BLAST/PSIBLAST alignment of GI: 255764488 and GI: 218461632 at iteration 1
>gi|218461632|ref|ZP_03501723.1| flagellar motor protein MotA [Rhizobium etli Kim 5] Length = 290
>gi|218662603|ref|ZP_03518533.1| flagellar motor protein MotA [Rhizobium etli IE4771] Length = 290
 Score =  361 bits (926), Expect = 8e-98,   Method: Compositional matrix adjust.
 Identities = 171/290 (58%), Positives = 219/290 (75%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M+ IIG  +T  C+IG F AMGG+   L QPFE VI+ GAGLG F+MANP+KV+KDSG +
Sbjct: 1   MNIIIGFIVTCGCVIGSFMAMGGHVEALFQPFEFVIIGGAGLGSFIMANPMKVVKDSGKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L E F +    +  Y D L +LY LM +L+  SRNE E HID+P  STIF   PTVL+N 
Sbjct: 61  LGEAFKHAVPKERNYLDTLGVLYSLMRDLRTKSRNEIEAHIDNPAESTIFQQAPTVLKNK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           ELT FICDY+R+II+GNARS+EIE LMDEE++ I+++K+KPYHAI  MG+S PAIGIV A
Sbjct: 121 ELTAFICDYVRLIIIGNARSHEIEALMDEELNTIMHDKMKPYHAIQIMGDSFPAIGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKAM +++ SP++LG  IG +L GT LGI+LSY LC+PL SQIK  R KQHRLY+I
Sbjct: 181 VLGVIKAMAHINDSPEVLGHLIGSALVGTFLGILLSYCLCSPLVSQIKVVRNKQHRLYVI 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK+ L+AYMNG++PQVA+EYGRK +   ERPSI+ V QE++      KA+
Sbjct: 241 VKQTLLAYMNGSVPQVALEYGRKTISAYERPSIDAVEQEMMNPGGENKAA 290