BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|255764488|ref|YP_003065099.2| flagellar motor protein MotA
[Candidatus Liberibacter asiaticus str. psy62]
         (290 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|317047825|ref|YP_004115473.1| flagellar motor protein MotA [Pantoea sp. At-9b]
 gi|316949442|gb|ADU68917.1| flagellar motor protein MotA [Pantoea sp. At-9b]
          Length = 295

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 96/288 (33%), Positives = 165/288 (57%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  + +  ++GG+  +GG+   L QP E++I+ GA +G F++ N  K IK +  +
Sbjct: 1   MLIILGYIVVLGSVLGGYLLVGGHLGALYQPSELLIIGGAAVGAFLVGNNGKAIKKTLKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
              +       +  Y D++ LLY LM   ++      E  I+DP  S IF + P +L + 
Sbjct: 61  FPLLMRGSKYNKAVYMDLMALLYRLMAKSRQQGMLSLERDIEDPSQSEIFANYPRILADK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +L  FI DY+R+++ GN  ++EIE LMDEEI+   +E   P  ++S +G+ LPA GIV A
Sbjct: 121 QLVDFITDYLRLMVSGNMNAFEIEALMDEEIETYEHECEVPAQSLSAVGDGLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+ +  +    LG  +  ++ GT LGI+L+Y   +PL S ++    +  ++   
Sbjct: 181 VMGVVHALASADRPAAELGALVAHAMVGTFLGILLAYGFISPLASVLRQKCAESTKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
           +K  L++ +NG  PQ+A+E+GRK L  +ERPS + + + V    +  K
Sbjct: 241 IKVTLLSSLNGYAPQIAVEFGRKTLYSTERPSFQELEEHVRNAKNPAK 288


>gi|304396267|ref|ZP_07378149.1| flagellar motor protein MotA [Pantoea sp. aB]
 gi|308187235|ref|YP_003931366.1| Chemotaxis protein motA (Motility protein A) [Pantoea vagans C9-1]
 gi|304356636|gb|EFM21001.1| flagellar motor protein MotA [Pantoea sp. aB]
 gi|308057745|gb|ADO09917.1| Chemotaxis protein motA (Motility protein A) [Pantoea vagans C9-1]
          Length = 295

 Score =  273 bits (699), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 100/288 (34%), Positives = 168/288 (58%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  IIG  I +  ++GG+  +GG+   L QP E++++ GAG G F++ N  K IK +  +
Sbjct: 1   MLIIIGYLIVLGSVLGGYALVGGHLGALYQPAELLMIGGAGAGAFLVGNNGKSIKKTLKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L ++F      +  Y D++ LLY LM   ++      E  I+DP  S IF + P +L + 
Sbjct: 61  LPKLFRGSKYNKAVYMDLMALLYRLMAKSRQQGMLSLERDIEDPSQSEIFANYPRILADK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +L  FI DY+R+++ GN  ++EIE LMDEEI+   +E   P  +I+ +G+ LPA GIV A
Sbjct: 121 QLVDFITDYLRLMVSGNMNAFEIEALMDEEIETYEHECDVPAQSIAAVGDGLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+ +  +    LG  +  ++ GT LGI+L+Y   +PL+S ++    +  ++   
Sbjct: 181 VMGVVHALASADRPAAELGALVAHAMVGTFLGILLAYGFVSPLSSVLRQKCAETTKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
           +K  L++ +NG  PQ+A+E+GRK L  +ERPS   + + V    +  K
Sbjct: 241 IKVTLLSSLNGYAPQIAVEFGRKTLYSAERPSFSELEEHVRNAKNPAK 288


>gi|300717115|ref|YP_003741918.1| flagellar motor protein [Erwinia billingiae Eb661]
 gi|299062951|emb|CAX60071.1| Flagellar motor protein [Erwinia billingiae Eb661]
          Length = 295

 Score =  271 bits (694), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 95/288 (32%), Positives = 162/288 (56%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  IIG  + +  ++GG+  +GG+   L QP E++I+ GAG+G F++ N  K IK +  +
Sbjct: 1   MLIIIGYILVLGSVLGGYAMVGGHLGALYQPSELLIIGGAGIGAFIVGNNGKAIKATMKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +       +  Y D++ LLY +M   ++      E  I+ P  S IF + P +L + 
Sbjct: 61  LPLLMRGSKYNKAVYMDLMALLYRIMAKSRQQGMLSLEADIESPQESEIFANYPRILADK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FI DY+R+++ GN  ++EIE LMDEEI+   +E   P  A+  +G+SLPA GIV A
Sbjct: 121 RLVDFITDYLRLMVSGNMNAFEIEALMDEEIETYEHECEVPATALQTVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  + +  +    LG ++  ++ GT LGI+L+Y   +PL   ++    +  ++   
Sbjct: 181 VMGVVHTLASADRPAAELGASVAHAMVGTFLGILLAYGFISPLAGVLRQKCAETTKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
           +K  L++ +NG  PQ+A+E+GRK L  ++RPS   + + V       K
Sbjct: 241 IKVTLLSSLNGYAPQIAVEFGRKTLYSTDRPSFTELEEHVRNAKSPAK 288


>gi|291617785|ref|YP_003520527.1| MotA [Pantoea ananatis LMG 20103]
 gi|291152815|gb|ADD77399.1| MotA [Pantoea ananatis LMG 20103]
          Length = 295

 Score =  271 bits (692), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 100/288 (34%), Positives = 168/288 (58%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  + +  ++GG+  +GG+   L QP E++++AGAG+G F++ N  K IK +  +
Sbjct: 1   MLIILGYIVVLGSVLGGYALVGGHLGALYQPAELLMIAGAGVGAFLVGNNGKSIKKTLKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y D++ LLY LM   ++      E  I+DP  S IF + P +L + 
Sbjct: 61  LPLLFRGSKYNKAVYMDLMALLYRLMAKSRQQGMLSLERDIEDPAQSEIFANYPRILADK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +L  FI DY+R+++ GN  ++EIE LMDEEI+   +E   P  +I+ +G+ LPA GIV A
Sbjct: 121 QLVDFITDYLRLMVSGNMNAFEIEALMDEEIETYEHECEVPAQSIAAVGDGLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+ +  +    LG  +  ++ GT LGI+L+Y   +PL S ++    +  ++   
Sbjct: 181 VMGVVHALASADRPAAELGALVAHAMVGTFLGILLAYGFISPLASVLRQKCAETTKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
           VK  L++ +NG  PQ+A+E+GRK L  +ERPS   + + V    +  K
Sbjct: 241 VKVTLLSSLNGYAPQIAVEFGRKTLYSAERPSFSELEEHVRNAKNPAK 288


>gi|253998519|ref|YP_003050582.1| flagellar motor protein MotA [Methylovorus sp. SIP3-4]
 gi|253985198|gb|ACT50055.1| flagellar motor protein MotA [Methylovorus sp. SIP3-4]
          Length = 286

 Score =  270 bits (691), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 97/285 (34%), Positives = 164/285 (57%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  + +  + GG+   GG+   L QP E++++ G  +G F++ N  K +K +  +
Sbjct: 1   MLVIVGYVVVLAAVFGGYALAGGHLGALWQPLEVLMIFGGAIGAFIVGNNGKALKATLGA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y D+L LL+ ++  ++K      EN +++P +S +F+  P +  ++
Sbjct: 61  LPTLFKGSKFTKALYMDLLALLFEILSKIRKDGMMSIENDVENPESSPLFSKYPALQADH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FI DY+R++I GN  ++++ENLMD EI+    E   P H I+ +G+ LPA GIV A
Sbjct: 121 HLMEFITDYLRLMISGNMDAFQVENLMDNEIETHHQEGHVPVHCIARLGDGLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  M N++  P  LG  I  +L GT LGI+L+Y    PL+S ++    +  ++Y  
Sbjct: 181 VMGVVHTMENVALPPAELGILIAHALVGTFLGILLAYGFIGPLSSLLEQKLDESTKMYQT 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           VK  L+A +NG  P +A+E+GRKVL  +ERP    + + V Q   
Sbjct: 241 VKATLLASLNGYAPAIAVEFGRKVLYSTERPGFTELEEHVKQAKS 285


>gi|188533602|ref|YP_001907399.1| flagellar motor protein MotA [Erwinia tasmaniensis Et1/99]
 gi|188028644|emb|CAO96506.1| Chemotaxis protein [Erwinia tasmaniensis Et1/99]
          Length = 294

 Score =  270 bits (691), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 102/290 (35%), Positives = 164/290 (56%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  I +  ++GG+  +GG+   L QP E++I+ GAG+G F++ N  K IK +  S
Sbjct: 1   MLIILGYIIVLGSVLGGYAMVGGHLGALYQPSEVLIIVGAGVGAFIVGNNGKAIKATLKS 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +       +  Y D++ LLY LM   ++      E  ID+P  S IF + P ++ + 
Sbjct: 61  LPLLMRGSKYNKAVYMDLMALLYRLMAKSRQQGMLSLERDIDNPQESEIFANYPRIIADK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +L  FI DY+R+++ GN  ++EIE LMDEEI+   +E   P  A+  MG+SLPA GIV A
Sbjct: 121 KLVDFISDYLRLMVSGNMNAFEIEALMDEEIETYEHECDVPATALGTMGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++GII  +    +    LG  I  ++ GT LGI+L+Y   +PL   ++    +  ++   
Sbjct: 181 VMGIIHTLAAADRPAAELGALIANAMVGTFLGILLAYGFISPLAGVLRQKCAENIKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           +K  L++ +NG  PQ+A+E+GRK L  +ERPS   + + V      ++ S
Sbjct: 241 IKVTLLSSLNGYAPQIAVEFGRKTLYSTERPSFSELEEHVRNAKSPQQTS 290


>gi|253996631|ref|YP_003048695.1| flagellar motor protein MotA [Methylotenera mobilis JLW8]
 gi|253983310|gb|ACT48168.1| flagellar motor protein MotA [Methylotenera mobilis JLW8]
          Length = 286

 Score =  270 bits (690), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 96/285 (33%), Positives = 160/285 (56%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  IIG  +    I GG+   GG+   L QP E++++ G  +G F++ N  K  K +  +
Sbjct: 1   MFVIIGYVVVCGTIFGGYALAGGHLGGLWQPLEVLMIFGGAVGAFIVGNDSKAQKATLKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y D+L LL+ ++  ++K      EN +++P  S +F+  P +  ++
Sbjct: 61  LPTLFKGSKFNKALYMDLLALLFEILTKIRKDGMMSIENDVENPEASPLFSKYPALQHDH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FI DY+R+++ GN  ++++ENLMD EI+    E   P H ++ +G+ LPA GIV A
Sbjct: 121 HLIEFITDYLRLMVSGNMDAFQVENLMDNEIETHHMEGHVPAHCVAKLGDGLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  M N++  P  LG  I  +L GT LGI+L+Y    PL+  ++    +  ++Y  
Sbjct: 181 VMGVVHTMENVALPPAELGILIAHALVGTFLGILLAYGFIGPLSGLLEQKLEESTKMYQT 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           VK  L+A +NG  P +A+E+GRKVL  +ERP+   +   V Q   
Sbjct: 241 VKVTLLASLNGYAPAIAVEFGRKVLYSTERPTFAELESHVKQAKG 285


>gi|74317261|ref|YP_315001.1| flagellar motor protein MotA [Thiobacillus denitrificans ATCC
           25259]
 gi|74056756|gb|AAZ97196.1| probable chemotaxis transmembrane protein MotA [Thiobacillus
           denitrificans ATCC 25259]
          Length = 286

 Score =  269 bits (687), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 98/286 (34%), Positives = 160/286 (55%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  I +L + GGF   GG+   L QP E++++ G  +G F++ N  KVIK +  +
Sbjct: 1   MLVIVGYVIVVLSVFGGFVLAGGHLAALFQPLELLMIGGGAIGAFLVGNNNKVIKATLKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +       +  Y D L LLY L+  ++K      E  +D P +S +F+  P ++ ++
Sbjct: 61  LPTVLKGSKYTRALYMDTLALLYELLTKIRKEGLMSVEADVDSPESSPLFSKYPAIMADH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  F+ DY+R+++ G+  ++EIENLMD EI+   +E   P H I+ +G+ LPA GIV A
Sbjct: 121 HVVEFLTDYLRLMVSGSMNAFEIENLMDNEIETHHHEGEVPAHVIAKIGDGLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  M ++   P  LG  I  +L GT LGI+L+Y    PL  +++    +  ++   
Sbjct: 181 VMGVVHTMESVGLPPAELGILIAHALVGTFLGILLAYGFVGPLAGRLEQRVHESTKMLQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHN 286
           VK  L+A +NG  P +A+E+GRKVL  +ERPS   +   V      
Sbjct: 241 VKVTLLASINGYAPAIAVEFGRKVLFSTERPSFSELEVHVKSAKSR 286


>gi|292488571|ref|YP_003531455.1| chemotaxis protein MotA [Erwinia amylovora CFBP1430]
 gi|292899742|ref|YP_003539111.1| chemotaxis protein [Erwinia amylovora ATCC 49946]
 gi|291199590|emb|CBJ46707.1| chemotaxis protein [Erwinia amylovora ATCC 49946]
 gi|291554002|emb|CBA21047.1| Chemotaxis protein MotA (Motility protein A) [Erwinia amylovora
           CFBP1430]
 gi|312172717|emb|CBX80973.1| Chemotaxis protein MotA (Motility protein A) [Erwinia amylovora
           ATCC BAA-2158]
          Length = 294

 Score =  268 bits (686), Expect = 6e-70,   Method: Composition-based stats.
 Identities = 103/290 (35%), Positives = 164/290 (56%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  I +  ++GG+  +GG+   L QP E++I+ GAG+G F++ N  K IK +  S
Sbjct: 1   MLIILGYIIVLGSVLGGYLMVGGHLGALYQPSEVLIIVGAGVGAFIVGNNGKAIKATLKS 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +       +  Y D++ LLY LM   ++      E  ID+P  S IF + P +L + 
Sbjct: 61  LPLLMRGSKYNKAVYMDLMALLYRLMAKSRQQGMLSLERDIDNPQESEIFANYPRILADK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FI DY+R+++ GN  ++EIE LMDEEI+   +E   P  A+  MG+SLPA GIV A
Sbjct: 121 RLVDFISDYLRLMVSGNMNAFEIEALMDEEIETYEHECEVPAIALGTMGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++GII  +    +    LG  I  ++ GT LGI+L+Y   +PL+  ++    +  ++   
Sbjct: 181 VMGIIHTLAAADRPAAELGALIANAMVGTFLGILLAYGFISPLSGVLRQKCAENTKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           +K  L++ +NG  PQ+A+E+GRK L  +ERPS   + + V      ++ S
Sbjct: 241 IKVTLLSSLNGYAPQIAVEFGRKTLYSTERPSFIELEEHVRNAKSPQQTS 290


>gi|193222290|emb|CAL61470.2| Chemotaxis protein MotA (Motility protein A) [Herminiimonas
           arsenicoxydans]
          Length = 286

 Score =  268 bits (685), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 103/285 (36%), Positives = 162/285 (56%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  IIG  + +  + GGF   GG+   L QP E++++ GA  G F + N  K IK +  +
Sbjct: 1   MLVIIGYIVVLASVFGGFALAGGHLSSLFQPVELLMIGGAAAGAFFVGNNSKAIKATFKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y +++ LL+ ++  ++K      E  ID P  S IFT  PTVL ++
Sbjct: 61  LPNVFKGSKYTKSLYMELMTLLFEILTKVRKEGLMSIEGDIDAPEESAIFTKYPTVLADH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FI DY+R+++ GN  +++IENLMD EID    E   P H I+ MG+ LPA GIV A
Sbjct: 121 HIIEFITDYLRLMVSGNMDAFQIENLMDNEIDTHHAEGEIPVHCIAKMGDGLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  M ++   P  LG  I  +L GT LGI+L+Y   +PL+S ++    +  +++  
Sbjct: 181 VMGVVHTMASVGLPPAELGILIANALVGTFLGILLAYGFVSPLSSTLEQKLHESSKVFQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           +K  L+A +NG  P +A+E+GRKVL  +ERPS   +   + Q   
Sbjct: 241 IKVTLLASLNGYAPALAVEFGRKVLFSTERPSFSELEDHIKQSKS 285


>gi|259908188|ref|YP_002648544.1| flagellar motor protein MotA [Erwinia pyrifoliae Ep1/96]
 gi|224963810|emb|CAX55312.1| Chemotaxis protein [Erwinia pyrifoliae Ep1/96]
 gi|283478117|emb|CAY74033.1| Chemotaxis protein MotA (Motility protein A) [Erwinia pyrifoliae
           DSM 12163]
 gi|310767898|gb|ADP12848.1| flagellar motor protein MotA [Erwinia sp. Ejp617]
          Length = 294

 Score =  268 bits (685), Expect = 8e-70,   Method: Composition-based stats.
 Identities = 103/290 (35%), Positives = 164/290 (56%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  I +  ++GG+  +GG+   L QP E++I+ GAG+G F++ N  K IK +  S
Sbjct: 1   MLIILGYIIVLGSVLGGYAMVGGHLGALYQPSEVLIIVGAGVGAFIVGNNGKAIKATLKS 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +       +  Y D++ LLY LM   ++      E  ID+P  S IF + P +L + 
Sbjct: 61  LPLLMRGSKYNKAVYMDLMALLYRLMAKSRQQGMLSLERDIDNPQESEIFANYPRILADK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FI DY+R+++ GN  ++EIE LMDEEI+   +E   P  A+  MG+SLPA GIV A
Sbjct: 121 RLVDFINDYLRLMVSGNMNAFEIEALMDEEIETYEHECEVPAIALGTMGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++GII  +    +    LG  I  ++ GT LGI+L+Y   +PL+  ++    +  ++   
Sbjct: 181 VMGIIHTLAAADRPAAELGALIANAMVGTFLGILLAYGFISPLSGVLRQKCAENTKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           +K  L++ +NG  PQ+A+E+GRK L  +ERPS   + + V      ++ S
Sbjct: 241 IKVTLLSSLNGYAPQIAVEFGRKTLYSTERPSFIELEEHVRNAKSPQQTS 290


>gi|329907015|ref|ZP_08274541.1| Flagellar motor rotation protein MotA [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327547115|gb|EGF31987.1| Flagellar motor rotation protein MotA [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 286

 Score =  268 bits (684), Expect = 8e-70,   Method: Composition-based stats.
 Identities = 98/285 (34%), Positives = 166/285 (58%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  IIG  + +L + GGF   GG+   L QP E++++ GA LG F++ N  K +K +  +
Sbjct: 1   MLVIIGYIVVMLSVFGGFAMAGGHLAALWQPLELLMIGGAALGAFLVGNNGKAMKATLQA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  +F      +  Y D++ L++ ++  ++K      E  ++ P  S IF+  P++L ++
Sbjct: 61  VPTLFKGSKFTKSLYMDLMSLMFEILTKVRKEGLMSIEGDVEKPEESPIFSKYPSILHDH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FI DY+R+++ GN  +++IENLMD EI+   +E   P H I+ +G+ LPA GIV A
Sbjct: 121 HVVEFITDYLRLMVSGNMDAFQIENLMDNEIETHHHEGAVPAHCIAKLGDGLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  M ++S  P  LG  I  +L GT LGI+L+Y    PL S ++    +  ++Y  
Sbjct: 181 VMGVVHTMESVSLPPAELGMLIAHALVGTFLGILLAYGFVGPLASLLEQKLDESTKIYQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           +K  L+A +NG  P +AIE+GRKVL  +ERP+   + + + Q   
Sbjct: 241 IKVTLLASLNGYAPALAIEFGRKVLFSTERPTFGELEEHIKQSKS 285


>gi|290474939|ref|YP_003467823.1| proton conductor component of motor, torque generator [Xenorhabdus
           bovienii SS-2004]
 gi|289174256|emb|CBJ81045.1| proton conductor component of motor, torque generator [Xenorhabdus
           bovienii SS-2004]
          Length = 293

 Score =  266 bits (681), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 101/288 (35%), Positives = 167/288 (57%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++G  +    +IGG+  +GG+   L QP E +I+AGAG+G F++ N  K IK +   
Sbjct: 1   MLVLLGYIVVFGAVIGGYLLVGGHMGALYQPAEFLIIAGAGIGAFIVGNNGKAIKATLRV 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L +I       +  Y D++ LL+ L+   ++      E  I++P+ S IFT  P +L++ 
Sbjct: 61  LPKILRRSKYNKAMYMDLMALLFRLLSKSRQNGLLALERDIENPHQSDIFTQYPRLLKDP 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  F  DYMR+II GN   +EIE LMDEEI+    E   P  +++ +G+SLPA GIV A
Sbjct: 121 YLMDFTTDYMRLIISGNMNPHEIEALMDEEIETYEQESEVPATSLAMVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+G+  +    LG  I  ++ GT LGI+L+Y   +PL + ++    +Q ++   
Sbjct: 181 VMGVVHALGSADRPAGELGALIAHAMVGTFLGILLAYGFVSPLATLLRQRSSEQVKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
           +K  L++ +NG  PQ+A+E+GRK L L++RPS   + + V +     +
Sbjct: 241 IKITLLSSLNGYAPQIAVEFGRKTLFLTDRPSFTELEEHVRRVKSPVQ 288


>gi|238795649|ref|ZP_04639163.1| hypothetical protein ymoll0001_15000 [Yersinia mollaretii ATCC
           43969]
 gi|238720375|gb|EEQ12177.1| hypothetical protein ymoll0001_15000 [Yersinia mollaretii ATCC
           43969]
          Length = 295

 Score =  266 bits (679), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 95/290 (32%), Positives = 165/290 (56%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  + +  + GG+  +GG+   L QP E +I+ GAG+G F++ N  K IK +  +
Sbjct: 1   MLVILGYIVVLGAVFGGYIIVGGHLGALYQPAEFLIIGGAGIGAFIVGNNGKAIKATMKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           + ++       +  Y D++ LLY L+   ++      E  I++P  S IF++ P +L + 
Sbjct: 61  MPKLMRRSKYNKVLYMDLMALLYRLLAKSRQQGMLSLERDIENPRESEIFSNYPRILADK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FI DY+R+I+ GN  ++EIE LMDEEI+    E   P  +++ +G+SLPA GIV A
Sbjct: 121 LLVEFITDYLRLIVSGNMNAFEIEALMDEEIETHEQECEVPAGSLAMVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+ +  +    LG  I  ++ GT LGI+L+Y   +PL + ++    +  ++   
Sbjct: 181 VMGVVHALASADRPAAELGALIAHAMVGTFLGILLAYGFISPLATLLRQQSAETTKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           +K  L++ +NG  PQ+A+E+GRK L  +ERPS   + + V +       +
Sbjct: 241 IKVTLLSSLNGYAPQIAVEFGRKTLYTTERPSFIELEEHVRRVKAPAPQA 290


>gi|187926230|ref|YP_001892575.1| flagellar motor protein MotA [Ralstonia pickettii 12J]
 gi|241665718|ref|YP_002984077.1| flagellar motor protein MotA [Ralstonia pickettii 12D]
 gi|187727984|gb|ACD29148.1| flagellar motor protein MotA [Ralstonia pickettii 12J]
 gi|240867745|gb|ACS65405.1| flagellar motor protein MotA [Ralstonia pickettii 12D]
          Length = 286

