HHsearch alignment for GI: 255764488 and conserved domain: PRK06926

>PRK06926 flagellar motor protein MotP; Reviewed.
Probab=94.28  E-value=0.41  Score=26.30  Aligned_cols=190  Identities=14%  Similarity=0.012  Sum_probs=116.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999741047447642074211455532355306202799999999999637898999999999999999
Q gi|255764488|r   76 CDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIIL  155 (290)
Q Consensus        76 ~eli~~l~el~~~~Rk~GllaLE~~ie~p~~s~i~~~~~~~~~~~~~~~fl~~~l~~~v~g~~~~~~i~~~L~~ei~~~~  155 (290)
T Consensus        83 i~~l~~la~~aRk~GllaLE~~~~~~~dpFl~----~gl~l~vdg~~~~~i~~iLe~e---------i~~-~~~r~~~~~  148 (272)
T PRK06926         83 VQTFVSLSEQARREGLLSLDAQLDEVKDPFLK----KGLLLAIDGWDEETIRDVMDSE---------IAA-MEERHRKGR  148 (272)
T ss_pred             HHHHHHHHHHHHHCCHHHHHHHHCCCCCHHHH----HHHHHHHCCCCHHHHHHHHHHH---------HHH-HHHHHHHHH
T ss_conf             99999999999875676588765065787999----8899985899999999999999---------999-999998888


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99621289999999998888899999999999961489789998666899999999999999999999999999999999
Q gi|255764488|r  156 YEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQH  235 (290)
Q Consensus       156 ~~~~~~~~~~~~~a~~aPafGmiGTviGLI~ml~~l~d~p~~lG~~iA~ALitTlYGv~lAn~i~~Pia~kl~~~~~~e~  235 (290)
T Consensus       149 ~~~~~~g~~aPafGmiGTviGLI~mL~~l~d-p~~iG---~~mAvALvtTlYGv~lAn~~f~PiA~KL~~~~~~e~~~~~  224 (272)
T PRK06926        149 RLFEKAGEFAPAWGMIGTLVGLVLMLKNLND-PHTLG---PNMAVALLTTLYGTLLANLVFIPIAAKLEEKTESEIFIKQ  224 (272)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC-HHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999999872588799999999999881699-99998---8889999999999999999998899999988899999989


Q ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCHHHCCCHHHHHHHHHHC
Q ss_conf             999999999999957999689999983119967683889999999702
Q gi|255764488|r  236 RLYIIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQY  283 (290)
Q Consensus       236 ~~~~~i~egi~~i~~g~~P~~~~e~l~~~lp~~~r~~~~e~~~~~~~~  283 (290)
T Consensus       225 miieGil~I~~g~nP~~ie~kL~sfL~p~~r~~~~~~~~~~~~~~~~~  272 (272)
T PRK06926        225 VMIEGIIGVQSGQNPRNLESQLVVFSSKEDWQKKRADRSKKKDRVHEA  272 (272)
T ss_pred             HHHHHHHHHHCCCCHHHHHHHHHHHCCHHHHHHHCCCHHHHHHHHCCC
T ss_conf             999999998779984999999997499888866500056776553039