Query         gi|255764488|ref|YP_003065099.2| flagellar motor protein MotA [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 290
No_of_seqs    138 out of 898
Neff          7.0 
Searched_HMMs 23785
Date          Tue May 31 17:02:56 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 255764488.hhm -d /home/congqian_1/database/pdb/pdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 1h8b_A ACT-EF34, alpha-actinin  34.3      12 0.00051   15.6   1.3   28  241-269    12-39  (75)
  2 1mp8_A Focal adhesion kinase 1  30.1      18 0.00077   14.5   1.6   36  254-289   243-280 (281)
  3 3din_C Preprotein translocase   27.4      24   0.001   13.7   4.6   10  252-261   326-335 (431)
  4 3kv0_A HET-C2; GLTP, glycolipi  22.7      30  0.0012   13.1   4.2  127   24-175    38-166 (209)
  5 3k6j_A Protein F01G10.3, confi  20.9      32  0.0014   12.9   3.8   61   74-148   207-267 (460)
  6 1f0y_A HCDH, L-3-hydroxyacyl-C  20.5      33  0.0014   12.8   4.0   32  117-148   206-237 (302)
  7 3gxj_A TGF-beta receptor type-  19.7      34  0.0014   12.7   4.0   32  256-287   266-299 (303)
  8 1xbb_A Tyrosine-protein kinase  17.6      38  0.0016   12.4   2.9   30  254-283   246-277 (291)
  9 2j8p_A Cleavage stimulation fa  17.6      38  0.0016   12.4   1.6   22  263-284    25-46  (49)
 10 3eup_A Transcriptional regulat  17.5      38  0.0016   12.4  10.4   45   46-93     29-73  (204)

No 1  
>1h8b_A ACT-EF34, alpha-actinin 2, skeletal muscle isoform; structural protein, Z-DISK structural complex; NMR {Homo sapiens} SCOP: a.39.1.7
Probab=34.33  E-value=12  Score=15.57  Aligned_cols=28  Identities=21%  Similarity=0.234  Sum_probs=19.7

Q ss_pred             HHHHHHHHHCCCCHHHHHHHHHHCCCHHH
Q ss_conf             99999999579996899999831199676
Q gi|255764488|r  241 VKKALIAYMNGAIPQVAIEYGRKVLPLSE  269 (290)
Q Consensus       241 i~egi~~i~~g~~P~~~~e~l~~~lp~~~  269 (290)
                      +++....+..| .|-+.++.|+..|||++
T Consensus        12 v~~sFr~lA~~-KpyVT~~dLr~~L~peq   39 (75)
T 1h8b_A           12 VIASFRILASD-KPYILAEELRRELPPDQ   39 (75)
T ss_dssp             HHHHHHHHTTS-CSSBCHHHHHHHSCHHH
T ss_pred             HHHHHHHHHCC-CCCCCHHHHHHHCCHHH
T ss_conf             99999999689-98118999996579999


No 2  
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A*
Probab=30.07  E-value=18  Score=14.45  Aligned_cols=36  Identities=19%  Similarity=0.200  Sum_probs=25.8

Q ss_pred             HHHHHHHHHHCC--CHHHCCCHHHHHHHHHHCCCCCCC
Q ss_conf             689999983119--967683889999999702434568
Q gi|255764488|r  254 PQVAIEYGRKVL--PLSERPSIEIVAQEVLQYNHNKKA  289 (290)
Q Consensus       254 P~~~~e~l~~~l--p~~~r~~~~e~~~~~~~~~~~~~a  289 (290)
                      |.-+.+.+..-+  .|++||+++|+-+.+.+.-.+++|
T Consensus       243 ~~~l~~li~~cl~~dP~~Rps~~ei~~~L~~il~~~ka  280 (281)
T 1mp8_A          243 PPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKA  280 (281)
T ss_dssp             CHHHHHHHHHHTCSSGGGSCCHHHHHHHHHHHHHHHHH
T ss_pred             CHHHHHHHHHHCCCCHHHCCCHHHHHHHHHHHHHHHHC
T ss_conf             99999999997687976892999999999999788608


No 3  
>3din_C Preprotein translocase subunit SECY; protein translocation, membrane protein, ATPase, ATP- binding, cytoplasm, inner membrane, nucleotide-binding; HET: ADP; 4.50A {Thermotoga maritima MSB8}
Probab=27.43  E-value=24  Score=13.69  Aligned_cols=10  Identities=20%  Similarity=-0.124  Sum_probs=3.2

Q ss_pred             CCHHHHHHHH
Q ss_conf             9968999998
Q gi|255764488|r  252 AIPQVAIEYG  261 (290)
Q Consensus       252 ~~P~~~~e~l  261 (290)
                      -||.-+.|.|
T Consensus       326 ~~p~~iAe~L  335 (431)
T 3din_C          326 FDPREISENI  335 (431)
T ss_dssp             THHHHHTTSC
T ss_pred             CCHHHHHHHH
T ss_conf             6889999999