 Score =  265 bits (678), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 99/286 (34%), Positives = 164/286 (57%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   IG  + +  + GG+   GG+   L QP E++I+ GAG+G FV+ N  K I  +  +
Sbjct: 1   MLVAIGYIVILASVFGGYMLAGGHLGPLFQPTELLIIFGAGIGAFVVGNDKKAINATVKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y +V+ LLY+++  +++      E  I++P+ ST+F + P +  ++
Sbjct: 61  LPGLFKGSKYTKALYMEVMALLYVVLSKIRREGMMSIEADIENPHESTLFANYPAIQADH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               FICDY+R+++ GN   ++IE LMD+EID   +E  +P   I+ +G+++PA GIV A
Sbjct: 121 HALDFICDYLRLMVGGNLNPFQIEALMDQEIDTHHHEAEQPARIITKVGDAMPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  MG++   P  LG  I  +L GT LGI+L+Y    PL S ++    +  +L+  
Sbjct: 181 VMGVVHTMGSVGLPPAELGKLIASALVGTFLGILLAYGFIGPLGSLLEQRAEESTKLFQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHN 286
           +K  L+A MNG  P +A+E+GRKVL  +ERPS   +   V      
Sbjct: 241 IKVTLLASMNGYAPAIAVEFGRKVLFSTERPSFAELEDHVRGAKTA 286


>gi|300722596|ref|YP_003711886.1| proton conductor component of motor, torque generator [Xenorhabdus
           nematophila ATCC 19061]
 gi|297629103|emb|CBJ89688.1| proton conductor component of motor, torque generator [Xenorhabdus
           nematophila ATCC 19061]
          Length = 293

 Score =  265 bits (678), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 99/288 (34%), Positives = 168/288 (58%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++G  +    +IGG+  +GG+   L QP E +I+AGAG+G F++ N  K IK +   
Sbjct: 1   MLVLLGYIVVFGAVIGGYLLVGGHMGALYQPAEFLIIAGAGIGAFIVGNNGKAIKATLRV 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L ++       +  Y D++ L + L+   ++      E  I++P+ S IFT  P +L++ 
Sbjct: 61  LPKVLRRSKYNKAMYMDLMALQFRLLSKSRQHGLLALERDIENPHQSDIFTQYPRLLKDQ 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +L  FI DYMR+II GN   +EIE LMDEEI+    E   P  +++ +G+SLPA GIV A
Sbjct: 121 QLMDFITDYMRLIISGNMNPHEIEALMDEEIETYEQESEVPATSLAMVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+G+  +    LG  I  ++ GT LGI+L+Y   +PL + ++    +Q ++   
Sbjct: 181 VMGVVHALGSADRPAGELGMLIAHAMVGTFLGILLAYGFVSPLATLLRQRSSEQVKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
           +K  L++ ++G  PQ+A+E+GRK L L++RPS   + + V +     +
Sbjct: 241 IKVTLLSSLHGYAPQIAVEFGRKTLFLTDRPSFTELEEHVRRVKVPVQ 288


>gi|152980324|ref|YP_001353789.1| flagellar motor protein MotA [Janthinobacterium sp. Marseille]
 gi|151280401|gb|ABR88811.1| MotA chemotaxis protein [Janthinobacterium sp. Marseille]
          Length = 286

 Score =  265 bits (677), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 100/285 (35%), Positives = 162/285 (56%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  IIG  + +L + GGF   GG+   L QP E++++ GA +G F + N  K IK +  +
Sbjct: 1   MLVIIGYLVVVLSVFGGFALAGGHLAALFQPLELLMIGGAAVGAFFVGNNGKAIKATLKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y +++ LL+ ++  ++K      E  I+ P  S IF   PTVL ++
Sbjct: 61  LPSVFKGSRYTKSLYMELMTLLFEILTKVRKEGLMSIEGDIEAPEESAIFAKYPTVLADH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+ DY+R+++ GN  +++IENLMD EI+    E   P H ++ +G+ LPA GIV A
Sbjct: 121 HTIEFMTDYLRLMVSGNMDAFQIENLMDNEIETHHAEGEVPVHCVAKVGDGLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  M ++   P  LG  I  +L GT LGI+LSY    PL+S ++    +  +++  
Sbjct: 181 VMGVVHTMESVGLPPAELGMLIAHALVGTFLGILLSYGFVTPLSSLLEQKLHESSKIFQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           VK  L+A +NG  P +A+E+GRKVL  +ERPS   + + + Q   
Sbjct: 241 VKVTLLASLNGYAPALAVEFGRKVLFSTERPSFSEMEEHIRQSKS 285


>gi|300694373|ref|YP_003750346.1| mota: chemotaxis protein; proton conductor component of flagella
           motor, torque generator [Ralstonia solanacearum PSI07]
 gi|299076410|emb|CBJ35726.1| MotA: chemotaxis protein; proton conductor component of flagella
           motor, torque generator [Ralstonia solanacearum PSI07]
          Length = 286

 Score =  264 bits (676), Expect = 8e-69,   Method: Composition-based stats.
 Identities = 99/286 (34%), Positives = 163/286 (56%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   IG  + +  + GG+   GG+   L QP E++I+ GAG+G FV+ N  K I  +  S
Sbjct: 1   MLVAIGYIVILASVFGGYMLAGGHLGPLFQPTELLIIFGAGVGAFVVGNDKKAINATVKS 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y +V+ LLY+++  +++      E  I+ P+ S +F++ P +  ++
Sbjct: 61  LPGLFKGSKYTKSLYMEVMALLYVMLSKIRREGMMSIEADIESPHESALFSNYPAIQADH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               FICDY+R+++ GN   ++IE LMD+EID   +E  +P   I+ +G+++PA GIV A
Sbjct: 121 HALDFICDYLRLMVGGNLNPFQIEALMDQEIDTHHHEAEQPARIITKVGDAMPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  MG++   P  LG  I  +L GT LGI+L+Y    PL S ++    +  +L+  
Sbjct: 181 VMGVVHTMGSVGLPPAELGKLIASALVGTFLGILLAYGFIGPLGSLLEQRAEESTKLFQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHN 286
           +K  L+A MNG  P +A+E+GRKVL  +ERPS   +   V      
Sbjct: 241 IKVTLLASMNGYAPAIAVEFGRKVLFSTERPSFAELEDHVRGAKTA 286


>gi|123442805|ref|YP_001006782.1| flagellar motor protein MotA [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|332161301|ref|YP_004297878.1| flagellar motor protein MotA [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|122089766|emb|CAL12619.1| chemotaxis MotA protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|318605217|emb|CBY26715.1| flagellar motor rotation protein MotA [Yersinia enterocolitica
           subsp. palearctica Y11]
 gi|325665531|gb|ADZ42175.1| flagellar motor protein MotA [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
          Length = 295

 Score =  264 bits (675), Expect = 9e-69,   Method: Composition-based stats.
 Identities = 96/290 (33%), Positives = 164/290 (56%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  + +  + GG+  +GG+   L QP E +I+ GAG+G F++ N  K IK +  +
Sbjct: 1   MLVILGYIVVLGAVFGGYIIVGGHLGALYQPAEFLIIGGAGIGAFIVGNNGKAIKATMKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L ++       +  Y D++ LLY L+   ++      E  I+ P  S IF++ P +L + 
Sbjct: 61  LPKLMRRSKYNKVLYMDLMALLYRLLAKSRQQGMLSLERDIESPLESEIFSNYPRILADK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FI DY+R+I+ GN  ++EIE LMDEEI+    E   P  +++ +G+SLPA GIV A
Sbjct: 121 VLVEFITDYLRLIVSGNMNAFEIEALMDEEIETHEQECEVPAGSLAMVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+ +  +    LG  I  ++ GT LGI+L+Y   +PL + ++    +  ++   
Sbjct: 181 VMGVVHALASADRPAAELGALIAHAMVGTFLGILLAYGFISPLATLLRQQSAETTKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           +K  L++ +NG  PQ+A+E+GRK L  +ERPS   + + V +       +
Sbjct: 241 IKVTLLSSLNGYAPQIAVEFGRKTLYTTERPSFIELEEHVRRVKAPAPQA 290


>gi|322832490|ref|YP_004212517.1| flagellar motor protein MotA [Rahnella sp. Y9602]
 gi|321167691|gb|ADW73390.1| flagellar motor protein MotA [Rahnella sp. Y9602]
          Length = 296

 Score =  264 bits (675), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 100/288 (34%), Positives = 166/288 (57%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  IIG  + +  + GGF  +GG    L QP E++I+ GAG+G F + N  K IK +  +
Sbjct: 1   MLVIIGYIVVLGSVFGGFMLVGGELGALYQPAELLIIGGAGIGAFFVGNNGKAIKSTMRA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L ++F      +  Y D++ LLY ++   ++      EN ID+P  S IF + P +L + 
Sbjct: 61  LPQLFRASKYNKALYMDLMALLYRVLAKSRQQGMLSLENDIDNPAESDIFANYPRILADK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +L  ++ DY+R+++ GN  ++EIE LMDEEI+   +E   P ++++ +G+SLPA GIV A
Sbjct: 121 QLVEYLTDYLRLMVSGNMNAFEIEALMDEEIETYEHESEVPANSLALVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++GI+  +    +    LG  I  ++ GT LGI+L+Y   +PL S ++    +  ++   
Sbjct: 181 VMGIVHTLAAADRPAAELGALIAHAMVGTFLGILLAYGFISPLASVLRQKSAENAKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
           +K  L++ +NG  PQ+A+E+GRK L  SERPS   + + V Q     +
Sbjct: 241 IKVTLLSSINGYAPQIAVEFGRKTLYTSERPSFIELEEHVRQVKSPGQ 288


>gi|270262420|ref|ZP_06190691.1| chemotaxis protein MotA [Serratia odorifera 4Rx13]
 gi|270043104|gb|EFA16197.1| chemotaxis protein MotA [Serratia odorifera 4Rx13]
          Length = 298

 Score =  264 bits (675), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 96/289 (33%), Positives = 167/289 (57%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
             I+G  + +  + GG+  +GG+   L QP E +I+ GAG+G F++ N  K IK +  ++
Sbjct: 4   LVILGYLVVLGAVFGGYMMVGGHLGALYQPSEFLIIGGAGIGAFIVGNNGKAIKSTLRAI 63

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
            ++       +D Y D++ LLY L+   ++      E  ID+P  S IF++ P +L +N 
Sbjct: 64  PKLMRRSKYSKDLYMDLMALLYRLLAKSRQQGMLSLEFDIDNPQESEIFSNYPRILADNT 123

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
           L  FI DY+R+++ GN  ++EIE LMDEEI+    E   P  +++ +G+SLPA GIV A+
Sbjct: 124 LVEFITDYLRLMVSGNMNAFEIEALMDEEIETFEQESEVPAGSLAMVGDSLPAFGIVAAV 183

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           +G++ A+ +  +    LG  I  ++ GT LGI+L+Y   +PL + ++    +  ++   +
Sbjct: 184 MGVVHALASADRPAAELGALIANAMVGTFLGILLAYGFISPLATLLRQKSAENVKMMQCI 243

Query: 242 KKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           K  L++ +NG  PQ+A+E+GRK L  +ERPS   + + V +     + +
Sbjct: 244 KVTLLSSLNGYAPQIAVEFGRKTLYTTERPSFVELEEHVRRVKAPAQQA 292


>gi|30248077|ref|NP_840147.1| flagellar motor protein MotA [Nitrosomonas europaea ATCC 19718]
 gi|30179962|emb|CAD83957.1| probable chemotaxis (motility protein A) transmembrane
           [Nitrosomonas europaea ATCC 19718]
          Length = 286

 Score =  264 bits (675), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 105/285 (36%), Positives = 161/285 (56%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   IG  + I+ + GGF   GG+   L QP E++++AGA +G F + N  K IK +  +
Sbjct: 1   MLVAIGYVVVIVSVFGGFAMAGGHLGSLFQPVELIMIAGAAVGAFFVGNSGKAIKATFKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  IF      +  Y +++ LLY ++  ++K      E  +DDP  S +F   P +L ++
Sbjct: 61  LPYIFRDANYTKSVYMELMTLLYEILGKIRKEGLMSIEADVDDPGKSPLFGKYPKILSDH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
             T FI DY+R+++ GN    EIENLMD EI+    E   P H IS MG++LPA GIV A
Sbjct: 121 HATEFITDYLRLMVGGNLNPLEIENLMDGEIETHHQEGEVPVHVISKMGDALPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  M ++   P  LG  I  +L GT LGI+L+Y    PL ++++    +  +L   
Sbjct: 181 VMGVVHTMESVGIPPAELGKLIAAALVGTFLGILLAYGFIGPLANRLEQRLHESGKLLEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           VK  L+A +NG  P +A+E+GRKVL  +ERPS   + + + Q   
Sbjct: 241 VKVTLLANLNGYAPALAVEFGRKVLFSTERPSFAELEKHIKQSKA 285


>gi|156933519|ref|YP_001437435.1| flagellar motor protein MotA [Cronobacter sakazakii ATCC BAA-894]
 gi|156531773|gb|ABU76599.1| hypothetical protein ESA_01339 [Cronobacter sakazakii ATCC BAA-894]
          Length = 336

 Score =  264 bits (675), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 102/287 (35%), Positives = 163/287 (56%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
             +IG  + +  + GG+   GG    L QP E++I+ GAG+G F++ N  K IK +  +L
Sbjct: 43  LILIGYLVILGTVFGGYMITGGELGALYQPAELIIIGGAGVGAFIVGNNGKAIKGTLKAL 102

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
             +F      +  Y D++ LLY LM   ++      E  I++P  S IFTS P +L +N 
Sbjct: 103 PLLFRRSKYTKSMYMDLMALLYRLMTKSRQQGMFSLERDIENPKESEIFTSYPRILADNT 162

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
           +  FI DY+R+II GN  ++EIE LMDEEI+    E   P ++++ MG+SLPA GIV A+
Sbjct: 163 MLEFITDYLRLIISGNMNTFEIEALMDEEIETHESEAEVPANSLALMGDSLPAFGIVAAV 222

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           +G++ A+ +  +    LG  I  ++ GT LGI+L+Y   +PL + ++    +  ++   V
Sbjct: 223 MGVVHALASADRPAAELGALIAHAMVGTFLGILLAYGFVSPLATVLRQKSAETTKMMQCV 282

Query: 242 KKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
           K  L++ +NG  P +A+E+GRK L  SERPS   + + V       +
Sbjct: 283 KVTLLSSLNGYAPPIAVEFGRKTLYSSERPSFTELDEHVRAVKSPNQ 329


>gi|238758126|ref|ZP_04619306.1| hypothetical protein yaldo0001_12660 [Yersinia aldovae ATCC 35236]
 gi|238703664|gb|EEP96201.1| hypothetical protein yaldo0001_12660 [Yersinia aldovae ATCC 35236]
          Length = 295

 Score =  264 bits (674), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 95/290 (32%), Positives = 165/290 (56%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  + +  + GG+  +GG+   L QP E +I+ GAG+G F++ N  K IK +  +
Sbjct: 1   MLVILGYIVVLGAVFGGYMIVGGHLGALYQPAEFLIIGGAGIGAFIVGNNGKAIKATMKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           + ++       +  Y D++ LLY L+   ++      E  I++P  S IF++ P +L + 
Sbjct: 61  MPKLMHRSKYNKVLYMDLMALLYRLLAKSRQQGMLSLERDIENPLESEIFSNYPRILADK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FI DY+R+I+ GN  ++EIE LMDEEI+    E   P  +++ +G+SLPA GIV A
Sbjct: 121 LLVEFITDYLRLIVSGNMNAFEIEALMDEEIETHEQECEVPAGSLAMVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+ +  +    LG  I  ++ GT LGI+L+Y   +PL + ++    +  ++   
Sbjct: 181 VMGVVHALASADRPAAELGALIAHAMVGTFLGILLAYGFISPLATLLRQQSAETTKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           +K  L++ +NG  PQ+A+E+GRK L  +ERPS   + + V +       +
Sbjct: 241 IKVTLLSSLNGYAPQIAVEFGRKTLYTTERPSFIELEEHVRRVKSPAPQA 290


>gi|302878238|ref|YP_003846802.1| MotA/TolQ/ExbB proton channel [Gallionella capsiferriformans ES-2]
 gi|302581027|gb|ADL55038.1| MotA/TolQ/ExbB proton channel [Gallionella capsiferriformans ES-2]
          Length = 284

 Score =  264 bits (674), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 91/282 (32%), Positives = 157/282 (55%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  +    + GGF   GG+   L QP E++++ G  +G F + N +  IK +   
Sbjct: 1   MLVIVGYVVVCGSVFGGFAMAGGHLGALWQPLELLMIFGGAMGAFCVGNNMTAIKATVKD 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +DTY +++ L+Y L+  ++K      E  ++ P  S +F+  P +L ++
Sbjct: 61  LPSLFKGSKYSKDTYMELMALMYELLTKVRKEGLMSIEGDVEKPEESPVFSKYPKILSDH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FI DY+R+++ GN  + EIENLMD E++   +E L   H I+ + + +PA GIV A
Sbjct: 121 HVVEFITDYLRIMVSGNLNAMEIENLMDVELETHHHEALVSSHVIAKLADGMPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  M ++   P  LG  I  +L GT LGI+L+Y    PL S ++    +  +++  
Sbjct: 181 VMGVVHTMESVGMPPAELGMLIAHALVGTFLGILLAYGFVGPLASLLEQKAEEGGKIFQT 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQ 282
           +K  L+A +NG  P +A+E+GRK L   +RP+   + + V Q
Sbjct: 241 IKVTLLANLNGYAPAMAVEFGRKALSSGDRPNFTELEEHVKQ 282


>gi|37525778|ref|NP_929122.1| flagellar motor protein MotA [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36785207|emb|CAE14142.1| chemotaxis protein [Photorhabdus luminescens subsp. laumondii TTO1]
          Length = 295

 Score =  264 bits (674), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 98/288 (34%), Positives = 162/288 (56%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++G  +    +IGG+  +GG+   L QP E +I+ GAG+G F++ N  K IK +   
Sbjct: 1   MLVLLGYIVVFGAVIGGYLIVGGHLGALYQPAEFLIITGAGIGAFIVGNNGKAIKATLRV 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L ++       +  Y D++ LL+ L+   +       E  I+ P  S IFT  P +L++ 
Sbjct: 61  LPKVMRRSKYNKVMYMDLMALLFRLLAKSRMHGVLALERDIEHPQQSDIFTQYPRLLKDK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FI DYMR+I+ GN   +EIE LMDEEI+    E   P  ++  +G+SLPA GIV A
Sbjct: 121 HLMDFITDYMRLIVSGNMNPHEIEALMDEEIETYEQESEIPATSLMMVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+G+  +    LG  I  ++ GT LGI+L+Y   +PL + ++    +  ++   
Sbjct: 181 VMGVVNALGSADRPAGELGVLIAHAMVGTFLGILLAYGFISPLATLLRQRSGEHLKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
           +K  L++ +NG  PQ+A+E+GRK L L++RPS   + + V +     +
Sbjct: 241 IKVTLLSSLNGYAPQIAVEFGRKTLYLTDRPSFTELEEHVRRVKAPVQ 288


>gi|309778973|ref|ZP_07673743.1| chemotaxis protein MotA [Ralstonia sp. 5_7_47FAA]
 gi|308922320|gb|EFP67947.1| chemotaxis protein MotA [Ralstonia sp. 5_7_47FAA]
          Length = 286

 Score =  264 bits (674), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 98/286 (34%), Positives = 163/286 (56%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   IG  + +  + GG+   GG+   L QP E++I+ GAG+G FV+ N  K I  +  +
Sbjct: 1   MLVAIGYIVILASVFGGYMLAGGHLGPLFQPTELLIIFGAGIGAFVVGNDKKAINATVKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y +V+ LLY+++  +++      E  I++P+ S +F + P +  ++
Sbjct: 61  LPGLFKGSKYTKALYMEVMALLYVVLSKIRREGMMSIEADIENPHESALFANYPAIQADH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               FICDY+R+++ GN   ++IE LMD+EID   +E  +P   I+ +G+++PA GIV A
Sbjct: 121 HALDFICDYLRLMVGGNLNPFQIEALMDQEIDTHHHEAEQPARIITKVGDAMPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  MG++   P  LG  I  +L GT LGI+L+Y    PL S ++    +  +L+  
Sbjct: 181 VMGVVHTMGSVGLPPAELGKLIASALVGTFLGILLAYGFIGPLGSLLEQRAEESTKLFQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHN 286
           +K  L+A MNG  P +A+E+GRKVL  +ERPS   +   V      
Sbjct: 241 MKVTLLASMNGYAPAIAVEFGRKVLFSTERPSFAELEDHVRGAKTA 286


>gi|17549630|ref|NP_522970.1| flagellar motor protein MotA [Ralstonia solanacearum GMI1000]
 gi|83747600|ref|ZP_00944637.1| Probable chemotaxis motA protein [Ralstonia solanacearum UW551]
 gi|207725017|ref|YP_002255414.1| chemotaxis protein (motility protein a) [Ralstonia solanacearum
           MolK2]
 gi|207738643|ref|YP_002257036.1| chemotaxis protein (motility protein a) [Ralstonia solanacearum
           IPO1609]
 gi|300697988|ref|YP_003748649.1| MotA: chemotaxis protein; proton conductor component of flagella
           motor, torque generator [Ralstonia solanacearum
           CFBP2957]
 gi|17431884|emb|CAD18562.1| probable chemotaxis (motility protein a) transmembrane [Ralstonia
           solanacearum GMI1000]
 gi|83725780|gb|EAP72921.1| Probable chemotaxis motA protein [Ralstonia solanacearum UW551]
 gi|206590246|emb|CAQ37207.1| chemotaxis protein (motility protein a) [Ralstonia solanacearum
           MolK2]
 gi|206592011|emb|CAQ58917.1| chemotaxis protein (motility protein a) [Ralstonia solanacearum
           IPO1609]
 gi|299074712|emb|CBJ54270.1| MotA: chemotaxis protein; proton conductor component of flagella
           motor, torque generator [Ralstonia solanacearum
           CFBP2957]
          Length = 286

 Score =  264 bits (674), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 99/286 (34%), Positives = 163/286 (56%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   IG  + +  + GG+   GG+   L QP E++I+ GAG+G FV+ N  K I  +  S
Sbjct: 1   MLVAIGYIVILASVFGGYMLAGGHLGPLFQPTELLIIFGAGVGAFVVGNDKKAINATVKS 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y +V+ LLY+++  +++      E  I+ P+ S +F++ P +  ++
Sbjct: 61  LPGLFKGSKYTKALYMEVMALLYVMLSKIRREGMMSIEADIESPHESALFSNYPAIQADH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               FICDY+R+++ GN   ++IE LMD+EID   +E  +P   I+ +G+++PA GIV A
Sbjct: 121 HALDFICDYLRLMVGGNLNPFQIEALMDQEIDTHHHEAEQPARIITKVGDAMPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  MG++   P  LG  I  +L GT LGI+L+Y    PL S ++    +  +L+  
Sbjct: 181 VMGVVHTMGSVGLPPAELGKLIASALVGTFLGILLAYGFIGPLGSLLEQRAEESTKLFQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHN 286
           +K  L+A MNG  P +A+E+GRKVL  +ERPS   +   V      
Sbjct: 241 IKVTLLASMNGYAPAIAVEFGRKVLFSTERPSFAELEDHVRGAKTA 286


>gi|319944148|ref|ZP_08018426.1| chemotaxis MotA protein [Lautropia mirabilis ATCC 51599]
 gi|319742642|gb|EFV95051.1| chemotaxis MotA protein [Lautropia mirabilis ATCC 51599]
          Length = 285

