BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|255764487|ref|YP_003065115.2| heat shock protein [Candidatus Liberibacter asiaticus str. psy62] (219 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|255764487|ref|YP_003065115.2| heat shock protein [Candidatus Liberibacter asiaticus str. psy62] Length = 219 Score = 443 bits (1139), Expect = e-126, Method: Compositional matrix adjust. Identities = 219/219 (100%), Positives = 219/219 (100%) Query: 1 METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60 METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR Sbjct: 1 METFMSEKNIDKEKNPSNANSSTAEEKSEINIPEESLNQSEEFRDKYLRVIAEMENLRRR 60 Query: 61 TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120 TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR Sbjct: 61 TDREKKDAQSYSIAKFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTR 120 Query: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP Sbjct: 121 REMMSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANTIIKVVQDGYAINERVLRP 180 Query: 181 ALVSISKGKTQNPTEEKKETIEQPSPLDIEERNKTQTKN 219 ALVSISKGKTQNPTEEKKETIEQPSPLDIEERNKTQTKN Sbjct: 181 ALVSISKGKTQNPTEEKKETIEQPSPLDIEERNKTQTKN 219 >gi|254781029|ref|YP_003065442.1| chemotaxis sensory transducer [Candidatus Liberibacter asiaticus str. psy62] Length = 1828 Score = 27.7 bits (60), Expect = 0.16, Method: Compositional matrix adjust. Identities = 23/89 (25%), Positives = 44/89 (49%), Gaps = 5/89 (5%) Query: 75 KFARDMLSVSDNLSRALDSAPLDLANSEKKSESVLKSLIEGIEMTRREMMSTLERYG--- 131 KF + S SDN+SR L +++ +S S+++ I ++ + LE YG Sbjct: 1172 KFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQRIHEVKDVLSNLDRALESYGSTV 1231 Query: 132 VKKIDAKDQKFNPNMH--QAMFEEPHDTV 158 K+ Q F NM +++F++ +D++ Sbjct: 1232 FKQFKEYVQCFETNMENMESLFDKNNDSM 1260 >gi|254780439|ref|YP_003064852.1| carbamoyl phosphate synthase large subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 1162 Score = 27.7 bits (60), Expect = 0.17, Method: Compositional matrix adjust. Identities = 12/39 (30%), Positives = 21/39 (53%) Query: 124 MSTLERYGVKKIDAKDQKFNPNMHQAMFEEPHDTVPANT 162 M L+RYGV+ I AK + + +++F + +P T Sbjct: 105 MGVLDRYGVEMIGAKPETIDKAEDRSLFSKAMQNIPLAT 143 >gi|254780264|ref|YP_003064677.1| elongation factor G [Candidatus Liberibacter asiaticus str. psy62] Length = 701 Score = 22.3 bits (46), Expect = 6.3, Method: Compositional matrix adjust. Identities = 8/27 (29%), Positives = 17/27 (62%) Query: 30 INIPEESLNQSEEFRDKYLRVIAEMEN 56 + IPE+ + + +RDK + I E+++ Sbjct: 203 VEIPEDMKDSANSYRDKMIESIVELDD 229 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.306 0.123 0.318 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 126,586 Number of Sequences: 1233 Number of extensions: 4704 Number of successful extensions: 12 Number of sequences better than 100.0: 11 Number of HSP's better than 100.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 11 length of query: 219 length of database: 328,796 effective HSP length: 71 effective length of query: 148 effective length of database: 241,253 effective search space: 35705444 effective search space used: 35705444 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 43 (22.0 bits) S2: 36 (18.5 bits)