No 4  
>3kv0_A HET-C2; GLTP, glycolipid transfer protein, transport protein; HET: MLY; 1.90A {Podospora anserina}
Probab=22.74  E-value=30  Score=13.13  Aligned_cols=127  Identities=10%  Similarity=0.025  Sum_probs=60.4

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             81124248999999999999999858989999999999996357889966689999999999999974104744764207
Q gi|255764488|r   24 NPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDD  103 (290)
Q Consensus        24 ~l~~f~~~~sllIV~GGtlaA~li~~p~~~i~~~~~~l~~~f~~~~~~~~~~~eli~~l~el~~~~Rk~GllaLE~~ie~  103 (290)
                      +...|++...-++-+-..+|.+..++=-+|+..-...++..+...+....    .++.+++.  .            ++.
T Consensus        38 ~t~~FL~A~~~i~~~fd~lG~~aF~~v~~Dv~gnI~kL~~~~~~~p~~~~----tl~~~v~~--E------------~~~   99 (209)
T 3kv0_A           38 STAEFLEAAESLTTMFDVLGSIAFSPVXTDMLGNVEXIRXRMLAAPLESQ----NIQDLVRN--E------------LXT   99 (209)
T ss_dssp             BHHHHHHHHHHHHHHHHHHHTTTTHHHHHHHHHHHHHHHHHHHHSGGGCS----BHHHHHHH--H------------TCC
T ss_pred             CHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCHHHH----HHHHHHHH--H------------HHC
T ss_conf             67999999999999999848741001699888609999988742824778----99999998--8------------642


Q ss_pred             HHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHH
Q ss_conf             421145553235530620279999999999963789899999999999999999621--289999999998888
Q gi|255764488|r  104 PYNSTIFTSIPTVLENNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLK--PYHAISHMGESLPAI  175 (290)
Q Consensus       104 p~~s~i~~~~~~~~~~~~~~~fl~~~l~~~v~g~~~~~~i~~~L~~ei~~~~~~~~~--~~~~~~~~a~~aPaf  175 (290)
                      ..+|    .-..++.-+....|++..++.++++..   ++++....-.+..-..||.  ..++|..+-..+|.-
T Consensus       100 ~~~S----~t~~LLwL~RaL~Fi~~fl~~~~~~~~---~l~~~~~~AY~~tL~pyHgw~vr~af~~A~~~~P~R  166 (209)
T 3kv0_A          100 XSHT----ATEGLLWLVRGLEFTCIALSXNIGSTE---ELADSFRGSYRVTLXPHHSFLVXPIFSAAMSACPYR  166 (209)
T ss_dssp             -CCH----HHHHHHHHHHHHHHHHHHHHHHHTSCC---CHHHHHHHHHHHTTGGGSCTTTHHHHHHHHHTCCCH
T ss_pred             CCCH----HHHHHHHHHHHHHHHHHHHHHHCCCCH---HHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCH
T ss_conf             5652----768999999899999999987607962---589999999999986412129999999999839979


No 5  
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans}
Probab=20.87  E-value=32  Score=12.89  Aligned_cols=61  Identities=10%  Similarity=0.061  Sum_probs=39.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHCCCCHHHHHHHHH
Q ss_conf             689999999999999974104744764207421145553235530620279999999999963789899999999
Q gi|255764488|r   74 TYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMIIVGNARSYEIENLMD  148 (290)
Q Consensus        74 ~~~eli~~l~el~~~~Rk~GllaLE~~ie~p~~s~i~~~~~~~~~~~~~~~fl~~~l~~~v~g~~~~~~i~~~L~  148 (290)
                      ...+++..+.++.+...|..+..-+    .          |-+.-+....++++.+++++.+|..++++++..+.
T Consensus       207 Ts~e~i~~~~~~~~~lgK~pVvv~d----~----------pGFi~NRi~~~~~~eA~~ll~egga~~~~ID~a~~  267 (460)
T 3k6j_A          207 TSSQAIATAFQACESIKKLPVLVGN----C----------KSFVFNRLLHVYFDQSQKLMYEYGYLPHQIDKIIT  267 (460)
T ss_dssp             CCHHHHHHHHHHHHHTTCEEEEESS----C----------CHHHHHHHHHHHHHHHHHHHHTSCCCHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHCCCEEEEECC----C----------CCEEHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHH
T ss_conf             8878999999999860880588346----6----------87318889999999999999968997687999998


No 6  
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A*
Probab=20.51  E-value=33  Score=12.85  Aligned_cols=32  Identities=22%  Similarity=0.421  Sum_probs=17.6

Q ss_pred             HHCHHHHHHHHHHHHHHHHCCCCHHHHHHHHH
Q ss_conf             30620279999999999963789899999999
Q gi|255764488|r  117 LENNELTTFICDYMRMIIVGNARSYEIENLMD  148 (290)
Q Consensus       117 ~~~~~~~~fl~~~l~~~v~g~~~~~~i~~~L~  148 (290)
                      .-+.-..+|++.+++++-+|..++++++..+.
T Consensus       206 i~NRl~~~~~~ea~~l~~eg~a~~e~iD~~~~  237 (302)
T 1f0y_A          206 IVNRLLVPYLMEAIRLYERGDASKEDIDTAMK  237 (302)
T ss_dssp             THHHHHHHHHHHHHHHHHTTSSCHHHHHHHHH
T ss_pred             EHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHH
T ss_conf             37999999999999999967997899999999