 Score =  264 bits (674), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 102/285 (35%), Positives = 159/285 (55%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  IIG  + +  +IGG+   GG+   L QP E++++ GA  G F++ANP K +K    +
Sbjct: 1   MFVIIGYIVVVASVIGGYAMAGGHVSALFQPLELLMIGGAAFGAFIVANPGKDLKACMAA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      ++ Y  V+ +LY ++   +K      EN ++ P +S +FT  P +L ++
Sbjct: 61  LPSVFKGSKYTKERYLSVMAMLYDILSKARKEGLMAIENDVEQPESSPLFTRYPDLLADH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  F+ DY+RM+I GN  + EIENLMD E++   +E + P H+I  M + LPA GIV A
Sbjct: 121 HLIEFVTDYLRMMISGNLNALEIENLMDNEMETHHHEAMVPAHSIQKMADGLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  MG++ Q P ILG  I  +L GT LGI+++Y    PL   +     +  +    
Sbjct: 181 VMGVVHTMGSVGQPPAILGEMIAHALVGTFLGILMAYGFVGPLADVLTQKTNEAAKELQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           VK  L+A M G  P + +E+GRKVL  +ERP    +   V Q   
Sbjct: 241 VKVTLLASMQGYAPAICVEFGRKVLYSTERPGFAELEGHVKQKRA 285


>gi|149928471|ref|ZP_01916706.1| putative chemotaxis (motility protein A) transmembrane [Limnobacter
           sp. MED105]
 gi|149822805|gb|EDM82056.1| putative chemotaxis (motility protein A) transmembrane [Limnobacter
           sp. MED105]
          Length = 328

 Score =  264 bits (674), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 100/286 (34%), Positives = 159/286 (55%), Gaps = 1/286 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   IG  I I  ++GGF  MGG+   L QP E++I+ G  LG F+++N   ++K +G +
Sbjct: 42  MLVAIGFVIVIFSVLGGFAFMGGHLVTLWQPVEVLIIGGGALGAFIVSNTPSILKATGKA 101

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L   F   A+ +  Y  ++ L+Y ++  ++K      E  +++P  S +F   P VL ++
Sbjct: 102 LGGAFKPSAITKAFYMSLMALMYEILTKVRKEGLMSIEGDVEEPEQSPLFQKYPEVLADH 161

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  F+ DY+R+++ GN    EIENLMD E++    E   P  A+  M + LPA GIV A
Sbjct: 162 HIVEFLTDYLRLMVSGNLNPMEIENLMDGELETHHQEAHTPQSAVQQMADGLPAFGIVAA 221

Query: 181 ILGIIKAMGNLSQ-SPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYI 239
           ++G++  MG++ Q S   LG  I  +L GT LGI+L+Y    PL S I     +  + + 
Sbjct: 222 VMGVVHVMGSVGQVSNAELGVMIAAALVGTFLGILLAYGFVGPLASIINHKIAESSKPFE 281

Query: 240 IVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
            VK  L+A +NG  P +A+E+GRKVL  +ERP+   + + V     
Sbjct: 282 CVKTTLLASLNGYSPALAVEFGRKVLYSTERPTFIELEEHVKSTKG 327


>gi|325981671|ref|YP_004294073.1| flagellar motor stator protein MotA [Nitrosomonas sp. AL212]
 gi|325531190|gb|ADZ25911.1| flagellar motor stator protein MotA [Nitrosomonas sp. AL212]
          Length = 286

 Score =  264 bits (674), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 101/286 (35%), Positives = 164/286 (57%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   +G  I I+ + GGF   GG+   L QP E++++ G  +G FV+ N  K +K +  +
Sbjct: 1   MLVSVGYLIIIISVFGGFALAGGHLASLWQPVEVLMIGGGAIGAFVVGNSNKALKATMKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y D++ LLY ++  ++K      E  +DDP NS IFT  P +L ++
Sbjct: 61  LPTVFKGSKYTKALYMDLMTLLYEVLGKIRKEGLMSIEGDVDDPSNSPIFTKYPNILADH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +T FI DY+R+++ GN  S EIE+LMD E++    E   P H ++ +G+ LPA GIV A
Sbjct: 121 HITEFITDYLRLMVGGNLNSLEIESLMDSELETHHQEGEVPVHVVAKLGDGLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  M ++   P  LG  I  +L GT LGI+L+Y   +PL  +++    +  +++  
Sbjct: 181 VMGVVHTMESVHLPPAELGVLIAAALVGTFLGILLAYGFVSPLAGKLEHNLHESSKMFEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHN 286
           +K  L+A +NG  P +A+E+GRKVL  +ERPS   + + V Q    
Sbjct: 241 IKITLLANLNGYSPVLAVEFGRKVLFTTERPSFLELEEHVKQSKSR 286


>gi|293395564|ref|ZP_06639847.1| lateral flagellar motor protein MotA [Serratia odorifera DSM 4582]
 gi|291421883|gb|EFE95129.1| lateral flagellar motor protein MotA [Serratia odorifera DSM 4582]
          Length = 298

 Score =  264 bits (674), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 95/289 (32%), Positives = 167/289 (57%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
             I+G  + +  + GG+  +GG+   L QP E +I+ GAG+G F++ N  K IK +  +L
Sbjct: 4   LVILGYLVVLGAVFGGYMIVGGHLGALYQPAEFLIIGGAGVGAFIVGNNGKAIKSTLRAL 63

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
            ++       ++ Y D++ LL+ L+   ++      E  ID+P  S IF++ P +L +N 
Sbjct: 64  PKLMRRSKYSKELYMDLMALLFRLLAKSRQQGMLSLEFDIDNPQESEIFSNYPRILADNH 123

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
           L  FI DY+R+++ GN  ++EIE LMDEEI+    E   P  +++ +G+SLPA GIV A+
Sbjct: 124 LVEFITDYLRLMVSGNMNAFEIEALMDEEIETFEQESEVPAGSLAMVGDSLPAFGIVAAV 183

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           +G++ A+ +  +    LG  I  ++ GT LGI+L+Y   +PL + ++    +  ++   +
Sbjct: 184 MGVVHALASADRPAAELGALIANAMVGTFLGILLAYGFISPLATLLRQKSAENVKMMQCI 243

Query: 242 KKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           K  L++ +NG  PQ+A+E+GRK L  +ERPS   + + V +     + +
Sbjct: 244 KVTLLSSLNGYAPQIAVEFGRKTLYTTERPSFVELEEHVRRVKAPAQTA 292


>gi|126417354|gb|ABO13879.1| MotA [Ralstonia solanacearum]
          Length = 286

 Score =  263 bits (673), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 98/286 (34%), Positives = 163/286 (56%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   IG  + +  + GG+   GG+   L QP E++I+ GAG+G FV+ N  K I  +  +
Sbjct: 1   MLVAIGYIVILASVFGGYMLAGGHLGPLFQPTELLIIFGAGVGAFVVGNDKKAINATVKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y +V+ LLY+++  +++      E  I+ P+ S +F++ P +  ++
Sbjct: 61  LPGLFKGSKYTKALYMEVMALLYVMLSKIRREGMMSIEADIESPHESALFSNYPAIQADH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               FICDY+R+++ GN   ++IE LMD+EID   +E  +P   I+ +G+++PA GIV A
Sbjct: 121 HALDFICDYLRLMVGGNLNPFQIEALMDQEIDTHHHEAEQPARIITKVGDAMPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  MG++   P  LG  I  +L GT LGI+L+Y    PL S ++    +  +L+  
Sbjct: 181 VMGVVHTMGSVGLPPAELGKLIASALVGTFLGILLAYGFIGPLGSLLEQRAEESTKLFQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHN 286
           +K  L+A MNG  P +A+E+GRKVL  +ERPS   +   V      
Sbjct: 241 IKVTLLASMNGYAPAIAVEFGRKVLFSTERPSFAELEDHVRGAKTA 286


>gi|238788296|ref|ZP_04632090.1| hypothetical protein yfred0001_7390 [Yersinia frederiksenii ATCC
           33641]
 gi|238723542|gb|EEQ15188.1| hypothetical protein yfred0001_7390 [Yersinia frederiksenii ATCC
           33641]
          Length = 295

 Score =  263 bits (672), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 95/290 (32%), Positives = 164/290 (56%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  + +  + GG+  +GG+   L QP E +I+ GAG+G F++ N  K IK +  +
Sbjct: 1   MLVILGYIVVLGAVFGGYIIVGGHLGALYQPAEFLIIGGAGIGAFIVGNNGKAIKATMKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           + ++       +  Y D++ LLY L+   ++      E  I+ P  S IF++ P +L + 
Sbjct: 61  MPKLMRRSKYNKVLYMDLMALLYRLLAKSRQQGMLSLERDIESPLESEIFSNYPRILADK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FI DY+R+I+ GN  ++EIE LMDEEI+    E   P  +++ +G+SLPA GIV A
Sbjct: 121 VLVEFITDYLRLIVSGNMNAFEIEALMDEEIETHEQECEVPAGSLAMVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+ +  +    LG  I  ++ GT LGI+L+Y   +PL + ++    +  ++   
Sbjct: 181 VMGVVHALASADRPAAELGALIAHAMVGTFLGILLAYGFISPLATLLRQQSAETTKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           +K  L++ +NG  PQ+A+E+GRK L  +ERPS   + + V +       +
Sbjct: 241 IKVTLLSSLNGYAPQIAVEFGRKTLYTTERPSFIELEEHVRRVKAPAPQA 290


>gi|253990167|ref|YP_003041523.1| flagellar motor protein MotA [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253781617|emb|CAQ84780.1| chemotaxis mota protein [Photorhabdus asymbiotica]
          Length = 295

 Score =  263 bits (672), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 98/286 (34%), Positives = 162/286 (56%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++G  +    +IGG+  +GG+   L QP E +I+ GAG+G F++ N  K IK +   
Sbjct: 1   MLVLLGYIVVFGAVIGGYLIVGGHLGALYQPAEFLIITGAGIGAFIVGNNGKAIKATLRV 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L ++       +  Y D++ LL+ L+   ++      E  I+ P  S IFT  P +L++ 
Sbjct: 61  LPKVMRRSKYNKVMYMDLMALLFRLLAKSRQHGVLALERDIEHPQQSDIFTQYPRLLKDK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FI DYMR+I+ GN   +EIE LMDEEI+    E   P  ++  +G+SLPA GIV A
Sbjct: 121 HLMDFITDYMRLIVSGNMNPHEIEALMDEEIETYEQESEIPATSLMMVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+G+  +    LG  I  ++ GT LGI+L+Y   +PL + ++    +  ++   
Sbjct: 181 VMGVVNALGSADRPAGELGALIAHAMVGTFLGILLAYGFISPLATLLRQRSGEHIKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHN 286
           +K  L++ +NG  PQ+A+E+GRK L L++RPS   + + V +    
Sbjct: 241 IKVTLLSSLNGYAPQIAVEFGRKTLYLTDRPSFTELEEHVRRVKAP 286


>gi|238785461|ref|ZP_04629445.1| hypothetical protein yberc0001_17850 [Yersinia bercovieri ATCC
           43970]
 gi|238713616|gb|EEQ05644.1| hypothetical protein yberc0001_17850 [Yersinia bercovieri ATCC
           43970]
          Length = 295

 Score =  263 bits (672), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 95/290 (32%), Positives = 163/290 (56%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  + +  + GG+  +GG+   L QP E +I+ GAG+G F+  N  K IK +  +
Sbjct: 1   MLVILGYIVVLGAVFGGYMIVGGHLGALYQPAEFLIIGGAGIGAFIAGNNGKAIKATMKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  +       +  Y D++ LLY L+   ++      E  I++P  S IF++ P +L + 
Sbjct: 61  MPRLMRRSKYNKVLYMDLMALLYRLLAKSRQQGMLSLERDIENPRESEIFSNYPRILADK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FI DY+R+I+ GN  ++EIE LMDEEI+    E   P  +++ +G+SLPA GIV A
Sbjct: 121 ILVEFITDYLRLIVSGNMNAFEIEALMDEEIETHEQECEVPAGSLAMVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+ +  +    LG  I  ++ GT LGI+L+Y   +PL + ++    +  ++   
Sbjct: 181 VMGVVHALASADRPAAELGALIAHAMVGTFLGILLAYGFISPLATLLRQQSAETTKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           +K  L++ +NG  PQ+A+E+GRK L  +ERPS   + + V +       +
Sbjct: 241 IKVTLLSSLNGYAPQIAVEFGRKTLYTTERPSFIELEEHVRRVKAPVPQA 290


>gi|238795042|ref|ZP_04638636.1| hypothetical protein yinte0001_4560 [Yersinia intermedia ATCC
           29909]
 gi|238725643|gb|EEQ17203.1| hypothetical protein yinte0001_4560 [Yersinia intermedia ATCC
           29909]
          Length = 295

 Score =  263 bits (672), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 96/290 (33%), Positives = 164/290 (56%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  + +  + GG+  +GGN   L QP E +I+ GAG+G F++ N  K IK +  +
Sbjct: 1   MLVILGYIVVLGAVFGGYMIVGGNLGALYQPAEFLIIGGAGVGAFIVGNNGKAIKATIKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           + ++       +  Y D++ LLY L+   ++      E  I+ P  S IF++ P +L + 
Sbjct: 61  MPKLMRRSKYNKVLYMDLMALLYRLLAKSRQQGMLSLERDIESPRESEIFSNYPRILADK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FI DY+R+I+ GN  ++EIE LMDEEI+    E   P  +++ +G+SLPA GIV A
Sbjct: 121 LLVEFITDYLRLIVSGNMNAFEIEALMDEEIETHEQECEVPAGSLAMVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+ +  +    LG  I  ++ GT LGI+L+Y   +PL + ++    +  ++   
Sbjct: 181 VMGVVHALASADRPAAELGALIAHAMVGTFLGILLAYGFISPLATLLRQQSAETTKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           +K  L++ +NG  PQ+A+E+GRK L  +ERPS   + + V +       +
Sbjct: 241 IKVTLLSSLNGYAPQIAVEFGRKTLYTTERPSFIELEEHVRRVKAPAPQA 290


>gi|239834450|ref|ZP_04682778.1| flagellar motor protein MotA [Ochrobactrum intermedium LMG 3301]
 gi|239822513|gb|EEQ94082.1| flagellar motor protein MotA [Ochrobactrum intermedium LMG 3301]
          Length = 328

 Score =  263 bits (672), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 154/290 (53%), Positives = 209/290 (72%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           +  I+GL IT+ C++GGF AMGG+  +LIQP+E VI+ GA LG F +ANP  ++KD+G +
Sbjct: 39  LGIIVGLVITLGCMLGGFIAMGGHVSVLIQPWEFVIILGAALGTFFIANPFSLVKDTGRA 98

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            +E F      Q  Y DVL +LY LM  L+  SRNE E HID+P  S IF + P+VL+  
Sbjct: 99  CMEAFSNAVPKQRDYLDVLGVLYSLMRELRAKSRNEVEVHIDNPKESPIFQAYPSVLKKE 158

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +LT FICDY R+IIVGN RS+EIE LMDEEI  I  +KLKPYHA+  + E+LPA+GIV A
Sbjct: 159 DLTNFICDYCRLIIVGNVRSHEIEALMDEEIHTIARDKLKPYHAMVSISEALPALGIVAA 218

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKAMG L QSP++LG  IG +L GT  GI  SY +  P+ ++IKSTR K +RLYI+
Sbjct: 219 VLGVIKAMGALDQSPEVLGHLIGAALVGTFAGIFFSYGVVGPIAAKIKSTREKNNRLYIV 278

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK+ L+AYMNG++PQ+A+EYGRK +   +RP+I++V QE +     ++A+
Sbjct: 279 VKQTLLAYMNGSLPQIAVEYGRKTISAYDRPTIDVVEQETMASAATQQAA 328


>gi|114330217|ref|YP_746439.1| flagellar motor protein MotA [Nitrosomonas eutropha C91]
 gi|114307231|gb|ABI58474.1| putative chemotaxis (motility protein A) transmembrane
           [Nitrosomonas eutropha C91]
          Length = 286

 Score =  263 bits (671), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 106/285 (37%), Positives = 161/285 (56%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   IG  I I+ + GGF   GG+   L QP E++++AGA LG F + N  K IK +  +
Sbjct: 1   MLVTIGYLIVIVSVFGGFALAGGHLGSLFQPVELLMIAGAALGAFFVGNSGKAIKATFKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y +++ LLY ++  ++K      E  +DDP  S +FT  P +L ++
Sbjct: 61  LPGVFQGARYTKVVYMELMTLLYEVLGKIRKEGLMSIEADVDDPAKSPLFTKYPKILSDH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               FI DY+R+++ GN    EIENLMD EI+    E   P H I  MG++LPA GIV A
Sbjct: 121 HAIEFITDYLRLMVGGNLNPLEIENLMDGEIETHHQEGEVPVHVIGKMGDALPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  M ++   P  LG  I  +L GT LGI+L+Y   +PL S+++    +  +L   
Sbjct: 181 VMGVVHTMASVGIPPAELGKLIAAALVGTFLGILLAYGFVSPLASRLEQRLHESSKLLEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           +K  L+A +NG  P +A+E+GRKVL  +ERPS   + + V Q   
Sbjct: 241 IKVTLLANLNGYAPALAVEFGRKVLFSTERPSFIELEKHVKQSKA 285


>gi|238756397|ref|ZP_04617707.1| hypothetical protein yruck0001_10360 [Yersinia ruckeri ATCC 29473]
 gi|238705370|gb|EEP97777.1| hypothetical protein yruck0001_10360 [Yersinia ruckeri ATCC 29473]
          Length = 295

 Score =  263 bits (671), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 97/290 (33%), Positives = 167/290 (57%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  + +  + GG+  +GG+   L QP E +I+AGAG+G F++ N  K IK +  +
Sbjct: 1   MLVILGYIVVLGAVFGGYMMVGGHLGALYQPSEFLIIAGAGIGAFIVGNNGKAIKATLRA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           + ++       +  Y D++ LLY L+   ++      E  I++P  S IF++ P +L +N
Sbjct: 61  MPKLLRRSKYNKVLYMDLMALLYRLLAKSRQQGMLSLERDIENPQESEIFSNYPRILADN 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FI DY+R+I+ GN  ++EIE LMDEEI+    E   P  +++ +G+SLPA GIV A
Sbjct: 121 ILVEFITDYLRLIVSGNMNAFEIEALMDEEIETYEQESEVPAGSLAMVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+ +  +    LG  I  ++ GT LGI+L+Y   +PL + ++    +  ++   
Sbjct: 181 VMGVVHALASADRPAAELGALIAHAMVGTFLGILLAYGFISPLATLLRQQNAETTKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           +K  L++ +NG  PQ+A+E+GRK L  +ERPS   + + V +       +
Sbjct: 241 IKVTLLSSLNGYAPQIAVEFGRKTLYTTERPSFIELEEHVRRVKSPAPQA 290


>gi|330821028|ref|YP_004349890.1| Flagellar motor component-like protein [Burkholderia gladioli BSR3]
 gi|327373023|gb|AEA64378.1| Flagellar motor component-like protein [Burkholderia gladioli BSR3]
          Length = 288

 Score =  263 bits (671), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 99/287 (34%), Positives = 158/287 (55%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   IG  + +  +IG F  +GG+   L+QPFE++ + GA  G FV++NP   +  +  S
Sbjct: 1   MFVAIGWIVVLASVIGSFVGVGGHLPALLQPFELLCIFGAAAGAFVVSNPRDTLGKTLKS 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L   F   +  +  Y +++ LLY L+   ++      E+ I++P NS +F   P VL ++
Sbjct: 61  LPSCFKSTSYTKTQYLELIALLYELLQKARRDGMLSLESDIENPANSPLFQKYPHVLGDH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FI DY+RM+  GN    E+++LMDEE++    E      AI  M + LPA GIV A
Sbjct: 121 HLLDFIIDYLRMMSTGNLNPLEMQDLMDEELETHHAEVSVAPSAIQKMADGLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  MG++   P  LG  I  +L GT LGI+L+Y    PL   + +      + +  
Sbjct: 181 VMGVVHTMGSVGAPPAELGKMIAGALVGTFLGILLAYGFVGPLADLLNAKGRNSAKPFHC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
           VK  L+A ++G  P VA+E+GRKVL  ++RPS + + + V     +K
Sbjct: 241 VKAVLLASLSGYAPAVAVEFGRKVLFTADRPSFQELDEAVRATKTSK 287


>gi|238764368|ref|ZP_04625318.1| hypothetical protein ykris0001_37310 [Yersinia kristensenii ATCC
           33638]
 gi|238697394|gb|EEP90161.1| hypothetical protein ykris0001_37310 [Yersinia kristensenii ATCC
           33638]
          Length = 295

 Score =  263 bits (671), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 95/290 (32%), Positives = 165/290 (56%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  + +  + GG+  +GG+   L QP E +I+ GAG+G F++ N  K IK +   
Sbjct: 1   MLVILGYIVVLGAVFGGYIIVGGHLGALYQPAEFLIIGGAGIGAFIVGNNGKAIKATLKV 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           + ++       +  Y D++ LLY L+   ++      E  I+ P  S IF++ P +L + 
Sbjct: 61  MPKLMRRSKYNKVLYMDLMALLYRLLAKSRQQGMLSLERDIESPLESEIFSNYPRILADK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FI DY+R+I+ GN  ++EIE LMDEEI+    E   P  +++ +G+SLPA GIV A
Sbjct: 121 LLVEFITDYLRLIVSGNMNAFEIEALMDEEIETHEQECEIPAGSLAMVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+ +  +    LG  I  ++ GT LGI+L+Y   +PL + ++    + +++   
Sbjct: 181 VMGVVHALASADRPAAELGALIAHAMVGTFLGILLAYGFISPLATLLRQQSAETNKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           +K  L++ +NG  PQ+A+E+GRK L  +ERPS   + + V +     + +
Sbjct: 241 IKVTLLSSLNGYAPQIAVEFGRKTLYTTERPSFIELEEHVRRVKAPAQQA 290


>gi|300312290|ref|YP_003776382.1| flagellar motor component protein [Herbaspirillum seropedicae SmR1]
 gi|300075075|gb|ADJ64474.1| flagellar motor component protein [Herbaspirillum seropedicae SmR1]
          Length = 286

 Score =  262 bits (670), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 100/285 (35%), Positives = 165/285 (57%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  IIG  + +  + GGF   GG+   L QP E++++ GA  G F++ N  K IK +  +
Sbjct: 1   MLVIIGYIVVMASVFGGFAMAGGHLGALFQPIELLMIGGAAGGAFLVGNNGKAIKATLKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F   A  +  Y +++ LL+ ++   +K      E  I++P +S IF+  P VL ++
Sbjct: 61  LPTVFKGSAYTKALYMELMALLFEILTKSRKEGLMSIEGDIEEPESSPIFSKYPGVLADH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  F+ DY+R+++ GN  +++IENLMD EI+   +E   P H I+ +G+ +PA GIV A
Sbjct: 121 HLIEFMTDYLRLMVSGNMDAFQIENLMDNEIETHHHEGEIPVHCIAKLGDGMPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  M ++   P  LG  I  +L GT LGI+L+Y    PL+S ++    +  ++Y  
Sbjct: 181 VMGVVHTMESVGIPPSELGMLIAHALVGTFLGILLAYGFVGPLSSLLEQKLHESTKIYQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           VK  L+A +NG  P ++IE+GRKVL  +ERP+   + + V Q   
Sbjct: 241 VKVTLLASLNGYAPALSIEFGRKVLFSTERPTFLELEEHVKQARG 285


>gi|299069797|emb|CBJ41077.1| MotA: chemotaxis protein; proton conductor component of flagella
           motor, torque generator [Ralstonia solanacearum CMR15]
          Length = 286

