Score = 26.4 bits (57), Expect = 3.6 Identities = 10/74 (13%), Positives = 18/74 (24%), Gaps = 4/74 (5%) Query: 55 GTSALAYYDEGSDYRDRYPILMRKVEQIVDIPLLAGRGEIKYPIHDTIRGF----LEKYK 110 + D R PIL + + H R + + Sbjct: 47 YFDRERFQDPSLSVRGGIPILFPICGNLPQDQFNHAGKSYRLKQHGFARDLPWEVIGQQT 106 Query: 111 NDSASVLFLLIPSP 124 D+A + L + Sbjct: 107 QDNARLDLRLSHND 120 >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} (B:1772-1800,B:1916-2006) Length = 120 Score = 25.9 bits (57), Expect = 5.2 Identities = 5/24 (20%), Positives = 14/24 (58%), Gaps = 5/24 (20%) Query: 1 MMVEYMITILFGGVCFKGLANMRS 24 M +E ++ ++F ++G+ M+ Sbjct: 6 MSIESLVEVVF----YRGMT-MQV 24 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.325 0.141 0.426 Gapped Lambda K H 0.267 0.0474 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,874,684 Number of extensions: 83468 Number of successful extensions: 267 Number of sequences better than 10.0: 1 Number of HSP's gapped: 267 Number of HSP's successfully gapped: 10 Length of query: 243 Length of database: 4,956,049 Length adjustment: 86 Effective length of query: 157 Effective length of database: 2,048,819 Effective search space: 321664583 Effective search space used: 321664583 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 53 (24.8 bits)