No 7  
>3gxj_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3hmm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A*
Probab=19.72  E-value=34  Score=12.74  Aligned_cols=32  Identities=13%  Similarity=0.089  Sum_probs=23.7

Q ss_pred             HHHHHHHHCC--CHHHCCCHHHHHHHHHHCCCCC
Q ss_conf             9999983119--9676838899999997024345
Q gi|255764488|r  256 VAIEYGRKVL--PLSERPSIEIVAQEVLQYNHNK  287 (290)
Q Consensus       256 ~~~e~l~~~l--p~~~r~~~~e~~~~~~~~~~~~  287 (290)
                      .+.+.++.-+  .|++||++.|+.+.+.+...++
T Consensus       266 ~l~~li~~cl~~dP~~RPs~~ei~~~L~~l~~~~  299 (303)
T 3gxj_A          266 VMAKIMRECWYANGAARLTALRIKKTLSQLSQQE  299 (303)
T ss_dssp             HHHHHHHTTCCSSGGGSCCHHHHHHHHHC-CCC-
T ss_pred             HHHHHHHHHCCCCHHHCCCHHHHHHHHHHHHHHC
T ss_conf             9999999976069757949999999999989865


No 8  
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A*
Probab=17.64  E-value=38  Score=12.44  Aligned_cols=30  Identities=17%  Similarity=0.311  Sum_probs=22.0

Q ss_pred             HHHHHHHHHHCC--CHHHCCCHHHHHHHHHHC
Q ss_conf             689999983119--967683889999999702
Q gi|255764488|r  254 PQVAIEYGRKVL--PLSERPSIEIVAQEVLQY  283 (290)
Q Consensus       254 P~~~~e~l~~~l--p~~~r~~~~e~~~~~~~~  283 (290)
                      |.-+.+.++.-+  .|++||++++..+.+++.
T Consensus       246 ~~~l~~li~~cl~~dP~~RPs~~~I~~~L~~~  277 (291)
T 1xbb_A          246 PREMYDLMNLCWTYDVENRPGFAAVELRLRNY  277 (291)
T ss_dssp             CHHHHHHHHHHTCSSTTTSCCHHHHHHHHHHH
T ss_pred             CHHHHHHHHHHCCCCHHHCCCHHHHHHHHHCH
T ss_conf             69999999997588976890989999985285


No 9  
>2j8p_A Cleavage stimulation factor 64 kDa subunit; cleavage/polyadenylation, alternative splicing RNA15, PCF11, CSTF-64, RNA-binding, nuclear protein; NMR {Homo sapiens}
Probab=17.58  E-value=38  Score=12.43  Aligned_cols=22  Identities=27%  Similarity=0.466  Sum_probs=16.7

Q ss_pred             HCCCHHHCCCHHHHHHHHHHCC
Q ss_conf             1199676838899999997024
Q gi|255764488|r  263 KVLPLSERPSIEIVAQEVLQYN  284 (290)
Q Consensus       263 ~~lp~~~r~~~~e~~~~~~~~~  284 (290)
                      +.|||++|.|+-.+.+...+..
T Consensus        25 a~LP~eQr~sIl~LKeQi~~s~   46 (49)
T 2j8p_A           25 AMLPPEQRQSILILKEQIQKST   46 (49)
T ss_dssp             HTSCHHHHTHHHHHHHHHHCCC
T ss_pred             HHCCHHHHHHHHHHHHHHHHCC
T ss_conf             6189999988999999997435


No 10 
>3eup_A Transcriptional regulator, TETR family; structural genomics, PSI2, MCSG, protein structure initiative; 1.99A {Cytophaga hutchinsonii atcc 33406}
Probab=17.46  E-value=38  Score=12.42  Aligned_cols=45  Identities=7%  Similarity=-0.048  Sum_probs=23.8

Q ss_pred             HHHCCHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             985898999999999999635788996668999999999999997410
Q gi|255764488|r   46 VMANPLKVIKDSGVSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGS   93 (290)
Q Consensus        46 li~~p~~~i~~~~~~l~~~f~~~~~~~~~~~eli~~l~el~~~~Rk~G   93 (290)
                      .-+.+++++-...+.-+..|.+.-.++++   ++..+++.......+.
T Consensus        29 ~~~~t~~~Ia~~agvs~~~iY~~F~sK~~---L~~~~~~~~~~~~~~~   73 (204)
T 3eup_A           29 LAGTSLTDLTEATNLTKGSIYGNFENKEA---VAIAAFDYNWGHVKSV   73 (204)
T ss_dssp             HHHCCHHHHHHHHTCCHHHHTTTSSSHHH---HHHHHHHHHHHHHHHH
T ss_pred             CCCCCHHHHHHHHCCCHHHHHHHCCCHHH---HHHHHHHHHHHHHHHH
T ss_conf             46288999999979099999776456479---9999999999999999


Done!