 Score =  262 bits (669), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 99/286 (34%), Positives = 162/286 (56%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   IG  + +  + GG+   GG+   L QP E++I+ GAG+G FV+ N  K I  +  S
Sbjct: 1   MLVAIGYIVILASVFGGYMLAGGHLGPLFQPTELLIIFGAGVGSFVVGNDKKAINATVKS 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y +V+ LLY+++  +++      E  I+ P+ S +F + P +  ++
Sbjct: 61  LPGLFKGSKYTKALYMEVMALLYVMLSKIRREGMMSIEADIESPHESALFANYPAIQADH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               FICDY+R+++ GN   ++IE LMD+EID   +E  +P   I+ +G+++PA GIV A
Sbjct: 121 HALDFICDYLRLMVGGNLNPFQIEALMDQEIDTHHHEAEQPARIITKVGDAMPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  MG++   P  LG  I  +L GT LGI+L+Y    PL S ++    +  +L+  
Sbjct: 181 VMGVVHTMGSVGLPPAELGKLIASALVGTFLGILLAYGFIGPLGSLLEQRAEESTKLFQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHN 286
           +K  L+A MNG  P +A+E+GRKVL  +ERPS   +   V      
Sbjct: 241 IKVTLLASMNGYAPAIAVEFGRKVLFSTERPSFAELEDHVRGAKTA 286


>gi|289207763|ref|YP_003459829.1| chemotaxis (motility protein A) transmembrane [Thioalkalivibrio sp.
           K90mix]
 gi|288943394|gb|ADC71093.1| putative chemotaxis (motility protein A) transmembrane
           [Thioalkalivibrio sp. K90mix]
          Length = 283

 Score =  262 bits (669), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 94/283 (33%), Positives = 163/283 (57%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  + +  + GGF A GG+  ++ QP+E +I+ GA LG F++ANP +V+     S
Sbjct: 1   MKYILGFLVVLFAVFGGFAAHGGDLLVIWQPYEYIIIGGAALGSFLIANPPRVVLTVFKS 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L ++       ++ Y D+L L+Y L    +K      EN I++P NS +F + P VL ++
Sbjct: 61  LPKLLQGSKYKREDYLDLLALMYKLFTKARKEGLMGVENDIEEPENSELFQAHPRVLADH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               FI DYMR+II G+   +E++ LMD +++    E  KP HA+  + ++LP  GIV A
Sbjct: 121 HAMEFITDYMRLIISGSMNPHELDALMDLDLETHHEEAHKPSHAVYRVADALPGFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGI+  MG++    +++G  +  +L G+ LGI+L+Y    P ++ +++   ++ +    
Sbjct: 181 VLGIVNTMGSIGGPIEVIGMNVAAALVGSFLGILLAYGFVGPTSAALEARAQEEGKFLQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQY 283
           VK  ++A + G  PQVA+E+GRK +  + RP+   + + V   
Sbjct: 241 VKACILANVQGYSPQVAVEFGRKTMEGAMRPTFLELEEHVKAA 283


>gi|91776292|ref|YP_546048.1| flagellar motor protein MotA [Methylobacillus flagellatus KT]
 gi|91710279|gb|ABE50207.1| putative chemotaxis transmembrane protein MotA [Methylobacillus
           flagellatus KT]
          Length = 286

 Score =  261 bits (667), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 99/286 (34%), Positives = 159/286 (55%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I G  + +  + GGF   GG+   L QP E++++ GA +G F++ N  K IK +  +
Sbjct: 1   MLVIAGYLVVLGSVFGGFAMAGGHLAALFQPIELLMIGGAAIGAFLVGNDAKAIKATLKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y D+L LL+ ++  +++      E+ ID+P  S IF+  P +L ++
Sbjct: 61  LPSVFKGSKYTKARYMDLLALLFEILTKIRRDGMMAIESDIDNPEASQIFSKYPDILADH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FICDY+R++  GN  +++IENLMD EI+   +E + P H I+ +GE +PA GIV A
Sbjct: 121 HLMDFICDYLRLMTSGNMDAFQIENLMDNEIETHHHESMVPSHCIARLGEGMPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  M ++   P  LG  I  +L GT LGI+L+Y    PL S ++    +  ++   
Sbjct: 181 VMGVVHTMESVGLPPGELGMLIAHALVGTFLGILLAYGFVGPLASLLERKADESSKMLQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHN 286
            K  L+A  N   P +A+E+GRKVL  +ERP    +   V Q    
Sbjct: 241 AKVTLLASHNSYAPAIAVEFGRKVLYSTERPEFAELEAHVKQARAR 286


>gi|22125716|ref|NP_669139.1| flagellar motor protein MotA [Yersinia pestis KIM 10]
 gi|45441603|ref|NP_993142.1| flagellar motor protein MotA [Yersinia pestis biovar Microtus str.
           91001]
 gi|108807852|ref|YP_651768.1| flagellar motor protein MotA [Yersinia pestis Antiqua]
 gi|108812128|ref|YP_647895.1| flagellar motor protein MotA [Yersinia pestis Nepal516]
 gi|149366376|ref|ZP_01888410.1| chemotaxis MotA protein [Yersinia pestis CA88-4125]
 gi|162419808|ref|YP_001607211.1| flagellar motor protein MotA [Yersinia pestis Angola]
 gi|165925431|ref|ZP_02221263.1| chemotaxis protein motA [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165938506|ref|ZP_02227063.1| chemotaxis protein motA [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|166008589|ref|ZP_02229487.1| chemotaxis protein motA [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166210492|ref|ZP_02236527.1| chemotaxis protein motA [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167401769|ref|ZP_02307260.1| chemotaxis protein motA [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167422607|ref|ZP_02314360.1| chemotaxis protein motA [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167426341|ref|ZP_02318094.1| chemotaxis protein motA [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|167466605|ref|ZP_02331309.1| chemotaxis protein motA [Yersinia pestis FV-1]
 gi|218928796|ref|YP_002346671.1| flagellar motor protein MotA [Yersinia pestis CO92]
 gi|229841655|ref|ZP_04461813.1| chemotaxis MotA protein [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229843772|ref|ZP_04463915.1| chemotaxis MotA protein [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229894515|ref|ZP_04509697.1| chemotaxis MotA protein [Yersinia pestis Pestoides A]
 gi|229902448|ref|ZP_04517567.1| chemotaxis MotA protein [Yersinia pestis Nepal516]
 gi|270490372|ref|ZP_06207446.1| flagellar motor stator protein MotA [Yersinia pestis KIM D27]
 gi|294504145|ref|YP_003568207.1| flagellar motor protein [Yersinia pestis Z176003]
 gi|21958634|gb|AAM85390.1|AE013785_3 proton conductor component of motor [Yersinia pestis KIM 10]
 gi|45436464|gb|AAS62019.1| chemotaxis MotA protein [Yersinia pestis biovar Microtus str.
           91001]
 gi|108775776|gb|ABG18295.1| chemotaxis MotA protein [Yersinia pestis Nepal516]
 gi|108779765|gb|ABG13823.1| chemotaxis MotA protein [Yersinia pestis Antiqua]
 gi|115347407|emb|CAL20309.1| chemotaxis MotA protein [Yersinia pestis CO92]
 gi|149290750|gb|EDM40825.1| chemotaxis MotA protein [Yersinia pestis CA88-4125]
 gi|162352623|gb|ABX86571.1| chemotaxis protein motA [Yersinia pestis Angola]
 gi|165913621|gb|EDR32241.1| chemotaxis protein motA [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|165922540|gb|EDR39691.1| chemotaxis protein motA [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165992971|gb|EDR45272.1| chemotaxis protein motA [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166207672|gb|EDR52152.1| chemotaxis protein motA [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166958454|gb|EDR55475.1| chemotaxis protein motA [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167048874|gb|EDR60282.1| chemotaxis protein motA [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167054696|gb|EDR64500.1| chemotaxis protein motA [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|229680494|gb|EEO76591.1| chemotaxis MotA protein [Yersinia pestis Nepal516]
 gi|229689380|gb|EEO81443.1| chemotaxis MotA protein [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229694118|gb|EEO84166.1| chemotaxis MotA protein [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229703534|gb|EEO90551.1| chemotaxis MotA protein [Yersinia pestis Pestoides A]
 gi|262362262|gb|ACY58983.1| flagellar motor protein [Yersinia pestis D106004]
 gi|262366195|gb|ACY62752.1| flagellar motor protein [Yersinia pestis D182038]
 gi|270338876|gb|EFA49653.1| flagellar motor stator protein MotA [Yersinia pestis KIM D27]
 gi|294354604|gb|ADE64945.1| flagellar motor protein [Yersinia pestis Z176003]
 gi|320014809|gb|ADV98380.1| chemotaxis MotA protein [Yersinia pestis biovar Medievalis str.
           Harbin 35]
          Length = 295

 Score =  261 bits (667), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 95/290 (32%), Positives = 166/290 (57%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  + +  + GG+  +GG+   L QP E +I+AGAG+G F++ N  K IK +  +
Sbjct: 1   MLVILGYLVVLGAVFGGYTLVGGHLGALYQPAEFLIIAGAGIGAFIVGNNGKAIKATMRA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           + ++       +  Y D++ LLY L+   ++      E  I++P  S IF++ P ++ + 
Sbjct: 61  MPKLMRRSKYNKALYMDLMALLYRLLAKSRQQGMLSLERDIENPLESEIFSNYPRIMADK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FI DY+R+I+ GN  ++EIE LMDEEI+    E   P  +++ +G+SLPA GIV A
Sbjct: 121 TLVEFITDYLRLIVSGNMNAFEIEALMDEEIETHEQESEVPAGSLAMVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+ +  +    LG  I  ++ GT LGI+L+Y   +PL + ++    +  ++   
Sbjct: 181 VMGVVHALASADRPAAELGALIAHAMVGTFLGILLAYGFISPLATLLRQQSAETTKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           +K  L++ +NG  PQ+A+E+GRK L  +ERPS   + + V +       +
Sbjct: 241 IKVTLLSSLNGYAPQIAVEFGRKTLYTTERPSFIELEEHVRRVKAPASQA 290


>gi|145599065|ref|YP_001163141.1| flagellar motor protein MotA [Yersinia pestis Pestoides F]
 gi|145210761|gb|ABP40168.1| chemotaxis MotA protein [Yersinia pestis Pestoides F]
          Length = 295

 Score =  261 bits (667), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 95/290 (32%), Positives = 166/290 (57%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  + +  + GG+  +GG+   L QP E +I+AGAG+G F++ N  K IK +  +
Sbjct: 1   MLVILGYLVVLGAVFGGYTLVGGHLGALYQPAEFLIIAGAGIGAFIVGNNGKAIKATMRA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           + ++       +  Y D++ LLY L+   ++      E  I++P  S IF++ P ++ + 
Sbjct: 61  MPKLIRRSKYNKALYMDLMALLYRLLAKSRQQGMLSLERDIENPLESEIFSNYPRIMADK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FI DY+R+I+ GN  ++EIE LMDEEI+    E   P  +++ +G+SLPA GIV A
Sbjct: 121 TLVEFITDYLRLIVSGNMNAFEIEALMDEEIETHEQESEVPAGSLAMVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+ +  +    LG  I  ++ GT LGI+L+Y   +PL + ++    +  ++   
Sbjct: 181 VMGVVHALASADRPAAELGALIAHAMVGTFLGILLAYGFISPLATLLRQQSAETTKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           +K  L++ +NG  PQ+A+E+GRK L  +ERPS   + + V +       +
Sbjct: 241 IKVTLLSSLNGYAPQIAVEFGRKTLYTTERPSFIELEEHVRRVKAPASQA 290


>gi|51596730|ref|YP_070921.1| flagellar motor protein MotA [Yersinia pseudotuberculosis IP 32953]
 gi|153948045|ref|YP_001400613.1| flagellar motor protein MotA [Yersinia pseudotuberculosis IP 31758]
 gi|170023988|ref|YP_001720493.1| flagellar motor protein MotA [Yersinia pseudotuberculosis YPIII]
 gi|186895792|ref|YP_001872904.1| flagellar motor protein MotA [Yersinia pseudotuberculosis PB1/+]
 gi|51590012|emb|CAH21645.1| chemotaxis MotA protein [Yersinia pseudotuberculosis IP 32953]
 gi|152959540|gb|ABS47001.1| chemotaxis protein motA [Yersinia pseudotuberculosis IP 31758]
 gi|169750522|gb|ACA68040.1| chemotaxis protein MotA [Yersinia pseudotuberculosis YPIII]
 gi|186698818|gb|ACC89447.1| chemotaxis protein MotA [Yersinia pseudotuberculosis PB1/+]
          Length = 295

 Score =  261 bits (667), Expect = 9e-68,   Method: Composition-based stats.
 Identities = 95/290 (32%), Positives = 166/290 (57%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  + +  + GG+  +GG+   L QP E +I+AGAG+G F++ N  K IK +  +
Sbjct: 1   MLVILGYLVVLGAVFGGYMLVGGHLGALYQPAEFLIIAGAGIGAFIVGNNGKAIKATMRA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           + ++       +  Y D++ LLY L+   ++      E  I++P  S IF++ P ++ + 
Sbjct: 61  MPKLMRRSKYNKALYMDLMALLYRLLAKSRQQGMLSLERDIENPLESEIFSNYPRIMADK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FI DY+R+I+ GN  ++EIE LMDEEI+    E   P  +++ +G+SLPA GIV A
Sbjct: 121 TLVEFITDYLRLIVSGNMNAFEIEALMDEEIETHEQESEVPAGSLAMVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+ +  +    LG  I  ++ GT LGI+L+Y   +PL + ++    +  ++   
Sbjct: 181 VMGVVHALASADRPAAELGALIAHAMVGTFLGILLAYGFISPLATLLRQQSAETTKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           +K  L++ +NG  PQ+A+E+GRK L  +ERPS   + + V +       +
Sbjct: 241 IKVTLLSSLNGYAPQIAVEFGRKTLYTTERPSFIELEEHVRRVKAPASQA 290


>gi|307726279|ref|YP_003909492.1| flagellar motor component-like protein [Burkholderia sp. CCGE1003]
 gi|307586804|gb|ADN60201.1| flagellar motor component-like protein [Burkholderia sp. CCGE1003]
          Length = 294

 Score =  261 bits (667), Expect = 9e-68,   Method: Composition-based stats.
 Identities = 100/290 (34%), Positives = 158/290 (54%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   IG  + I  +IG F  +GG+   LIQPFE++ + GA +G FV++NP   +K +  +
Sbjct: 1   MFVAIGWVLVIGSVIGSFVGVGGHLPALIQPFELLCIFGAAIGAFVVSNPTSTLKKTLKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +   F      ++ Y +++ LLY L+   +K      E  +  P  S IF   P VL ++
Sbjct: 61  IPSCFKGGGYTKEKYLELIALLYELLQKARKEGMMSLEADVFAPEESVIFQKYPHVLADH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FI DY+RM+  GN    E+++LMDEE+     E     +AI  M + LPA GIV A
Sbjct: 121 HLLDFIVDYLRMMSGGNVNVLEVQDLMDEELATHHAEASVAANAIQKMADGLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  MG++   P +LG  I  +L GT LGI+L+Y    PL   + +    + + +  
Sbjct: 181 VMGVVHTMGSVGAPPAVLGEMIAGALVGTFLGILLAYGFIGPLADLLNAKGRAEAKPFQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK  L+A ++G  P +A+E+GRKVL  ++RPS + +   V      K A+
Sbjct: 241 VKAVLLASLSGYAPPIAVEFGRKVLFTADRPSFQELDDAVRATKSPKPAA 290


>gi|209547921|ref|YP_002279838.1| flagellar motor protein MotA [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209533677|gb|ACI53612.1| chemotaxis motility protein [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 290

 Score =  261 bits (666), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 171/290 (58%), Positives = 220/290 (75%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M+ IIG  +T  C+IG F AMGG+   L QPFE VI+ GAGLG F+MANP+KV+KDSG +
Sbjct: 1   MNIIIGFIVTCGCVIGSFMAMGGHVDALFQPFEFVIIGGAGLGSFIMANPMKVVKDSGKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L E F +    +  Y D L +LY LM +L+  SRNE E HID+P  STIF S PTVL+N 
Sbjct: 61  LGEAFKHAVPKERNYLDTLGVLYSLMRDLRTKSRNEIEAHIDNPAESTIFQSAPTVLKNK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           ELT FICDY+R+II+GNARS+EIE LMDEE++ I+++K+KPYHAI  MG+S PAIGIV A
Sbjct: 121 ELTAFICDYVRLIIIGNARSHEIEALMDEELNTIMHDKMKPYHAIQIMGDSFPAIGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKAM +++ SP++LG  IG +L GT LGI+LSY +C+PL SQIK  R KQHRLY+I
Sbjct: 181 VLGVIKAMAHINDSPEVLGHLIGSALVGTFLGILLSYCVCSPLVSQIKIVRNKQHRLYVI 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK+ L+AYMNG++PQVA+EYGRK +   ERPSI+ V QE++      KA+
Sbjct: 241 VKQTLLAYMNGSVPQVALEYGRKTISAYERPSIDAVEQEMMNPGGENKAA 290


>gi|190890356|ref|YP_001976898.1| chemotaxis motility protein [Rhizobium etli CIAT 652]
 gi|190695635|gb|ACE89720.1| chemotaxis motility protein [Rhizobium etli CIAT 652]
          Length = 290

 Score =  261 bits (666), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 169/290 (58%), Positives = 219/290 (75%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M+ IIG  +T  C++G F AMGG+   L QPFE VI+ GAGLG F+MANP+KV+KDSG +
Sbjct: 1   MNIIIGFIVTCGCVVGSFMAMGGHVEALFQPFEFVIIGGAGLGSFIMANPMKVVKDSGKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L E F +    +  Y D L +LY LM +L+  SRNE E HID+P  STIF   PTVL+N 
Sbjct: 61  LGEAFKHAVPKERNYLDTLGVLYSLMRDLRTKSRNEIEAHIDNPAESTIFQQAPTVLKNK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           ELT FICDY+R+II+GNARS+EIE LMDEE++ I+++K+KPYHAI  MG+S PAIGIV A
Sbjct: 121 ELTAFICDYVRLIIIGNARSHEIEALMDEELNTIMHDKMKPYHAIQIMGDSFPAIGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKAM +++ SP++LG  IG +L GT LGI+LSY +C+PL SQIK  R KQHRLY+I
Sbjct: 181 VLGVIKAMAHINDSPEVLGHLIGSALVGTFLGILLSYCVCSPLVSQIKVVRNKQHRLYVI 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK+ L+AYMNG++PQVA+EYGRK +   ERPSI+ V QE++      KA+
Sbjct: 241 VKQTLLAYMNGSVPQVALEYGRKTISAYERPSIDAVEQEMMNPGGENKAA 290


>gi|310764848|gb|ADP09798.1| Flagellar motor protein MotA [Erwinia sp. Ejp617]
          Length = 298

 Score =  260 bits (665), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 98/286 (34%), Positives = 168/286 (58%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  +IG  + I  + GGF   GG+   L QP E++I+ GAG+G F++ N +K +K +G +
Sbjct: 1   MLVVIGYLVVIATVFGGFVLSGGSLGSLFQPVELLIIGGAGIGAFIVGNNMKSLKATGRA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L+ +F  +   +  Y D++ +L++L+   +       E  I+DP NS IF++ P +L + 
Sbjct: 61  LVRLFFGRNYSKVVYMDLMAMLFLLLSKSRVQGLMSLEKDIEDPANSDIFSAYPRLLSDP 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  F+ DY R++I G+  +++IE+LMDEEI+    E   P  +++ +G++ PA GIV A
Sbjct: 121 TLINFVLDYFRLMISGSMNAHQIEDLMDEEIETCQEELEVPAQSLNTVGDAFPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+G   +    LG  I  ++ GT LGI+++Y    PL + ++     Q ++   
Sbjct: 181 VMGVVNALGAADRPAAELGMLIAHAMVGTFLGILIAYGFVLPLATVLRQKSSDQVKMLQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHN 286
           +K  L++ +NG  PQ+A+E+GRK L  SERPS E +   V +   N
Sbjct: 241 IKVTLLSSLNGYAPQIAVEFGRKTLYTSERPSFEELETHVREVKSN 286


>gi|218461632|ref|ZP_03501723.1| flagellar motor protein MotA [Rhizobium etli Kim 5]
 gi|218662603|ref|ZP_03518533.1| flagellar motor protein MotA [Rhizobium etli IE4771]
          Length = 290

 Score =  260 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 171/290 (58%), Positives = 219/290 (75%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M+ IIG  +T  C+IG F AMGG+   L QPFE VI+ GAGLG F+MANP+KV+KDSG +
Sbjct: 1   MNIIIGFIVTCGCVIGSFMAMGGHVEALFQPFEFVIIGGAGLGSFIMANPMKVVKDSGKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L E F +    +  Y D L +LY LM +L+  SRNE E HID+P  STIF   PTVL+N 
Sbjct: 61  LGEAFKHAVPKERNYLDTLGVLYSLMRDLRTKSRNEIEAHIDNPAESTIFQQAPTVLKNK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           ELT FICDY+R+II+GNARS+EIE LMDEE++ I+++K+KPYHAI  MG+S PAIGIV A
Sbjct: 121 ELTAFICDYVRLIIIGNARSHEIEALMDEELNTIMHDKMKPYHAIQIMGDSFPAIGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKAM +++ SP++LG  IG +L GT LGI+LSY LC+PL SQIK  R KQHRLY+I
Sbjct: 181 VLGVIKAMAHINDSPEVLGHLIGSALVGTFLGILLSYCLCSPLVSQIKVVRNKQHRLYVI 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK+ L+AYMNG++PQVA+EYGRK +   ERPSI+ V QE++      KA+
Sbjct: 241 VKQTLLAYMNGSVPQVALEYGRKTISAYERPSIDAVEQEMMNPGGENKAA 290


>gi|313200597|ref|YP_004039255.1| flagellar motor protein mota [Methylovorus sp. MP688]
 gi|312439913|gb|ADQ84019.1| flagellar motor protein MotA [Methylovorus sp. MP688]
          Length = 278

 Score =  260 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 94/277 (33%), Positives = 160/277 (57%)

Query: 9   ITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYK 68
           + +  + GG+   GG+   L QP E++++ G  +G F++ N  K +K +  +L  +F   
Sbjct: 1   MVLAAVFGGYALAGGHLGALWQPLEVLMIFGGAIGAFIVGNNGKALKATLGALPTLFKGS 60

Query: 69  ALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICD 128
              +  Y D+L LL+ ++  ++K      EN +++P +S +F+  P +  ++ L  FI D
Sbjct: 61  KFTKALYMDLLALLFEILSKIRKDGMMSIENDVENPESSPLFSKYPALQADHHLMEFITD 120

Query: 129 YMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAM 188
           Y+R++I GN  ++++ENLMD EI+    E   P H I+ +G+ LPA GIV A++G++  M
Sbjct: 121 YLRLMISGNMDAFQVENLMDNEIETHHQEGHVPVHCIARLGDGLPAFGIVAAVMGVVHTM 180

Query: 189 GNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAY 248
            N++  P  LG  I  +L GT LGI+L+Y    PL+S ++    +  ++Y  VK  L+A 
Sbjct: 181 ENVALPPAELGILIAHALVGTFLGILLAYGFIGPLSSLLEQKLDESTKMYQTVKATLLAS 240

Query: 249 MNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           +NG  P +A+E+GRKVL  +ERP    + + V Q   
Sbjct: 241 LNGYAPAIAVEFGRKVLYSTERPGFTELEEHVKQAKS 277


>gi|317403795|gb|EFV84275.1| chemotaxis protein MotA [Achromobacter xylosoxidans C54]
          Length = 289

 Score =  260 bits (664), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 112/289 (38%), Positives = 170/289 (58%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  +IG  + I+ +IG F A+GG+   L QPFE+ ++ GA  G F+  N  K +     +
Sbjct: 1   MLIVIGFLVVIVSVIGSFVALGGHMGALYQPFELTLIFGAAFGAFLAGNSKKSLMLVKKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L +       G+D Y +++ LLY+L+   ++      E+HI+DP +S IF+  P + ++ 
Sbjct: 61  LPDTLKSSRYGKDVYMELMALLYVLLNKARREGLMAIESHIEDPASSPIFSEYPRIAKDE 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +L  FI DY+R++I GN  S+EIE LMDEEI+   +E+  P   I  M + LPA GIV A
Sbjct: 121 KLMEFITDYLRIMISGNMSSFEIETLMDEEIETYRHEREVPASMIRQMADGLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKA+  + Q P ILG  I  ++ GT LGI+L+Y    PL S+I+    +  ++   
Sbjct: 181 VLGVIKALAAVDQPPAILGDLISKAMVGTFLGILLAYGFVGPLASRIERRTDEAMKVLEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKA 289
           +K  L+A MNG  PQ+A+E+GRKVL  S RP+   + + V Q     KA
Sbjct: 241 IKTTLLASMNGYPPQLAVEFGRKVLYSSVRPTFGELEEHVRQTKSTAKA 289


>gi|259907646|ref|YP_002648002.1| Flagellar motor protein MotA [Erwinia pyrifoliae Ep1/96]
 gi|224963268|emb|CAX54752.1| Flagellar motor protein MotA [Erwinia pyrifoliae Ep1/96]
 gi|283477489|emb|CAY73405.1| Chemotaxis protein motA (Motility protein A) [Erwinia pyrifoliae
           DSM 12163]
          Length = 298

 Score =  260 bits (664), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 98/286 (34%), Positives = 169/286 (59%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  +IG  + I  + GGF   GG+   L QP E++I+ GAG+G F++ N +K +K +G +
Sbjct: 1   MLVVIGYLVVIATVFGGFVLSGGSLSSLFQPVELLIIGGAGVGAFIVGNNMKSLKATGRA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L+ +F  ++  +  Y D++ +L++L+   +       E  I+DP NS IF++ P +L + 
Sbjct: 61  LVRLFFGRSYSKVVYMDLMAMLFLLLSKSRVQGLMSLEKDIEDPANSDIFSAYPRLLSDP 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  F+ DY R++I G+  +++IE+LMDEEI+    E   P  +++ +G++ PA GIV A
Sbjct: 121 TLINFVLDYFRLMISGSMNAHQIEDLMDEEIETCQEELEVPAQSLNTVGDAFPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+G   +    LG  I  ++ GT LGI+++Y    PL + ++     Q ++   
Sbjct: 181 VMGVVNALGAADRPAAELGMLIAHAMVGTFLGILIAYGFVLPLATVLRQKSSDQVKMLQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHN 286
           +K  L++ +NG  PQ+A+E+GRK L  SERPS E +   V +   N
Sbjct: 241 IKVTLLSSLNGYAPQIAVEFGRKTLYTSERPSFEELETHVREVKSN 286


>gi|238751744|ref|ZP_04613232.1| hypothetical protein yrohd0001_35130 [Yersinia rohdei ATCC 43380]
 gi|238710015|gb|EEQ02245.1| hypothetical protein yrohd0001_35130 [Yersinia rohdei ATCC 43380]
          Length = 295

 Score =  259 bits (663), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 96/290 (33%), Positives = 163/290 (56%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  + +  ++GG+  +GG+   L QP E +I+ GAG+G F+  N  K IK +  +
Sbjct: 1   MLVILGYIVVLGAVLGGYSIVGGHLGALYQPAEFLIIGGAGIGAFIAGNNGKAIKATIKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           + ++       +  Y D++ LLY L+   ++      E  I+ P  S IF++ P VL + 
Sbjct: 61  MPKLMRRSKYNKILYMDLMALLYRLLAKSRQQGMLSLERDIESPLESEIFSNYPRVLADK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FI DY+R+I+ GN  ++EIE LMDEEI+    E   P  +++ +G+SLPA GIV A
Sbjct: 121 LLVEFITDYLRLIVSGNMNAFEIEALMDEEIETHEQECEVPAGSLAVVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  +    +    LG  I  ++ GT LGI+L+Y   +PL + ++    +  ++   
Sbjct: 181 VMGVVNTLAAADRPAAELGALIAHAMVGTFLGILLAYGFVSPLATLLRQQSAETTKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK  L++ +NG  PQ+A+E+GRK L  +ERPS   + + V +     + +
Sbjct: 241 VKVTLLSSLNGYAPQIAVEFGRKTLYTTERPSFIELEEHVRRVKAPAQQA 290


>gi|323529506|ref|YP_004231658.1| MotA/TolQ/ExbB proton channel [Burkholderia sp. CCGE1001]
 gi|323386508|gb|ADX58598.1| MotA/TolQ/ExbB proton channel [Burkholderia sp. CCGE1001]
          Length = 294

 Score =  259 bits (663), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 99/290 (34%), Positives = 159/290 (54%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   IG  + I  +IG F  +GG+   L+QPFE++ + GA +G FV++NP+  +K +  +
Sbjct: 1   MFVAIGWVLVIGSVIGSFVGVGGHLPALVQPFELLCIFGAAIGAFVVSNPISTLKKTLRA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +   F      ++ Y +++ LLY L+   +K      E  +  P  S IF   P VL ++
Sbjct: 61  IPSCFKNGGYTKEKYLELIALLYELLQKARKEGMMSLEADVFAPEESVIFQKYPHVLADH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FI DY+RM+  GN    E+++LMDEE+     E     +AI  M + LPA GIV A
Sbjct: 121 HLLDFIVDYLRMMSGGNVNVLEVQDLMDEELATHHAEASVAANAIQKMADGLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  MG++   P +LG  I  +L GT LGI+L+Y    PL   + +    + + +  
Sbjct: 181 VMGVVHTMGSVGAPPAVLGEMIAGALVGTFLGILLAYGFIGPLADLLNAKGRAEAKPFQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK  L+A ++G  P +A+E+GRKVL  ++RPS + +   V      K A+
Sbjct: 241 VKAVLLASLSGYAPPIAVEFGRKVLFTADRPSFQELDDAVRATKTPKPAA 290


>gi|116250475|ref|YP_766313.1| flagellar motor protein MotA [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115255123|emb|CAK06197.1| putative chemotaxis motility protein [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 290

 Score =  259 bits (663), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 171/290 (58%), Positives = 220/290 (75%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M+ IIG  +T  C+IG F AMGG+   L QPFE VI+ GAGLG F+MANP+KV+KDSG +
Sbjct: 1   MNIIIGFIVTCGCVIGSFMAMGGDVNALFQPFEFVIIGGAGLGSFIMANPMKVVKDSGKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L E F +    +  Y D L +LY LM +L+  SRNE E HID+P  STIF S PTVL+N 
Sbjct: 61  LGEAFKHAVPKERNYLDTLGVLYSLMRDLRTKSRNEIEAHIDNPAESTIFQSAPTVLKNK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           ELT FICDY+R+II+GNARS+EIE LMDEE++ I+++K+KPYHAI  MG+S PAIGIV A
Sbjct: 121 ELTAFICDYVRLIIIGNARSHEIEALMDEELNTIMHDKMKPYHAIQIMGDSFPAIGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKAM +++ SP++LG  IG +L GT LGI+LSY +C+PL SQIK  R KQHRLY+I
Sbjct: 181 VLGVIKAMAHINDSPEVLGHLIGSALVGTFLGILLSYCVCSPLVSQIKVVRNKQHRLYVI 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK+ L+AYMNG++PQVA+EYGRK +   ERPSI+ V QE++      KA+
Sbjct: 241 VKQTLLAYMNGSVPQVALEYGRKTISAYERPSIDAVEQEMMNPGGENKAA 290


>gi|292489121|ref|YP_003532008.1| chemotaxis protein MotA [Erwinia amylovora CFBP1430]
 gi|292900240|ref|YP_003539609.1| motility protein A [Erwinia amylovora ATCC 49946]
 gi|291200088|emb|CBJ47214.1| chemotaxis protein (motility protein A) [Erwinia amylovora ATCC
           49946]
 gi|291554555|emb|CBA22157.1| Chemotaxis protein motA (Motility protein A) [Erwinia amylovora
           CFBP1430]
 gi|312173279|emb|CBX81534.1| Chemotaxis protein motA (Motility protein A) [Erwinia amylovora
           ATCC BAA-2158]
          Length = 298

 Score =  259 bits (663), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 98/286 (34%), Positives = 169/286 (59%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  +IG  + I  + GGF   GG+   L QP E++I+ GAG+G F++ N +K +K +G +
Sbjct: 1   MLVVIGYLVVIATVFGGFVLSGGSLGSLFQPVELLIIGGAGIGAFIVGNNMKSLKATGRA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L+ +F  ++  +  Y D++ +L++L+   +       E  I+DP NS IF++ P +L + 
Sbjct: 61  LVRLFFGRSYSKVVYMDLMAMLFLLLSKSRVQGLMSLEKDIEDPINSDIFSAYPRLLSDP 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  F+ DY R++I G+  +++IE+LMDEEI+    E   P  +++ +G++ PA GIV A
Sbjct: 121 TLINFVLDYFRLMISGSMNAHQIEDLMDEEIETCQEELEVPSQSLNTVGDAFPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+G   +    LG  I  ++ GT LGI+++Y    PL + ++     Q ++   
Sbjct: 181 VMGVVNALGAADRPAAELGMLIAHAMVGTFLGILIAYGFVLPLATVLRQKSSDQVKMLQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHN 286
           +K  L++ +NG  PQ+A+E+GRK L  SERPS E +   V +   N
Sbjct: 241 IKVTLLSSLNGYAPQIAVEFGRKTLYTSERPSFEELETHVREVKSN 286


>gi|170694366|ref|ZP_02885520.1| flagellar motor protein MotA [Burkholderia graminis C4D1M]
 gi|187925788|ref|YP_001897430.1| flagellar motor protein MotA [Burkholderia phytofirmans PsJN]
 gi|170140789|gb|EDT08963.1| flagellar motor protein MotA [Burkholderia graminis C4D1M]
 gi|187716982|gb|ACD18206.1| flagellar motor protein MotA [Burkholderia phytofirmans PsJN]
          Length = 286

 Score =  259 bits (663), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 102/285 (35%), Positives = 171/285 (60%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   +G  +T+L + GG+   GG+   L+QP E++++ GAG+G F++ N +K IK +   
Sbjct: 1   MLIFVGTLVTLLSVFGGYALEGGHLGALLQPVEVLMIVGAGVGAFILGNGMKTIKATLRV 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  +F      +D Y +++ LLY+L+   +K      E  IDDP  S IFT  P +L ++
Sbjct: 61  IPTLFKGAKYNKDVYMELMALLYVLLAKARKEGTLTLEADIDDPSKSPIFTQYPKILADH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  F+ DY+R+++ GN  ++EIE+LMDEEI+    E   P HA++ +G+++PA GIV A
Sbjct: 121 HIIEFLTDYLRLMVGGNMNAFEIESLMDEEIETHHQEGEAPAHALNKVGDAMPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  M +  + P +LG  I  +L GT LGI+LSY L  PL S  +    +  +++  
Sbjct: 181 VMGVVHTMASADKPPAVLGEMIAQALVGTFLGILLSYGLIGPLASVAEQRVTESTKMFQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           +K  ++A +NG  P +A+E+GRKVL  +ERPS   + + V +   
Sbjct: 241 IKVTILASLNGYAPAIAVEFGRKVLFSTERPSFAELEEHVRRVKA 285


>gi|307731389|ref|YP_003908613.1| flagellar motor protein MotA [Burkholderia sp. CCGE1003]
 gi|323527739|ref|YP_004229892.1| flagellar motor protein MotA [Burkholderia sp. CCGE1001]
 gi|307585924|gb|ADN59322.1| flagellar motor protein MotA [Burkholderia sp. CCGE1003]
 gi|323384741|gb|ADX56832.1| flagellar motor protein MotA [Burkholderia sp. CCGE1001]
          Length = 286

 Score =  259 bits (662), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 102/285 (35%), Positives = 171/285 (60%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   +G  +T+L + GG+   GG+   L+QP E++++ GAG+G F++ N +K IK +   
Sbjct: 1   MLIFVGTLVTLLSVFGGYALEGGHLGALLQPVEVLMIVGAGVGAFILGNGMKTIKATLRV 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  +F      +D Y +++ LLY+L+   +K      E  IDDP  S IFT  P +L ++
Sbjct: 61  IPTLFKGAKYNKDVYMELMALLYVLLAKARKEGTLTLEADIDDPSKSPIFTQYPKILADH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  F+ DY+R+++ GN  ++EIE+LMDEEI+    E   P HA++ +G+++PA GIV A
Sbjct: 121 HIIEFLTDYLRLMVGGNMNAFEIESLMDEEIETHHQEGEAPAHALTKVGDAMPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  M +  + P +LG  I  +L GT LGI+LSY L  PL S  +    +  +++  
Sbjct: 181 VMGVVHTMASADKPPAVLGEMIAQALVGTFLGILLSYGLIGPLASVAEQRVTESTKMFQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           +K  ++A +NG  P +A+E+GRKVL  +ERPS   + + V +   
Sbjct: 241 IKVTILASLNGYAPAIAVEFGRKVLFSTERPSFAELEEHVRRVKA 285


>gi|78063637|ref|YP_373545.1| flagellar motor component-like [Burkholderia sp. 383]
 gi|77971522|gb|ABB12901.1| Flagellar motor component-like protein [Burkholderia sp. 383]
          Length = 289

 Score =  259 bits (662), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 102/289 (35%), Positives = 158/289 (54%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   IG  + I  +IG F  +GG+   L+QPFE++ + GA LG FV++NP+  +K +  +
Sbjct: 1   MFVAIGWIVVIGSVIGSFVGVGGHLPALLQPFELLCIFGAALGAFVVSNPVTTLKKTIKT 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L   F      +  Y +++ LLY L+   ++      E  +D P  S +F     VLE++
Sbjct: 61  LPTCFKGGGYTKQQYVELIALLYELLQKARRDGMMALEADVDAPEQSPLFQKYSHVLEDH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FI DY+RM+  GN    E+++LMDEE+     E     +AI  M + LPA GIV A
Sbjct: 121 HLLDFIVDYLRMMSGGNVNVLEMQDLMDEELHTHHAEASVAANAIQKMADGLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  MG++   P +LG  I  +L GT LGI+L+Y    PL   + +      + +  
Sbjct: 181 VMGVVHTMGSVGAPPAVLGKMIAGALVGTFLGILLAYGFVGPLADLLNAKGRAAAKPFQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKA 289
           VK  L+A M+G  P VA+E+GRKVL  ++RPS + + + V      K A
Sbjct: 241 VKAVLLASMSGYAPPVAVEFGRKVLFTADRPSFKELDEAVRATKSPKAA 289


>gi|238919360|ref|YP_002932875.1| flagellar motor protein MotA [Edwardsiella ictaluri 93-146]
 gi|238868929|gb|ACR68640.1| chemotaxis protein MotA [Edwardsiella ictaluri 93-146]
          Length = 301

 Score =  259 bits (662), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 101/290 (34%), Positives = 170/290 (58%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++G  + ++ + GG+  +GG+   L QP E++I+ GAG+G F++ N  K IK +  +
Sbjct: 1   MLILLGYAVVLIAVFGGYTLVGGHLGALYQPSELLIIGGAGIGAFIVGNNGKAIKSTLRT 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +       +  Y DV+ L+Y L+   ++      E  I+DP  S IF++ P ++ +N
Sbjct: 61  LPRLARGSKYNKALYMDVMGLMYQLLAKSRQQGMLTLERDIEDPKESEIFSNYPRLIADN 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FI DYMR+II GN  ++EIE+LMDEEI+    E   P  +++ +G+SLPA GIV A
Sbjct: 121 TLIEFITDYMRLIISGNMNAFEIESLMDEEIETFEQEAEVPAGSLAAVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+ +  +    LG  I  ++ GT LGI+L+Y   +PL S ++    +  ++   
Sbjct: 181 VMGVVHALASADRPAAELGALIAHAMVGTFLGILLAYGFISPLASLMRQKSAETAKMMHC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           +K  L++ +NG  PQ+A+E+GRK L  +ERPS   + + V Q  +  K +
Sbjct: 241 IKTTLLSSLNGYAPQIAVEFGRKTLYSTERPSFLELEEHVRQVKYPAKQA 290


>gi|241203099|ref|YP_002974195.1| flagellar motor protein MotA [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240856989|gb|ACS54656.1| chemotaxis motility protein [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 290

 Score =  259 bits (661), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 168/290 (57%), Positives = 218/290 (75%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M+ IIG  +T  CI+G F AMGG    L QPFE +I+ GAGLG F+MANP+KV+KDSG +
Sbjct: 1   MNIIIGFIVTCGCIVGSFMAMGGEVDALFQPFEFLIIGGAGLGSFIMANPMKVVKDSGKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L E F +    +  Y D L +LY LM +L+  SRNE E HID+P  STIF S PTVL+N 
Sbjct: 61  LSEAFRHAVPKERNYLDTLGVLYSLMRDLRTKSRNEIEAHIDNPAESTIFQSAPTVLKNK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           ELT FICDY+R+II+GNARS+EIE LMDEE++ I+++K+KPYH+I  M +S PAIGIV A
Sbjct: 121 ELTAFICDYVRLIIIGNARSHEIEALMDEELNTIMHDKMKPYHSIQIMSDSFPAIGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKAM +++ SP++LG  IG +L GT LGI+LSY +C+PL SQIK  R KQHRLY+I
Sbjct: 181 VLGVIKAMAHINDSPEVLGHLIGSALVGTFLGILLSYCVCSPLVSQIKVVRNKQHRLYVI 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK+ L+AYMNG++PQVA+EYGRK +   ERPSI+ V QE++      KA+
Sbjct: 241 VKQTLLAYMNGSVPQVALEYGRKTISAYERPSIDAVEQEMMNPGGENKAA 290


>gi|148558032|ref|YP_001257192.1| flagellar motor protein MotA [Brucella ovis ATCC 25840]
 gi|148369317|gb|ABQ62189.1| chemotaxis motA protein [Brucella ovis ATCC 25840]
          Length = 339

 Score =  258 bits (660), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 154/290 (53%), Positives = 208/290 (71%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           +  I+GL IT+ C++GGF AMGG+  +LIQP+E +I+ GA LG F +ANP  ++KD+G +
Sbjct: 50  LGIIVGLVITLGCMLGGFIAMGGHVSVLIQPWEFIIILGAALGTFFVANPFSLVKDTGRA 109

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            +E F      Q  Y DVL +LY LM  L+  SRNE E HID+P  S IF + P+VL+  
Sbjct: 110 CMEAFTDAVPKQRDYLDVLGVLYSLMRELRAKSRNEVEVHIDNPKESPIFLAYPSVLKKE 169

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +LT FICDY R+IIVGN RSYEIE LMDEEI  I  +KLKPY A+  + E+LPA+GIV A
Sbjct: 170 DLTNFICDYCRLIIVGNVRSYEIEALMDEEIRTIARDKLKPYQAMITISEALPALGIVAA 229

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKAMG L QSP++LG  IG +L GT  GI  SY +  P+ ++IKSTR K +RLYI+
Sbjct: 230 VLGVIKAMGALDQSPEVLGHLIGAALVGTFAGIFFSYGVIGPIANKIKSTREKNNRLYIV 289

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK+ L+AYMNG++PQ+A+EYGRK +   ERP+I++V QE +     ++A+
Sbjct: 290 VKQTLLAYMNGSLPQIAVEYGRKTISAYERPTIDVVEQETMASVPTQQAA 339


>gi|121602234|ref|YP_989407.1| lateral flagellar motor protein MotA [Bartonella bacilliformis
           KC583]
 gi|120614411|gb|ABM45012.1| lateral flagellar motor protein MotA [Bartonella bacilliformis
           KC583]
          Length = 301

 Score =  258 bits (660), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 137/290 (47%), Positives = 202/290 (69%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           +S IIGL IT+ CI+GG+ AMGG+  +L+QP+E VI+ G+ +G F+++ P  VIKD+  +
Sbjct: 11  LSVIIGLIITLGCILGGYVAMGGHLDVLMQPWEFVIIVGSAIGAFIVSTPFPVIKDTLKA 70

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
             E        Q  +   L LLY LM  ++  SR+E E+HID+P  ST+F   P VL+++
Sbjct: 71  TTEALTDAVPKQKDFLATLGLLYTLMREMRSKSRSEMESHIDNPKESTLFQQYPLVLKDD 130

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            LT FICDY R+I++GN R +EIE LMDEEI  I  +  KPY A+ +M ++LPA+GIV A
Sbjct: 131 SLTNFICDYCRLIVMGNTRPFEIEALMDEEIHTISSDSQKPYQAMQNMADALPALGIVAA 190

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKAMG +++ P++LG  IG +L GT  GI  SYS+  P+ ++IK+ R K+ R+YI+
Sbjct: 191 VLGVIKAMGAITEPPEVLGHLIGAALVGTFAGIFFSYSIFGPIATKIKAVRSKKTRIYIV 250

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK+ L+AYMNGAIPQ+A+EYGRK +   +RP+I++V Q  +  +  +K +
Sbjct: 251 VKQTLLAYMNGAIPQIALEYGRKTISAKDRPTIDVVEQHAISGHSAEKKA 300


>gi|91785661|ref|YP_560867.1| flagellar motor protein MotA [Burkholderia xenovorans LB400]
 gi|296157482|ref|ZP_06840317.1| flagellar motor protein MotA [Burkholderia sp. Ch1-1]
 gi|91689615|gb|ABE32815.1| Chemotaxis protein MotA [Burkholderia xenovorans LB400]
 gi|295892254|gb|EFG72037.1| flagellar motor protein MotA [Burkholderia sp. Ch1-1]
          Length = 286

 Score =  258 bits (660), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 102/285 (35%), Positives = 170/285 (59%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   +G  +T+L + GG+   GG+   L+QP E++++ GAG+G F++ N +K IK +   
Sbjct: 1   MLIFVGTLVTLLSVFGGYALEGGHLGALLQPVEVLMIVGAGIGAFILGNGMKTIKATLRV 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  +F      +D Y +++ LLY+L+   +K      E  IDDP  S IFT  P +L + 
Sbjct: 61  IPTLFKGAKYNKDVYMELMALLYVLLAKARKEGTLTLEADIDDPSKSPIFTQYPKILADK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  F+ DY+R+++ GN  ++EIE+LMDEEI+    E   P HA++ +G+++PA GIV A
Sbjct: 121 HIIEFLTDYLRLMVGGNMNAFEIESLMDEEIETHHQEGEAPAHALNKVGDAMPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  M +  + P +LG  I  +L GT LGI+LSY L  PL S  +    +  +++  
Sbjct: 181 VMGVVHTMASADKPPAVLGEMIAQALVGTFLGILLSYGLIGPLASVAEQRVTESTKMFQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           +K  ++A +NG  P +A+E+GRKVL  +ERPS   + + V +   
Sbjct: 241 IKVTILASLNGYAPAIAVEFGRKVLFSTERPSFAELEEHVRRVKA 285


>gi|186473030|ref|YP_001860372.1| MotA/TolQ/ExbB proton channel [Burkholderia phymatum STM815]
 gi|184195362|gb|ACC73326.1| MotA/TolQ/ExbB proton channel [Burkholderia phymatum STM815]
          Length = 289

 Score =  258 bits (660), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 101/289 (34%), Positives = 163/289 (56%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   IG  + +  +IG F  +GG+   L+QPFE++ + GA +G FV++NP+ V+K +  +
Sbjct: 1   MFVAIGWLLVVGSVIGSFVGVGGHLPALVQPFELLCIFGAAIGAFVVSNPVSVLKKTIKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L   F   A  ++ Y +++ LLY L+   +K      E  ++ P  S +F     VL+++
Sbjct: 61  LPGCFKGGAYSKEIYLELIALLYELLQKARKEGMMALEADVNAPEESALFQKYSHVLKDH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FI DY+RM+  GN    E+++LMDEE++    E   P +AI  M + LPA GIV A
Sbjct: 121 HLLDFIVDYLRMMSTGNVNVLEMQDLMDEELETHHAESSVPANAIQKMADGLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  MG++   P +LG  I  +L GT LGI+L+Y    P+   + +    + + Y  
Sbjct: 181 VMGVVHTMGSVGAPPAVLGEMIAGALVGTFLGILLAYGFIGPVADLLNAKGRAEAKPYQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKA 289
           VK  L+A ++G  P VA+E+GRKVL  ++RPS + +   V      K A
Sbjct: 241 VKAVLLASLSGYAPPVAVEFGRKVLFTADRPSFQELDDAVRATKMPKSA 289


>gi|294635725|ref|ZP_06714191.1| chemotaxis MotA protein [Edwardsiella tarda ATCC 23685]
 gi|291090937|gb|EFE23498.1| chemotaxis MotA protein [Edwardsiella tarda ATCC 23685]
          Length = 296

 Score =  258 bits (659), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 100/290 (34%), Positives = 169/290 (58%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++G  + ++ + GG+  +GG+   L QP E++I+ GAG+G F++ N  K IK +  +
Sbjct: 1   MLILLGYAVVLIAVFGGYALVGGHLGALYQPSELLIIGGAGIGAFIVGNNGKAIKSTLRT 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L ++       +  Y DV+ L+Y L+   ++      E  I+DP +S IF++ P +L + 
Sbjct: 61  LPKLARGSKYNKALYMDVMGLMYQLLAKSRQQGMLSLERDIEDPSSSDIFSNYPRLLADQ 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  F+ DYMR+II GN  ++EIE LMDEEI+    E   P  +++ +G+SLPA GIV A
Sbjct: 121 TLIEFVTDYMRLIISGNMNAFEIEALMDEEIETFEQEAEVPAGSLAAVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+ +  +    LG  I  ++ GT LGI+L+Y   +PL S ++    +  ++   
Sbjct: 181 VMGVVHALASADRPAAELGALIAHAMVGTFLGILLAYGFISPLASLMRQKSAETSKMMHC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           +K  L++ +NG  PQ+A+E+GRK L  +ERPS   + + V Q     K +
Sbjct: 241 IKVTLLSSLNGYAPQIAVEFGRKTLYSTERPSFIELEEHVRQVKAPAKQA 290


>gi|170692675|ref|ZP_02883837.1| flagellar motor component-like protein [Burkholderia graminis
           C4D1M]
 gi|170142331|gb|EDT10497.1| flagellar motor component-like protein [Burkholderia graminis
           C4D1M]
          Length = 294

 Score =  258 bits (659), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 100/290 (34%), Positives = 159/290 (54%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   IG  + I  +IG F  +GG+   LIQPFE++ + GA +G FV++NP   +K +  +
Sbjct: 1   MFVAIGWLLVIGSVIGSFIGVGGHLPALIQPFELLCIFGAAIGAFVVSNPTSTLKKTLKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +   F      ++ Y +++ LLY L+   +K      E  +  P  S IF   P VL ++
Sbjct: 61  IPSCFKGGGYTKEKYLELIALLYELLQKARKEGMMSLEADVFAPEESVIFQKYPHVLSDH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FI DY+RM+  GN    E+++LMDEE+     E     +AI  M + LPA GIV A
Sbjct: 121 HLLDFIVDYLRMMSGGNVNVLEVQDLMDEELATHHAEASVAANAIQKMADGLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  MG++   P +LG  I  +L GT LGI+L+Y    PL   + +    + + +  
Sbjct: 181 VMGVVHTMGSVGAPPAVLGEMIAGALVGTFLGILLAYGFIGPLADLLNAKGRAEAKPFQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK  L+A ++G  P +A+E+GRKVL +++RPS + +   V      K A+
Sbjct: 241 VKAVLLASLSGYAPPIAVEFGRKVLFIADRPSFQELDDAVRATKTPKPAA 290


>gi|197285529|ref|YP_002151401.1| flagellar motor protein MotA [Proteus mirabilis HI4320]
 gi|227356024|ref|ZP_03840415.1| motility protein A [Proteus mirabilis ATCC 29906]
 gi|194683016|emb|CAR43483.1| chemotaxis protein (motility protein A) [Proteus mirabilis HI4320]
 gi|227163801|gb|EEI48709.1| motility protein A [Proteus mirabilis ATCC 29906]
          Length = 297

 Score =  258 bits (658), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 102/289 (35%), Positives = 167/289 (57%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++G  + I  ++GGF  +GG+   L QP E +I+ GAG+G FV+ N  + I  +   
Sbjct: 1   MLVLLGYIVVICAVLGGFTLVGGHLGALYQPAEFLIIFGAGIGAFVVGNNGRAIVSTVKI 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L ++       +  Y D++ L++ L+   ++      E  I++P  S IF+  P ++++ 
Sbjct: 61  LPKLLRNTNYNKAMYMDLMALMFRLLSKARQNGMLALERDIENPQQSDIFSQYPRIMKDV 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            + +FI DYMR+++ GN   YEIE LMDEEI     E   P   +S MG+SLPA GIV A
Sbjct: 121 YMLSFITDYMRLMVTGNMNPYEIEALMDEEIATFEEESEVPAAGLSTMGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+G   +    +G  IG ++ GT LGI+L+Y   +PL S+I+    +Q ++   
Sbjct: 181 VMGVVNALGAADRPAGEMGALIGHAMVGTFLGILLAYGFVSPLASRIRQRSSQQMKMMEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKA 289
           +K  L++ MNG  PQ+A+E+GRK L L++RPS   + + V Q     +A
Sbjct: 241 IKTTLLSSMNGYAPQIAVEFGRKTLFLADRPSFIELEEHVRQVRTPMQA 289


>gi|291613012|ref|YP_003523169.1| MotA/TolQ/ExbB proton channel [Sideroxydans lithotrophicus ES-1]
 gi|291583124|gb|ADE10782.1| MotA/TolQ/ExbB proton channel [Sideroxydans lithotrophicus ES-1]
          Length = 284

 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 90/282 (31%), Positives = 156/282 (55%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  + +  + GGF   GG+   L QP E++++ G  LG F + N +K +K +   
Sbjct: 1   MLVIVGYIVVLASVFGGFALAGGHLGALFQPIELLMIGGGALGAFFVGNTMKSVKATFKD 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +       +++Y +++ L+Y L+  ++K      E  +++P  S +F   P VL ++
Sbjct: 61  LPTVLKGAKYNKESYMELMALMYELLGKVRKEGLMSIEGDVENPEESPVFAKYPKVLADH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+ DY+R+++ GN  + EIENLMD EI+   +E +   H I+ +G+ +PA GIV A
Sbjct: 121 HAVEFMTDYLRIMVSGNLNAMEIENLMDVEIETHHHEAMVSSHVIAKLGDGMPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  M ++   P  LG  I  +L GT LGI+L+Y    PL   ++    +  ++   
Sbjct: 181 VMGVVHTMESVGIPPAELGMLIAHALVGTFLGILLAYGFVGPLAGLLEQKAEEGSKMLQA 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQ 282
           +K  L+A +NG  P +A+E+GRK L  +ERP    + + V Q
Sbjct: 241 IKVVLLANLNGYAPAMAVEFGRKALNSTERPGFVELEEHVKQ 282


>gi|120555690|ref|YP_960041.1| flagellar motor component [Marinobacter aquaeolei VT8]
 gi|120325539|gb|ABM19854.1| flagellar motor component [Marinobacter aquaeolei VT8]
          Length = 283

 Score =  257 bits (657), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 99/282 (35%), Positives = 165/282 (58%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  IIG  + + C++GG+   GGN  +L QP EI+I+ GA +G F++ANPL  +K+   +
Sbjct: 1   MLLIIGAVVVVACVLGGYVLHGGNLAVLWQPTEILIIGGAAVGSFIIANPLHTVKEVFQA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            + +       +  Y D+L LLY +    +K      E  ID+P +S IF+  P ++++ 
Sbjct: 61  CIRLLTGSPFNKSYYMDLLSLLYEVFDKSRKQGVMAIEEDIDNPESSQIFSRYPAIMKSK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FI DY+R+I  GN   +E+E +M+ EI+   +E  +P HA++ + ++LP +GIV A
Sbjct: 121 HLLDFITDYLRIISSGNMAPHELEGMMENEIENRQHELEEPAHAVNKIADALPGLGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGI+  MG L++ P+ +G ++  +L GT LGI + Y    P +  ++     + + Y  
Sbjct: 181 VLGIVITMGFLTEGPEKIGLSVAAALVGTFLGIWMGYGFVGPTSIALEHAAKYELKAYEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQ 282
           VK A++A ++G  PQ+AIE+GRK LP  +RP  + +   V  
Sbjct: 241 VKSAIVATVSGQAPQMAIEFGRKALPTEKRPGFQELNDHVRS 282


>gi|238026966|ref|YP_002911197.1| flagellar motor component-like protein [Burkholderia glumae BGR1]
 gi|237876160|gb|ACR28493.1| Flagellar motor component-like protein [Burkholderia glumae BGR1]
          Length = 289

 Score =  257 bits (657), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 99/289 (34%), Positives = 155/289 (53%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   IG  + I  +IG F  +GG+   LIQPFE++ + GA  G FV++NP   +  +  +
Sbjct: 1   MFVAIGWIVVIGSVIGSFVGVGGHLPALIQPFELLCIFGAAAGAFVVSNPRDTLVKTLKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L   F      +  Y +++ LLY ++   ++      E+ I++P +S +F     VL ++
Sbjct: 61  LPSCFKSSGYTKTQYLELIALLYEVLQKARREGMLSLESDIENPASSALFQKYSHVLADH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FI DY+RM+  GN    E+++LMDEE+     E      AI  M + LPA GIV A
Sbjct: 121 HLLDFIIDYLRMMSTGNVNPLEMQDLMDEELGTHHAEMSVAPSAIQKMADGLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  MG++   P  LG  I  +L GT LGI+L+Y    PL   + +      + +  
Sbjct: 181 VMGVVHTMGSVGAPPAELGKMIAGALVGTFLGILLAYGFVGPLADLLNAKGRSSAKPFQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKA 289
           VK  L+A ++G  P VA+E+GRKVL  S+RPS + + + V      K A
Sbjct: 241 VKAVLLASLSGYAPAVAVEFGRKVLFTSDRPSFQELDEAVRATKTVKAA 289


>gi|288959637|ref|YP_003449978.1| chemotaxis protein [Azospirillum sp. B510]
 gi|288911945|dbj|BAI73434.1| chemotaxis protein [Azospirillum sp. B510]
          Length = 286

 Score =  257 bits (657), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 90/280 (32%), Positives = 158/280 (56%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  +IG  I I  + GG+   GG+  +L  PFE +I+ G+G G F +ANP  V+  +G  
Sbjct: 1   MFVMIGFGIVIFSVFGGYILGGGHLGVLWMPFEFMIILGSGAGAFFIANPKSVVTHTGKE 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      ++ + +VL ++Y +    K       E HI+ P +S +F   P    ++
Sbjct: 61  LGHLFKGPKYKKEDFLEVLTMMYQVFKIAKTKGLLALEQHIEKPEDSPLFQQFPKFYGDH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+C Y+R++ +G    +E+ +LMDE+I+ + +E  +   AI  + +++PA+GIV A
Sbjct: 121 HAIAFLCTYLRLMSLGADNPHELVDLMDEDIETMHHEHQRISDAIQAVADAVPALGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+I  MG++++ P++LG  IG +L GT  GI+++Y    P+ S +K+    + + Y  
Sbjct: 181 VLGVIHTMGSITEPPEVLGKLIGGALVGTFTGILVAYGFLAPIASGLKNIYHAEGKYYQA 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEV 280
           +K  LIA+++G  P +++EY R VL    RP+   V +  
Sbjct: 241 MKTGLIAHLSGYAPAISVEYARNVLEPEYRPTFAQVEEAT 280


>gi|296161289|ref|ZP_06844097.1| flagellar motor component-like protein [Burkholderia sp. Ch1-1]
 gi|295888447|gb|EFG68257.1| flagellar motor component-like protein [Burkholderia sp. Ch1-1]
          Length = 289

 Score =  257 bits (657), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 101/289 (34%), Positives = 159/289 (55%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   IG  + I  ++G F  +GG+   LIQPFE++ + GA +G FV++NP   +K +  +
Sbjct: 1   MFVAIGWVLVIGSVLGSFIGVGGHLPALIQPFELLCIFGAAIGAFVVSNPTSTLKKTIKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +   F      ++ Y +++ LLY L+   +K      E  +  P +S IF   P VLE++
Sbjct: 61  IPSCFKGGGYTKEKYLELIALLYELLQKARKEGMMSLEAEVGAPKDSVIFQKYPHVLEDH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FI DY+RM+  GN    E+++LMDEE+     E     +AI  M + LPA GIV A
Sbjct: 121 HLLDFIVDYLRMMSGGNVNVLEVQDLMDEELATHHAESAVAANAIQKMADGLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  MG++   P +LG  I  +L GT LGI+L+Y    PL   + +    + + Y  
Sbjct: 181 VMGVVHTMGSVGAPPAVLGEMIAGALVGTFLGILLAYGFIGPLADLLTAKGRAEGKPYQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKA 289
           VK  L+A ++G  P +A+E+GRKVL  ++RPS + +   V      K A
Sbjct: 241 VKAVLLASLSGYAPAIAVEFGRKVLFTADRPSFQELDDAVRATKTPKSA 289


>gi|209515723|ref|ZP_03264586.1| flagellar motor protein MotA [Burkholderia sp. H160]
 gi|209503750|gb|EEA03743.1| flagellar motor protein MotA [Burkholderia sp. H160]
          Length = 286

 Score =  257 bits (656), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 104/285 (36%), Positives = 171/285 (60%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   +G  +T+L + GG+   GG+   L+QP E++++AGAGLG F++ N +K IK +   
Sbjct: 1   MLIFVGTLVTLLSVFGGYALEGGHLGALLQPVEVLMIAGAGLGAFILGNGMKTIKATLRV 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  +F      +D Y +++ LLY+L+   +K      E  IDDP  S IFT  P +L + 
Sbjct: 61  IPTLFKGAKYNKDVYMELMGLLYVLLAKARKEGTLTLEADIDDPSKSPIFTQYPKILADK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  F+ DY+R+++ GN  ++EIE+LMDEEI+    E   P HA++ +G+++PA GIV A
Sbjct: 121 HIIEFLTDYLRLMVGGNMNAFEIESLMDEEIETHHQEGEAPAHALTKVGDAMPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  M +  + P +LG  I  +L GT LGI+LSY L  PL S  +    +  +++  
Sbjct: 181 VMGVVHTMASADKPPAVLGEMIAQALVGTFLGILLSYGLIGPLASVAEQRVTESTKMFQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           +K  ++A +NG  P +A+E+GRKVL  +ERPS   + + V +   
Sbjct: 241 IKVTILASLNGYAPAIAVEFGRKVLFSTERPSFAELEEHVRRVKA 285


>gi|227112503|ref|ZP_03826159.1| flagellar motor protein MotA [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 295

 Score =  257 bits (656), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 96/290 (33%), Positives = 168/290 (57%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  + +  I+GG+  +GG    L QP E++I+ GA LG F++ N  K IK +  +
Sbjct: 1   MLVILGYIVIVASILGGYLMVGGALGALYQPSELLIIGGAALGAFIVGNNGKAIKATLRA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +       +  Y D++ LL+ +M   ++      E  ID+P  S IF+S P +L +N
Sbjct: 61  LPLLVKSSKYNKALYMDLMALLFRVMAKSRQQGMLSLEFDIDNPRESEIFSSYPNILADN 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FI DY+R+++ GN  ++EIE LMDEEI+ I +E   P  +++ MG+ LPA GIV A
Sbjct: 121 TVVEFITDYLRLMVSGNMNAFEIETLMDEEIETIEHESEVPASSLTMMGDGLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ ++  + +    LG  I  ++ GT LGI+L+Y   +PL + ++    ++ ++   
Sbjct: 181 VMGVVHSLAYVDRPAAELGMMIAHAMVGTFLGILLAYGFVSPLAALLRQKNAEKIKVLQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           +K  L++ +NG  PQ+A+E+GRK L  +ERPS   + + + +     + +
Sbjct: 241 IKVTLLSSLNGYAPQIAVEFGRKTLYSTERPSFTELEEHIRRVKSPTQQA 290


>gi|253688989|ref|YP_003018179.1| flagellar motor protein MotA [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251755567|gb|ACT13643.1| flagellar motor protein MotA [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 295

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 95/290 (32%), Positives = 168/290 (57%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  + +  I+GG+  +GG    L QP E++I+ GA +G F++ N  K IK +  +
Sbjct: 1   MLVILGYIVIVASILGGYLMVGGALGALYQPSELLIIGGAAVGAFIVGNNGKAIKATLRA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +       +  Y D++ LL+ +M   ++      E  ID+P  S IF+S P +L +N
Sbjct: 61  LPLLVKSSKYNKALYMDLMALLFRVMAKSRQQGMLSLEFDIDNPRESEIFSSYPNILADN 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FI DY+R+++ GN  ++EIE LMDEEI+ I +E   P  +++ MG+ LPA GIV A
Sbjct: 121 TVVEFITDYLRLMVSGNMNAFEIETLMDEEIETIEHESEVPATSLTLMGDGLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ ++  + +    LG  I  ++ GT LGI+L+Y   +PL + ++    ++ ++   
Sbjct: 181 VMGVVHSLAYVDRPAAELGMMIAHAMVGTFLGILLAYGFVSPLAALLRQKNAEKIKVLQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           +K  L++ +NG  PQ+A+E+GRK L  +ERPS   + + + +     + +
Sbjct: 241 IKVTLLSSLNGYAPQIAVEFGRKTLYSTERPSFTELEEHIRRVKSPTQQA 290


>gi|163793055|ref|ZP_02187031.1| motA, chemotaxis (motility protein A [alpha proteobacterium BAL199]
 gi|159181701|gb|EDP66213.1| motA, chemotaxis (motility protein A [alpha proteobacterium BAL199]
          Length = 286

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 99/281 (35%), Positives = 160/281 (56%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  IIG  +  + ++GG+ AMGG    L QPFE+VI+ GAG+G F++ANP  V+  +G  
Sbjct: 1   MFVIIGWVVVTVSVLGGYMAMGGKLGPLWQPFELVIIGGAGVGAFIVANPKYVLSKAGYG 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
                      +D Y ++L LLY +    K       E HI+ P  ST+F + P    ++
Sbjct: 61  FKAALKGPKYSKDDYLELLSLLYAIFKLAKTKGMLAIEAHIERPEESTLFQAFPKFSADH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+CDY+RM+ +G    +E+ +L+DEE++    E  +   A   MG+  PA+GIV A
Sbjct: 121 HAMDFLCDYLRMMTLGTNNPHELADLLDEELETHHAEDAQIQSAYQTMGDGFPALGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGIIK M ++++ P++LG  IG +L GT LGI+L+Y   +PL++ + +      +    
Sbjct: 181 VLGIIKTMSSITEPPEVLGKLIGGALVGTFLGILLAYGFVSPLSATMGAVFAADAKYLGC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
           ++  L+A+++G  P V++E+ RK L   +RPS   V + V 
Sbjct: 241 IRAGLLAHVSGYAPAVSVEFARKALMSKDRPSFFEVEEAVA 281


>gi|225628601|ref|ZP_03786635.1| flagellar motor protein MotA [Brucella ceti str. Cudo]
 gi|225616447|gb|EEH13495.1| flagellar motor protein MotA [Brucella ceti str. Cudo]
          Length = 339

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 153/290 (52%), Positives = 208/290 (71%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           +  I+GL IT+ C++GGF AMGG+  +LIQP+E +I+ GA LG F +ANP  ++KD+G +
Sbjct: 50  LGIIVGLVITLGCMLGGFIAMGGHVSVLIQPWEFIIILGAALGTFFVANPFSLVKDTGRA 109

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            +E F      Q  Y DVL +LY LM  L+  SRNE E HID+P  S IF + P+VL+  
Sbjct: 110 CMEAFTDAVPKQRDYLDVLGVLYSLMRELRAKSRNEVEVHIDNPKESPIFLAYPSVLKKE 169

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +LT FICDY R+IIVGN RSYEIE LMDEEI  I  +KLKPY A+  + E+LPA+GIV A
Sbjct: 170 DLTNFICDYCRLIIVGNVRSYEIEALMDEEIRTIARDKLKPYQAMITISEALPALGIVAA 229

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKAMG L QSP++LG  IG +L GT  GI  SY +  P+ ++IKSTR K +RLYI+
Sbjct: 230 VLGVIKAMGALDQSPEVLGHLIGAALVGTFAGIFFSYGVIGPIANKIKSTREKNNRLYIV 289

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK+ L+AYMNG++PQ+A+EYGRK +   ERP+I++V Q+ +     ++A+
Sbjct: 290 VKQTLLAYMNGSLPQIAVEYGRKTISAYERPTIDVVEQKTMASVPTQQAA 339


>gi|134294328|ref|YP_001118063.1| flagellar motor protein MotA [Burkholderia vietnamiensis G4]
 gi|134137485|gb|ABO53228.1| chemotaxis MotA protein [Burkholderia vietnamiensis G4]
          Length = 286

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 105/285 (36%), Positives = 172/285 (60%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  +T+L + GG+   GG+   L+QP EI+++ GAG+G F++ N +K IK +   
Sbjct: 1   MLIIVGTLVTLLSVFGGYALAGGHLGALVQPLEILMIVGAGVGAFILGNGIKTIKATLRV 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +D Y +++ LLY+L+   +K      E  IDDP  S IFT  P +L ++
Sbjct: 61  LPTLFKGSKYNKDVYMELMGLLYVLLAKARKEGTLTLEADIDDPEKSPIFTQYPKILADH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  F+ DY+R+++ GN  ++EIE+LMDEEI+    E   P HA+  +G+++PA GIV A
Sbjct: 121 HIVEFLTDYLRLMVGGNMNAFEIESLMDEEIETHHTEGEAPAHALMRVGDAMPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  M +  + P +LG  I  +L GT LGI+LSY L  PL+S  +    +  +++  
Sbjct: 181 VMGVVHTMASADKPPAVLGAMIAQALVGTFLGILLSYGLIGPLSSLAEQRVAEATKMFQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           +K  ++A +NG  P +A+E+GRKVL  +ERPS   + + V +   
Sbjct: 241 IKVTILASLNGYAPAIAVEFGRKVLFSTERPSFNELEEHVRRVKA 285


>gi|311105915|ref|YP_003978768.1| chemotaxis protein MotA [Achromobacter xylosoxidans A8]
 gi|310760604|gb|ADP16053.1| chemotaxis protein MotA [Achromobacter xylosoxidans A8]
          Length = 291

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 107/287 (37%), Positives = 168/287 (58%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  +IG  +  + ++G F A+GG+   L QPFE+ ++ GA  G F+ +N  K +     +
Sbjct: 1   MLIVIGFLVVAVSVVGSFIALGGHLGALYQPFELTLIFGAAFGAFLASNSKKSLMLVKAA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L +       G+D Y +++ LLY+L+   ++      E+HI+DP +S IF+  P + ++ 
Sbjct: 61  LPDSLKSSRYGKDVYMELMALLYVLLNKARREGLMAIESHIEDPESSPIFSEYPRIAKDA 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +L  FI DY+R++I GN  S+EIE LMDEEI+   +E+  P  A+  M + LPA GIV A
Sbjct: 121 KLMEFITDYLRIMISGNMSSFEIETLMDEEIETYRHEREVPVRALQQMADGLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKA+  + Q P ILG  I  ++ GT LGI+L+Y    PL S+I     +  ++   
Sbjct: 181 VLGVIKALAAVDQPPAILGDLISKAMVGTFLGILLAYGFVGPLASRIDRRSDEATKVLEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
           +K  L+A MNG  PQ+A+E+GRKVL  + RP+   + + V Q     
Sbjct: 241 IKTTLLASMNGYPPQLAVEFGRKVLFSAVRPTFGELEEHVRQAKSTA 287


>gi|82702436|ref|YP_412002.1| chemotaxis (motility protein A) transmembrane [Nitrosospira
           multiformis ATCC 25196]
 gi|82410501|gb|ABB74610.1| probable chemotaxis (motility protein A) transmembrane
           [Nitrosospira multiformis ATCC 25196]
          Length = 286

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 98/284 (34%), Positives = 156/284 (54%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  IIG  I +  + GGF   GG+   L QP E++++ GA +G F + N  K +K +  S
Sbjct: 1   MLVIIGSLIVLGSVFGGFALTGGHLAALFQPVELLMIGGAAMGAFTLGNTKKALKATLKS 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L ++       +  Y D++ LLY L+  ++K      E  +DDP  S IF + P +L   
Sbjct: 61  LPKVVQPPRYTKALYMDLMALLYDLLVKVRKEGLMSIEPDVDDPNESAIFANYPDILAEP 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+ DY+R+++ GN  ++E+ENLMD EI+    E   P H IS + +S+PA GIV A
Sbjct: 121 VALEFLTDYLRLMVAGNLNAFELENLMDNEIETHHQEGEIPVHCISRLADSMPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G+I  M ++   P  LG  +  +L GT LGI+L Y    P+ S ++    +  ++   
Sbjct: 181 VMGVIHTMASVGLPPSELGVLVAQALVGTFLGILLGYGFVGPVASILEQRLNESTKILQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYN 284
           ++  L+A +NG  P +A+E+GRKVL  +ERPS   +   V +  
Sbjct: 241 IRVTLLASINGYTPALAVEFGRKVLYSTERPSFAELESHVRRAK 284


>gi|237816640|ref|ZP_04595632.1| flagellar motor protein MotA [Brucella abortus str. 2308 A]
 gi|237787453|gb|EEP61669.1| flagellar motor protein MotA [Brucella abortus str. 2308 A]
          Length = 339

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 153/290 (52%), Positives = 207/290 (71%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           +  I+GL IT+ C++GGF AMGG+  +LIQP+E +I+ GA LG F +ANP  ++KD+G +
Sbjct: 50  LGIIVGLVITLGCMLGGFIAMGGHVSVLIQPWEFIIILGAALGTFFVANPFSLVKDTGRA 109

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            +E F      Q  Y DVL +LY LM  L+  SRNE E HID+P  S IF + P+VL+  
Sbjct: 110 CMEAFTDAVPKQRDYLDVLGVLYSLMRELRAKSRNEVEVHIDNPKESPIFLAYPSVLKKE 169

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +LT FICDY R+IIVGN RSYEIE LMDEEI  I  +KLKPY A+  + E+LPA+GIV A
Sbjct: 170 DLTNFICDYCRLIIVGNVRSYEIEALMDEEIRTIARDKLKPYQAMITISEALPALGIVAA 229

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +L +IKAMG L QSP++LG  IG +L GT  GI  SY +  P+ ++IKSTR K +RLYI+
Sbjct: 230 VLSVIKAMGALDQSPEVLGHLIGAALVGTFAGIFFSYGVIGPIANKIKSTREKNNRLYIV 289

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK+ L+AYMNG++PQ+A+EYGRK +   ERP+I++V QE +     ++A+
Sbjct: 290 VKQTLLAYMNGSLPQIAVEYGRKTISAYERPTIDVVEQETMASVPTQQAA 339


>gi|251789150|ref|YP_003003871.1| flagellar motor protein MotA [Dickeya zeae Ech1591]
 gi|247537771|gb|ACT06392.1| flagellar motor protein MotA [Dickeya zeae Ech1591]
          Length = 295

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 94/290 (32%), Positives = 168/290 (57%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  +TI  I+GG+  +GG    L QP E++I+ GA +G F++ N  K IK +  +
Sbjct: 1   MLVILGYLVTIGSILGGYLIVGGELGALYQPSELLIIGGAAVGAFIVGNNAKAIKATLKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y D++ +L+ LM   ++      E  ID+P  S IF++ P +L ++
Sbjct: 61  LPVLFQGSKYTKAVYMDLMAVLFRLMAKSRQQGMLSLEFDIDNPKESEIFSNYPRILSDD 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  F+ DY+R+++ GN  ++EIE LMDEEI+ + +E   P  +++ MG+ LPA GIV A
Sbjct: 121 YIVEFVTDYLRLMVSGNMNAFEIETLMDEEIETVEHEVEVPATSLNLMGDGLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ ++  + +    LG  I  ++ GT LGI+L+Y   +PL S ++    ++ ++   
Sbjct: 181 VMGVVHSLAFVDRPAAELGMMIAHAMVGTFLGILLAYGFVSPLASLLRQKNSEKIKVLQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           +K  L++ +NG  PQ+A+E+GRK L  + RPS   + + +       + +
Sbjct: 241 IKVTLLSSLNGYAPQIAVEFGRKTLYSTVRPSFTEMEEHIRNVKAPAQQA 290


>gi|161620212|ref|YP_001594098.1| flagellar motor protein MotA [Brucella canis ATCC 23365]
 gi|163844321|ref|YP_001621976.1| flagellar motor protein MotA [Brucella suis ATCC 23445]
 gi|161337023|gb|ABX63327.1| chemotaxis motA protein [Brucella canis ATCC 23365]
 gi|163675044|gb|ABY39154.1| Hypothetical protein, conserved [Brucella suis ATCC 23445]
          Length = 323

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 154/290 (53%), Positives = 208/290 (71%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           +  I+GL IT+ C++GGF AMGG+  +LIQP+E +I+ GA LG F +ANP  ++KD+G +
Sbjct: 34  LGIIVGLVITLGCMLGGFIAMGGHVSVLIQPWEFIIILGAALGTFFVANPFSLVKDTGRA 93

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            +E F      Q  Y DVL +LY LM  L+  SRNE E HID+P  S IF + P+VL+  
Sbjct: 94  CMEAFTDAVPKQRDYLDVLGVLYSLMRELRAKSRNEVEVHIDNPKESPIFLAYPSVLKKE 153

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +LT FICDY R+IIVGN RSYEIE LMDEEI  I  +KLKPY A+  + E+LPA+GIV A
Sbjct: 154 DLTNFICDYCRLIIVGNVRSYEIEALMDEEIRTIARDKLKPYQAMITISEALPALGIVAA 213

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKAMG L QSP++LG  IG +L GT  GI  SY +  P+ ++IKSTR K +RLYI+
Sbjct: 214 VLGVIKAMGALDQSPEVLGHLIGAALVGTFAGIFFSYGVIGPIANKIKSTREKNNRLYIV 273

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK+ L+AYMNG++PQ+A+EYGRK +   ERP+I++V QE +     ++A+
Sbjct: 274 VKQTLLAYMNGSLPQIAVEYGRKTISAYERPTIDVVEQETMASVPTQQAA 323


>gi|153011532|ref|YP_001372746.1| flagellar motor protein MotA [Ochrobactrum anthropi ATCC 49188]
 gi|151563420|gb|ABS16917.1| chemotaxis motA protein [Ochrobactrum anthropi ATCC 49188]
          Length = 290

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 155/290 (53%), Positives = 210/290 (72%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+GL IT+ C++GGF AMGG+  +LIQP+E VI+ GA LG F +ANP  ++KD+G +
Sbjct: 1   MGIIVGLVITLGCMLGGFIAMGGHVSVLIQPWEFVIILGAALGTFFIANPFSLVKDTGRA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            +E F      Q  Y DVL +LY LM  L+  SRNE E HID+P  S+IF + P+VL+  
Sbjct: 61  CMEAFSNAVPKQRDYLDVLGVLYSLMRELRAKSRNEVEVHIDNPKESSIFQAYPSVLKKE 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +LT FICDY R+IIVGN RS+EIE LMDEEI  I  +KLKPYHA+  + E+LPA+GIV A
Sbjct: 121 DLTHFICDYCRLIIVGNVRSHEIEALMDEEIHTIARDKLKPYHAMVSISEALPALGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKAMG L QSP++LG  IG +L GT  GI  SY +  P+ ++IKSTR K +RLYI+
Sbjct: 181 VLGVIKAMGALDQSPEVLGHLIGAALVGTFAGIFFSYGVVGPIAAKIKSTREKNNRLYIV 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK+ L+AYMNG++PQ+A+EYGRK +   +RP+I++V QE +     ++A+
Sbjct: 241 VKQTLLAYMNGSLPQIAVEYGRKTISAYDRPTIDVVEQETMASAPTQQAA 290


>gi|306846300|ref|ZP_07478861.1| flagellar motor protein MotA [Brucella sp. BO1]
 gi|306273295|gb|EFM55164.1| flagellar motor protein MotA [Brucella sp. BO1]
          Length = 323

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 154/290 (53%), Positives = 208/290 (71%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           +  I+GL IT+ C++GGF AMGG+  +LIQP+E +I+ GA LG F +ANP  ++KD+G +
Sbjct: 34  LGIIVGLVITLGCMLGGFIAMGGHVSVLIQPWEFIIILGAALGTFFVANPFSLVKDTGRA 93

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            +E F      Q  Y DVL +LY LM  L+  SRNE E HID+P  S IF + P+VL+  
Sbjct: 94  CMEAFTDAVPKQRDYLDVLGVLYSLMRELRAKSRNEVEFHIDNPKESPIFLAYPSVLKKE 153

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +LT FICDY R+IIVGN RSYEIE LMDEEI  I  +KLKPY A+  + E+LPA+GIV A
Sbjct: 154 DLTNFICDYCRLIIVGNVRSYEIEALMDEEIRTIARDKLKPYQAMITISEALPALGIVAA 213

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKAMG L QSP++LG  IG +L GT  GI  SY +  P+ ++IKSTR K +RLYI+
Sbjct: 214 VLGVIKAMGALDQSPEVLGHLIGAALVGTFAGIFFSYGVIGPIANKIKSTREKNNRLYIV 273

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK+ L+AYMNG++PQ+A+EYGRK +   ERP+I++V QE +     ++A+
Sbjct: 274 VKQTLLAYMNGSLPQIAVEYGRKTISAYERPTIDVVEQETMASVPTQQAA 323


>gi|157371227|ref|YP_001479216.1| flagellar motor protein MotA [Serratia proteamaculans 568]
 gi|157322991|gb|ABV42088.1| chemotaxis protein MotA [Serratia proteamaculans 568]
          Length = 298

 Score =  256 bits (655), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 95/289 (32%), Positives = 168/289 (58%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
             I+G  + +  + GG+  +GG+   L QP E +I+ GAG+G F++ N  K IK +  ++
Sbjct: 4   LVILGYLVVLGAVFGGYLIVGGHLGALYQPAEFLIIGGAGIGAFIVGNNGKAIKSTLRAI 63

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
            ++       +D Y D++ LL++L+   ++      E  ID+P  S IF++ P +L +N 
Sbjct: 64  PKLMRRSKYSKDLYMDLMALLFLLLAKSRQQGMLSLEFDIDNPQESEIFSNYPRILADNT 123

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
           L  FI DY+R+++ GN  ++EIE LMDEEI+    E   P  +++ +G+SLPA GIV A+
Sbjct: 124 LVEFITDYLRLMVSGNMNAFEIEALMDEEIETFEQESEVPAGSLAMVGDSLPAFGIVAAV 183

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           +G++ A+ +  +    LG  I  ++ GT LGI+L+Y   +PL + ++    +  ++   +
Sbjct: 184 MGVVHALASADRPAAELGALIANAMVGTFLGILLAYGFISPLATLLRQKSAENVKMMQCI 243

Query: 242 KKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           K  L++ +NG  PQ+A+E+GRK L  +ERPS   + + V +     + +
Sbjct: 244 KVTLLSSLNGYAPQIAVEFGRKTLYTTERPSFVELEEHVRRVKAPAQQA 292


>gi|60115452|dbj|BAD90018.1| MotA [Pectobacterium carotovorum subsp. carotovorum]
          Length = 295

 Score =  256 bits (655), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 95/290 (32%), Positives = 168/290 (57%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  + +  I+GG+  +GG    L QP E++I+ GA +G F++ N  K IK +  +
Sbjct: 1   MLVILGYIVIVASILGGYLMVGGALGALYQPSELLIIGGAAVGAFIVGNNGKAIKATLRA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +       +  Y D++ LL+ +M   ++      E  ID+P  S IF+S P +L +N
Sbjct: 61  LPLLVKSSKYNKALYMDLMALLFRVMAKSRQQGMLSLEFDIDNPRESEIFSSYPNILADN 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FI DY+R+++ GN  ++EIE LMDEEI+ I +E   P  +++ MG+ LPA GIV A
Sbjct: 121 TVVEFITDYLRLMVSGNMNAFEIETLMDEEIETIEHESEVPASSLTMMGDGLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ ++  + +    LG  I  ++ GT LGI+L+Y   +PL + ++    ++ ++   
Sbjct: 181 VMGVVHSLAYVDRPAAELGMMIAHAMVGTFLGILLAYGFVSPLAALLRQKNAEKIKVLQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           +K  L++ +NG  PQ+A+E+GRK L  +ERPS   + + + +     + +
Sbjct: 241 IKVTLLSSLNGYAPQIAVEFGRKTLYSTERPSFTELEEHIRRVKSPTQQA 290


>gi|307131628|ref|YP_003883644.1| flagellar motor rotation protein motA [Dickeya dadantii 3937]
 gi|306529157|gb|ADM99087.1| Flagellar motor rotation protein motA [Dickeya dadantii 3937]
          Length = 295

 Score =  256 bits (655), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 93/290 (32%), Positives = 166/290 (57%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  +TI  I+GG+  +GG    L QP E++I+ GA  G F++ N  K IK +  +
Sbjct: 1   MLVILGYLVTIGSILGGYLIVGGELGALYQPSELLIIGGAAAGAFIVGNNGKAIKATLKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +       +  Y D++ +L+ LM   ++      E  ID+P  S IF++ P +L ++
Sbjct: 61  LPTLLKGSQYTKAVYMDLMAVLFRLMAKSRQQGMLSLEFDIDNPKESEIFSNYPRILSDD 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  F+ DY+R+++ GN  ++EIE LMDEEI+ + +E   P  +++ MG+ LPA GIV A
Sbjct: 121 YIVEFVTDYLRLMVSGNMNAFEIETLMDEEIETVEHEVEVPATSLNLMGDGLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ ++  + +    LG  I  ++ GT LGI+L+Y   +PL S ++    ++ ++   
Sbjct: 181 VMGVVHSLAFVDRPAAELGMMIAHAMVGTFLGILLAYGFVSPLASLLRQKNSEKIKVLQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           +K  L++ +NG  PQ+A+E+GRK L  + RPS   + + +       + +
Sbjct: 241 IKVTLLSSLNGYAPQIAVEFGRKTLYSTVRPSFTEMEEHIRNVKAPAQQA 290


>gi|78064832|ref|YP_367601.1| flagellar motor protein MotA [Burkholderia sp. 383]
 gi|77965577|gb|ABB06957.1| Flagellar motor component-like protein [Burkholderia sp. 383]
          Length = 286

 Score =  256 bits (655), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 106/285 (37%), Positives = 170/285 (59%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  +T+L + GG+   GG+   LIQP EI+++ GAG+G F++ N  K IK +   
Sbjct: 1   MLIIVGTLVTLLSVFGGYALAGGHLGALIQPVEILMIVGAGVGAFILGNGGKTIKATLRV 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +D Y +++ LLY+L+   +K      E  IDDP  S IFT  P +L ++
Sbjct: 61  LPTLFKGSKYTKDVYMELMALLYVLLAKARKEGTLTLEADIDDPEKSPIFTQYPKILADH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  F+ DY+R+++ GN  ++EIE+LMDEEI+    E   P HA+  +G+++PA GIV A
Sbjct: 121 HIVEFLTDYLRLMVGGNMNAFEIESLMDEEIETHHAEGEGPAHALMRVGDAMPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  M +  + P +LG  I  +L GT LGI+LSY L  PL S  +    +  +++  
Sbjct: 181 VMGVVHTMASADKPPAVLGAMIAQALVGTFLGILLSYGLIGPLASLAEQRVAESTKMFQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           +K  ++A +NG  P +A+E+GRKVL  +ERPS   + + V +   
Sbjct: 241 IKVTILATLNGYAPAIAVEFGRKVLFSTERPSFSELEEHVRRVKA 285


>gi|322616923|gb|EFY13831.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322618162|gb|EFY15054.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322625832|gb|EFY22651.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322626284|gb|EFY23094.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322632698|gb|EFY29443.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322639042|gb|EFY35735.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322640482|gb|EFY37135.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322646009|gb|EFY42526.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322655477|gb|EFY51785.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322660256|gb|EFY56494.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322662936|gb|EFY59143.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322668122|gb|EFY64281.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322674118|gb|EFY70212.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322675528|gb|EFY71602.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322683058|gb|EFY79074.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322686752|gb|EFY82730.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|323195357|gb|EFZ80537.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323199249|gb|EFZ84344.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323204162|gb|EFZ89174.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323207504|gb|EFZ92452.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323211879|gb|EFZ96708.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323217489|gb|EGA02208.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323221976|gb|EGA06365.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323224727|gb|EGA08996.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323231511|gb|EGA15624.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323235953|gb|EGA20032.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323240523|gb|EGA24566.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323245415|gb|EGA29415.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323250186|gb|EGA34078.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323253634|gb|EGA37462.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323259385|gb|EGA43022.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323266190|gb|EGA49680.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323270700|gb|EGA54141.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
          Length = 295

 Score =  256 bits (654), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 101/288 (35%), Positives = 163/288 (56%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++G  + I  + GG+   GG+   L QP E+VI+ GAG+G F++ N  K IK +  +
Sbjct: 1   MLILLGYLVVIGTVFGGYVMTGGHLGALYQPAELVIIGGAGIGAFIVGNNGKAIKGTMKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  +F      +  Y D+L LLY LM   ++      E  I++P  S IF S P +L + 
Sbjct: 61  IPLLFRRSKYTKSMYMDLLALLYRLMAKSRQQGMFSLERDIENPKESEIFASYPRILADT 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FI DY+R+II GN   +EIE LMDEEI+    E   P ++++ +G+SLPA GIV A
Sbjct: 121 VMLDFIVDYLRLIISGNMNPFEIEALMDEEIETHESEAEVPANSLAMVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+ +  +    LG  I  ++ GT LGI+L+Y   +PL + ++    +  ++   
Sbjct: 181 VMGVVHALASADRPAAELGALIAHAMVGTFLGILLAYGFISPLATVLRQKSAETTKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
           VK  L++ +NG  P +A+E+GRK L  SERPS   + + V    +  +
Sbjct: 241 VKITLLSNLNGYAPPIAVEFGRKTLYSSERPSFIELEEHVRAVRNPNQ 288


>gi|288942641|ref|YP_003444881.1| MotA/TolQ/ExbB proton channel [Allochromatium vinosum DSM 180]
 gi|288898013|gb|ADC63849.1| MotA/TolQ/ExbB proton channel [Allochromatium vinosum DSM 180]
          Length = 284

 Score =  256 bits (654), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 101/281 (35%), Positives = 155/281 (55%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M+ I+G  I I  ++GGF A GG+   L QPFE+VI+ GA  GGFV+ANP+ V+  S  S
Sbjct: 1   MNFILGSLIVIASVLGGFAAGGGHIIALWQPFELVIILGAAGGGFVIANPMSVVVQSLKS 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  +F      +  Y + L  LY L    +K      E  I++P +S +F   P +L+++
Sbjct: 61  IPALFTGAKYKKAHYMEALGFLYELFNKARKEGLMGIEPDIEEPESSALFQKYPLILKDH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
             T FI DYMR+++ GN   +E+ENLMD EI+   +      HA+  + + LPA GIV A
Sbjct: 121 HATEFISDYMRLVVSGNMNPFELENLMDVEIETHHHATAATSHAVQQVADGLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGI+  M  L      +G  +  +L GT  GI++SY    P+ S +     ++ R    
Sbjct: 181 VLGIVHTMAALGGPMSEIGGLVAAALVGTFSGILISYGFVGPIASYLGRLADEETRYLSC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
           +K  ++A + G  PQVA+E+GRK +P   RP+ +   Q + 
Sbjct: 241 IKACILANVQGYSPQVAVEFGRKTMPPELRPNFQEFEQHLR 281


>gi|261821135|ref|YP_003259241.1| flagellar motor protein MotA [Pectobacterium wasabiae WPP163]
 gi|261605148|gb|ACX87634.1| flagellar motor protein MotA [Pectobacterium wasabiae WPP163]
          Length = 295

 Score =  256 bits (654), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 96/290 (33%), Positives = 169/290 (58%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  + +  I+GG+  +GG    L QP E++I+ GA LG F++ N  K IK +  +
Sbjct: 1   MLVILGYIVIVASILGGYLMVGGALGALYQPSELLIIGGAALGAFIVGNNGKAIKATVRA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y D++ LL+ +M   ++      E  ID+P  S IF+S P +L ++
Sbjct: 61  LPLLFKGSKYNKALYMDLMALLFRVMAKSRQQGMLSLEFDIDNPRESEIFSSYPNILSDS 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FI DY+R+++ GN  ++EIE LMDEEI+ I +E   P  +++ MG+ LPA GIV A
Sbjct: 121 NIVEFITDYLRLMVSGNMNAFEIETLMDEEIETIEHESEIPASSLTMMGDGLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ ++  + +    LG  I  ++ GT LGI+L+Y   +PL + ++    ++ ++   
Sbjct: 181 VMGVVHSLAYVDRPAAELGMMIAHAMVGTFLGILLAYGFVSPLAALLRQKNAEKIKVLQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           +K  L++ +NG  PQ+A+E+GRK L  +ERPS   + + + +     + +
Sbjct: 241 IKVTLLSSLNGYAPQIAVEFGRKTLYSTERPSFTELEEHIRRVKSPTQQA 290


>gi|226941126|ref|YP_002796200.1| flagellar motor protein MotA [Laribacter hongkongensis HLHK9]
 gi|226716053|gb|ACO75191.1| MotA1 [Laribacter hongkongensis HLHK9]
          Length = 286

 Score =  256 bits (654), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 99/284 (34%), Positives = 161/284 (56%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  IIG  + +  +IGGF   GG+   L+QP E+VI+ GAG G F+ AN    ++ +  +
Sbjct: 1   MFVIIGYILVLGSVIGGFMMAGGHVAALLQPNELVIIFGAGTGAFLAANGGAPLRATMKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L ++F      +  Y ++  LL+ ++  ++K      E  +D P  S IF+  P ++ ++
Sbjct: 61  LPQLFKGDKYNKALYMELFALLFEVLTKVRKEGLMSIEADVDAPQESPIFSKYPVIVNDH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FICDY+R+++ GN   +EIENLMD EI+   +E   P  A++ M + LPA GIV A
Sbjct: 121 HVIDFICDYLRLMVGGNLNPFEIENLMDIEIETHHHEGSVPVGALAKMADGLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  M ++   P  LG  I  +L GT LGI+LSY    PL+++++       R+   
Sbjct: 181 VMGVVHTMESVGIPPAELGKLIAAALVGTFLGILLSYGFIAPLSNRLEYKVNDVTRVLTT 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYN 284
           +K  L+A +NG  PQVA+E+GRK L  ++RP    + + V    
Sbjct: 241 IKVTLLASLNGYAPQVAVEFGRKALYGADRPGFLELEEHVKSAK 284


>gi|306837355|ref|ZP_07470234.1| flagellar motor protein MotA [Brucella sp. NF 2653]
 gi|306407547|gb|EFM63747.1| flagellar motor protein MotA [Brucella sp. NF 2653]
          Length = 323

 Score =  256 bits (654), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 153/290 (52%), Positives = 208/290 (71%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           +  I+GL IT+ C++GGF AMGG+  +LIQP+E +I+ GA LG F +ANP  ++KD+G +
Sbjct: 34  LGIIVGLVITLGCMLGGFIAMGGHVSVLIQPWEFIIILGAALGTFFVANPFSLVKDTGRA 93

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            +E F      Q  Y DVL +LY LM  L+  SRNE E HID+P  S IF + P+VL+  
Sbjct: 94  CMEAFTDAVPKQRDYLDVLGVLYSLMRELRAKSRNEVEVHIDNPKESPIFLAYPSVLKKE 153

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +LT FICDY R+IIVGN RSYEIE LMDEEI  I  +KLKP+ A+  + E+LPA+GIV A
Sbjct: 154 DLTNFICDYCRLIIVGNVRSYEIEALMDEEIRTIARDKLKPHQAMITISEALPALGIVAA 213

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKAMG L QSP++LG  IG +L GT  GI  SY +  P+ ++IKSTR K +RLYI+
Sbjct: 214 VLGVIKAMGALDQSPEVLGHLIGAALVGTFAGIFFSYGVIGPIANKIKSTREKNNRLYIV 273

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK+ L+AYMNG++PQ+A+EYGRK +   ERP+I++V QE +     ++A+
Sbjct: 274 VKQTLLAYMNGSLPQIAVEYGRKTISAYERPTIDVVEQETMASVPTQQAA 323


>gi|218548502|ref|YP_002382293.1| flagellar motor protein MotA [Escherichia fergusonii ATCC 35469]
 gi|218356043|emb|CAQ88659.1| proton conductor component of flagella motor [Escherichia
           fergusonii ATCC 35469]
 gi|324113676|gb|EGC07651.1| chemotaxis protein motA [Escherichia fergusonii B253]
 gi|325496922|gb|EGC94781.1| flagellar motor protein MotA [Escherichia fergusonii ECD227]
          Length = 295

 Score =  256 bits (653), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 105/290 (36%), Positives = 167/290 (57%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  + I  + GG+   GG+   L QP E+VI+AGAG+G F++ N  K IK +  +
Sbjct: 1   MLIILGYLVVIGTVFGGYLMTGGSLGALYQPAELVIIAGAGIGAFIVGNNGKAIKGTLKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y D+L LLY LM   ++      E  I++P  S IF S P +L ++
Sbjct: 61  LPLLFRRSKYSKAMYMDLLALLYRLMAKSRQQGMFSLERDIENPQESEIFASYPRILADS 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FI DY+R+II G+  S+EIE LMDEEI+    E   P ++++ +G+SLPA GIV A
Sbjct: 121 VMLEFIVDYLRLIISGHMNSFEIEALMDEEIETHESEAEVPANSLAIVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+G+  +    LG  I  ++ GT LGI+L+Y   +PL   ++    +  ++   
Sbjct: 181 VMGVVHALGSADRPAAELGALIAHAMVGTFLGILLAYGFISPLAGVLRQKSAETTKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK  L++ +NG  P +A+E+GRK L  SERPS   + + V    +  + +
Sbjct: 241 VKVTLLSSLNGYAPPIAVEFGRKTLYSSERPSFVELEEHVRAVKNPNQQA 290


>gi|53720919|ref|YP_109905.1| flagellar motor protein MotA [Burkholderia pseudomallei K96243]
 gi|53724324|ref|YP_104372.1| flagellar motor protein MotA [Burkholderia mallei ATCC 23344]
 gi|67640464|ref|ZP_00439269.1| chemotaxis protein MotA [Burkholderia mallei GB8 horse 4]
 gi|76810929|ref|YP_331497.1| flagellar motor protein MotA [Burkholderia pseudomallei 1710b]
 gi|121600572|ref|YP_994716.1| flagellar motor protein MotA [Burkholderia mallei SAVP1]
 gi|124383824|ref|YP_001027661.1| flagellar motor protein MotA [Burkholderia mallei NCTC 10229]
 gi|126441486|ref|YP_001060852.1| flagellar motor protein MotA [Burkholderia pseudomallei 668]
 gi|126448569|ref|YP_001082632.1| flagellar motor protein MotA [Burkholderia mallei NCTC 10247]
 gi|126451764|ref|YP_001068159.1| flagellar motor protein MotA [Burkholderia pseudomallei 1106a]
 gi|134281489|ref|ZP_01768197.1| chemotaxis protein MotA [Burkholderia pseudomallei 305]
 gi|167000406|ref|ZP_02266220.1| chemotaxis MotA protein [Burkholderia mallei PRL-20]
 gi|167721694|ref|ZP_02404930.1| flagellar motor protein MotA [Burkholderia pseudomallei DM98]
 gi|167740672|ref|ZP_02413446.1| flagellar motor protein MotA [Burkholderia pseudomallei 14]
 gi|167817883|ref|ZP_02449563.1| flagellar motor protein MotA [Burkholderia pseudomallei 91]
 gi|167826261|ref|ZP_02457732.1| flagellar motor protein MotA [Burkholderia pseudomallei 9]
 gi|167847769|ref|ZP_02473277.1| flagellar motor protein MotA [Burkholderia pseudomallei B7210]
 gi|167896357|ref|ZP_02483759.1| flagellar motor protein MotA [Burkholderia pseudomallei 7894]
 gi|167904731|ref|ZP_02491936.1| flagellar motor protein MotA [Burkholderia pseudomallei NCTC 13177]
 gi|167913011|ref|ZP_02500102.1| flagellar motor protein MotA [Burkholderia pseudomallei 112]
 gi|167920948|ref|ZP_02508039.1| flagellar motor protein MotA [Burkholderia pseudomallei BCC215]
 gi|217424036|ref|ZP_03455536.1| chemotaxis protein MotA [Burkholderia pseudomallei 576]
 gi|237814249|ref|YP_002898700.1| chemotaxis protein MotA [Burkholderia pseudomallei MSHR346]
 gi|242317302|ref|ZP_04816318.1| chemotaxis protein MotA [Burkholderia pseudomallei 1106b]
 gi|254174899|ref|ZP_04881560.1| chemotaxis MotA protein [Burkholderia mallei ATCC 10399]
 gi|254183891|ref|ZP_04890482.1| chemotaxis protein MotA [Burkholderia pseudomallei 1655]
 gi|254186367|ref|ZP_04892884.1| chemotaxis protein MotA [Burkholderia pseudomallei Pasteur 52237]
 gi|254194544|ref|ZP_04900975.1| chemotaxis protein MotA [Burkholderia pseudomallei S13]
 gi|254201445|ref|ZP_04907809.1| chemotaxis MotA protein [Burkholderia mallei FMH]
 gi|254206787|ref|ZP_04913138.1| chemotaxis MotA protein [Burkholderia mallei JHU]
 gi|254260914|ref|ZP_04951968.1| chemotaxis protein MotA [Burkholderia pseudomallei 1710a]
 gi|254357190|ref|ZP_04973464.1| chemotaxis MotA protein [Burkholderia mallei 2002721280]
 gi|52211333|emb|CAH37322.1| chemotaxis protein MotA [Burkholderia pseudomallei K96243]
 gi|52427747|gb|AAU48340.1| chemotaxis MotA protein [Burkholderia mallei ATCC 23344]
 gi|76580382|gb|ABA49857.1| chemotaxis MotA protein [Burkholderia pseudomallei 1710b]
 gi|121229382|gb|ABM51900.1| chemotaxis MotA protein [Burkholderia mallei SAVP1]
 gi|124291844|gb|ABN01113.1| chemotaxis protein MotA [Burkholderia mallei NCTC 10229]
 gi|126220979|gb|ABN84485.1| chemotaxis protein MotA [Burkholderia pseudomallei 668]
 gi|126225406|gb|ABN88946.1| chemotaxis protein MotA [Burkholderia pseudomallei 1106a]
 gi|126241439|gb|ABO04532.1| chemotaxis protein MotA [Burkholderia mallei NCTC 10247]
 gi|134247156|gb|EBA47242.1| chemotaxis protein MotA [Burkholderia pseudomallei 305]
 gi|147747339|gb|EDK54415.1| chemotaxis MotA protein [Burkholderia mallei FMH]
 gi|147752329|gb|EDK59395.1| chemotaxis MotA protein [Burkholderia mallei JHU]
 gi|148026254|gb|EDK84339.1| chemotaxis MotA protein [Burkholderia mallei 2002721280]
 gi|157934052|gb|EDO89722.1| chemotaxis protein MotA [Burkholderia pseudomallei Pasteur 52237]
 gi|160695944|gb|EDP85914.1| chemotaxis MotA protein [Burkholderia mallei ATCC 10399]
 gi|169651294|gb|EDS83987.1| chemotaxis protein MotA [Burkholderia pseudomallei S13]
 gi|184214423|gb|EDU11466.1| chemotaxis protein MotA [Burkholderia pseudomallei 1655]
 gi|217393099|gb|EEC33121.1| chemotaxis protein MotA [Burkholderia pseudomallei 576]
 gi|237504138|gb|ACQ96456.1| chemotaxis protein MotA [Burkholderia pseudomallei MSHR346]
 gi|238521180|gb|EEP84633.1| chemotaxis protein MotA [Burkholderia mallei GB8 horse 4]
 gi|242140541|gb|EES26943.1| chemotaxis protein MotA [Burkholderia pseudomallei 1106b]
 gi|243063601|gb|EES45787.1| chemotaxis MotA protein [Burkholderia mallei PRL-20]
 gi|254219603|gb|EET08987.1| chemotaxis protein MotA [Burkholderia pseudomallei 1710a]
          Length = 286

 Score =  256 bits (653), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 104/285 (36%), Positives = 170/285 (59%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   +G  +T+L + GG+   GG+   L+QP EI+++ GAG+G F++ N +K IK +   
Sbjct: 1   MLIFVGTLVTLLSVFGGYALAGGHLGALVQPVEILMIVGAGVGAFIIGNGIKTIKATLRV 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +D Y +++ LLY+L+   +K      E  IDDP  S IFT  P +L ++
Sbjct: 61  LPTLFKGSKYNKDIYMELMALLYVLLAKARKEGTLTLEADIDDPEKSPIFTQYPKILADH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  F+ DY+R+++ GN  ++EIE+LMDEEI+    E   P HA+  +G+++PA GIV A
Sbjct: 121 HIVEFLTDYLRLMVGGNMNAFEIESLMDEEIETHHAEGEGPAHALMRVGDAMPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  M +  + P +LG  I  +L GT LGI+LSY L  PL S  +    +  +++  
Sbjct: 181 VMGVVHTMASADKPPAVLGAMIAQALVGTFLGILLSYGLIGPLASLAEQRVAESTKMFQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           +K  ++A +NG  P +A+E+GRKVL  +ERPS   + + V +   
Sbjct: 241 IKVTILASLNGYAPAIAVEFGRKVLFSTERPSFAELEEHVRRVKA 285


>gi|50120621|ref|YP_049788.1| flagellar motor protein MotA [Pectobacterium atrosepticum SCRI1043]
 gi|49611147|emb|CAG74593.1| chemotaxis protein [Pectobacterium atrosepticum SCRI1043]
          Length = 295

 Score =  256 bits (653), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 94/290 (32%), Positives = 168/290 (57%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  + +  I+GG+  +GG    L QP E++I+ GA +G F++ N  K IK +  +
Sbjct: 1   MLVILGYIVIVASILGGYLMVGGALGALYQPSELLIIGGAAIGAFIVGNNGKAIKATIRA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +       +  Y D++ LL+ +M   ++      E  ID+P  S IF+S P +L +N
Sbjct: 61  LPLLIKSSKYNKALYMDLMALLFRVMAKSRQQGMLSLEFDIDNPRESEIFSSYPNILSDN 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FI DY+R+++ GN  ++EIE LMDEEI+ + +E   P  +++ MG+ LPA GIV A
Sbjct: 121 NIVEFITDYLRLMVSGNMNAFEIETLMDEEIETVEHESEVPASSLTMMGDGLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ ++  + +    LG  I  ++ GT LGI+L+Y   +PL + ++    ++ ++   
Sbjct: 181 VMGVVHSLAYVDRPAAELGMMIAHAMVGTFLGILLAYGFVSPLAALLRQKNAEKIKVLQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           +K  L++ +NG  PQ+A+E+GRK L  +ERPS   + + + +     + +
Sbjct: 241 IKVTLLSSLNGYAPQIAVEFGRKTLYSTERPSFTELEEHIRRVKSPTQQA 290


>gi|271500048|ref|YP_003333073.1| flagellar motor protein MotA [Dickeya dadantii Ech586]
 gi|270343603|gb|ACZ76368.1| flagellar motor protein MotA [Dickeya dadantii Ech586]
          Length = 295

 Score =  255 bits (652), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 95/290 (32%), Positives = 168/290 (57%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  +TI  I+GG+  +GG    L QP E++I+ GA +G F++ N  K IK +  +
Sbjct: 1   MLVILGYLVTIGSILGGYLIVGGELGALYQPSELLIIGGAAVGAFIVGNNAKAIKATMKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y D++ +L+ LM   ++      E  ID+P  S IF++ P +L +N
Sbjct: 61  LPVLFQGSKYTKAVYMDLMAVLFRLMAKSRQQGMLSLEFDIDNPKESEIFSNYPRILADN 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  F+ DY+R+++ GN  ++EIE LMDEEI+ + +E   P  +++ MG+ LPA GIV A
Sbjct: 121 YIVEFVTDYLRLMVSGNMNAFEIETLMDEEIETVEHEVEVPATSLNLMGDGLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ ++  + +    LG  I  ++ GT LGI+L+Y   +PL S ++    ++ ++   
Sbjct: 181 VMGVVHSLAFVDRPAAELGMMIAHAMVGTFLGILLAYGFVSPLASLLRQKNSEKLKVLQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           +K  L++ +NG  PQ+A+E+GRK L  + RPS   + + +       + +
Sbjct: 241 IKVTLLSSLNGYAPQIAVEFGRKTLYSTVRPSFTEMEEHIRNVKAPAQQA 290


>gi|107024397|ref|YP_622724.1| flagellar motor protein MotA [Burkholderia cenocepacia AU 1054]
 gi|116688277|ref|YP_833900.1| flagellar motor protein MotA [Burkholderia cenocepacia HI2424]
 gi|170731590|ref|YP_001763537.1| flagellar motor protein MotA [Burkholderia cenocepacia MC0-3]
 gi|254246759|ref|ZP_04940080.1| hypothetical protein BCPG_01519 [Burkholderia cenocepacia PC184]
 gi|105894586|gb|ABF77751.1| flagellar motor component-like protein [Burkholderia cenocepacia AU
           1054]
 gi|116646366|gb|ABK07007.1| flagellar motor component-like protein [Burkholderia cenocepacia
           HI2424]
 gi|124871535|gb|EAY63251.1| hypothetical protein BCPG_01519 [Burkholderia cenocepacia PC184]
 gi|169814832|gb|ACA89415.1| flagellar motor protein MotA [Burkholderia cenocepacia MC0-3]
          Length = 286

 Score =  255 bits (652), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 106/285 (37%), Positives = 169/285 (59%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  +T+L + GG+   GG+   LIQP EI+++ GAG+G F++ N  K IK +   
Sbjct: 1   MLIIVGTLVTLLSVFGGYALAGGHLGALIQPVEILMIVGAGVGAFILGNGGKTIKATLRV 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +D Y +++ LLY+L+   +K      E  IDDP  S IFT  P +L + 
Sbjct: 61  LPTLFKGSKYTKDVYMELMALLYVLLAKARKEGTLTLEADIDDPEKSPIFTQYPKILADR 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  F+ DY+R+++ GN  ++EIE+LMDEEI+    E   P HA+  +G+++PA GIV A
Sbjct: 121 HIVEFLTDYLRLMVGGNMNAFEIESLMDEEIETHHTEGEGPAHALMRVGDAMPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  M +  + P +LG  I  +L GT LGI+LSY L  PL S  +    +  +++  
Sbjct: 181 VMGVVHTMASADKPPAVLGAMIAQALVGTFLGILLSYGLIGPLASLAEQRVAESTKMFQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           +K  ++A +NG  P +A+E+GRKVL  +ERPS   + + V +   
Sbjct: 241 IKVTILATLNGYAPAIAVEFGRKVLFSTERPSFSELEEHVRRVKA 285


>gi|167587858|ref|ZP_02380246.1| flagellar motor protein MotA [Burkholderia ubonensis Bu]
          Length = 286

 Score =  255 bits (652), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 107/285 (37%), Positives = 170/285 (59%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  +TIL + GG+   GG+   LIQP EI+++ GAG+G F++ N +K IK +   
Sbjct: 1   MLIIVGTLVTILSVFGGYALAGGHLGALIQPIEILMIVGAGVGAFILGNGMKTIKATLQV 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +D Y +++ LLY+L+   +K      E  IDDP  S IFT  P +L + 
Sbjct: 61  LPTLFKGSKYNKDVYMELMGLLYVLLAKARKEGTLTLEADIDDPDKSPIFTQYPKILADR 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  F+ DY+R+++ GN  ++EIE+LMDEEI+    E   P HA+  +G+++PA GIV A
Sbjct: 121 HIVEFLTDYLRLMVGGNMNAFEIESLMDEEIETHHTEGEGPAHALMRVGDAMPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  M +  + P +LG  I  +L GT LGI+LSY L  PL S  +    +  +++  
Sbjct: 181 VMGVVHTMASADKPPAVLGAMIAQALVGTFLGILLSYGLIGPLASLAEQRVAESTKMFQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           +K  ++A +NG  P +A+E+GRKVL  +ERPS   + + V +   
Sbjct: 241 IKVTILASLNGYAPAIAVEFGRKVLFSTERPSFAELEEHVRRVKA 285


>gi|296101765|ref|YP_003611911.1| flagellar motor protein MotA [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295056224|gb|ADF60962.1| flagellar motor protein MotA [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 295

 Score =  255 bits (652), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 100/288 (34%), Positives = 164/288 (56%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++G  + +  + GG+   GG+   L QP E++I+ GAG+G F++ N  K IK +  +
Sbjct: 1   MLILLGYLVVLGTVFGGYMMTGGHLGALYQPAELIIIGGAGVGAFIVGNNGKSIKGTLKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  +F      +  Y D+L LLY LM   ++      E  I++P  S IF S P +L + 
Sbjct: 61  IPLLFRRSKYTKSMYMDLLALLYRLMAKSRQQGMFSLERDIENPKESEIFASYPRILADA 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FI DY+R+II GN  ++EIE LMDEEI+    E   P ++++ +G+SLPA GIV A
Sbjct: 121 MMLDFIVDYLRLIISGNMNTFEIEALMDEEIETHESESEVPANSLALVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+ +  +    LG  I  ++ GT LGI+L+Y   +PL S ++    +  ++   
Sbjct: 181 VMGVVHALASADRPAAELGALIAHAMVGTFLGILLAYGFISPLASVLRQKSAETTKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
           VK  L++ +NG  P +A+E+GRK L  SERPS   + + V    +  +
Sbjct: 241 VKITLLSNLNGYAPPIAVEFGRKTLYSSERPSFIELEEHVRAVKNPNQ 288


>gi|319781689|ref|YP_004141165.1| flagellar motor protein MotA [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317167577|gb|ADV11115.1| flagellar motor protein MotA [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 291

 Score =  255 bits (652), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 154/290 (53%), Positives = 211/290 (72%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  +IGL +T+ C++GGF AMGG+ ++LIQP+E VI+ GA  G F++ANP+K +KD+G  
Sbjct: 1   MGILIGLVVTLGCVLGGFMAMGGHLHVLIQPWEAVIICGAAFGTFLVANPMKTVKDTGKG 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +LE F      +  Y + L +L+ LM  L+  SR+E E HID+P  S IF + PTVL N+
Sbjct: 61  ILEAFKQAVPKEQDYLETLGVLHSLMRELRSKSRSEVEAHIDNPEESAIFQAFPTVLHNH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +LT FICDY R+II+GNARS+EIE LMDEEI  I  +K+K YHA+  +G+ LPA+GIV A
Sbjct: 121 DLTHFICDYCRIIIIGNARSHEIEALMDEEIQTIRSDKMKAYHAMVAVGDGLPALGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG++KAMG L QSP+ILG  IG +L GT LGI LSYS+  P+ ++IK+ R K++RLYII
Sbjct: 181 VLGVVKAMGALDQSPEILGGLIGAALVGTFLGIFLSYSVVGPVATKIKTVREKKNRLYII 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK+ L+AYMNGA+PQVAIE+GRK +   ERP+I+ V Q  +     +K +
Sbjct: 241 VKQTLLAYMNGALPQVAIEFGRKTISSYERPTIDAVEQSTMNTGTVEKKA 290


>gi|121997036|ref|YP_001001823.1| putative chemotaxis (motility protein A) transmembrane
           [Halorhodospira halophila SL1]
 gi|121588441|gb|ABM61021.1| putative chemotaxis (motility protein A) transmembrane
           [Halorhodospira halophila SL1]
          Length = 290

 Score =  255 bits (652), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 100/290 (34%), Positives = 168/290 (57%), Gaps = 1/290 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  IIG  I    +I G+ A GG   IL QP+E +I+ GA +GGF++ANP+KVIK    +
Sbjct: 1   MLVIIGAAIAFFSVIVGYAAHGGPLAILWQPYEFLIIFGAAIGGFMIANPMKVIKRVLST 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           + +I G    G++ Y D+L LLY +    ++      E+ +D+P+ S +F S P +L ++
Sbjct: 61  VPKIPGGSPYGREHYMDLLALLYEIFQRAQRDGLLSIEDDVDNPHESELFKSYPRILNDH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+CDY+R+++ GN   +E+ENLMD EI+    E  +P  A++ + +++P  GI+ A
Sbjct: 121 VALEFLCDYLRLMVGGNMNPFEMENLMDVEIETHHKEAAQPAAAVNKVADAMPGFGIIAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG++ A+G+L +    +G  +  +L GT  GI   Y+   PL   + +   +Q +    
Sbjct: 181 LLGVVIALGSLDEDVMTIGGLVASALVGTFTGIFAGYAFVGPLGQAMDNRAAEQTKFLET 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL-QYNHNKKA 289
           +K  L+A +NG  P VA+E+GRK +  +ERP+   + + V  Q   ++ A
Sbjct: 241 IKLTLLAVLNGYKPVVAVEFGRKAMYEAERPTFFELEEHVKMQAARSQDA 290


>gi|170703864|ref|ZP_02894554.1| flagellar motor component-like protein [Burkholderia ambifaria
           IOP40-10]
 gi|172059244|ref|YP_001806896.1| flagellar motor protein MotA [Burkholderia ambifaria MC40-6]
 gi|170131225|gb|EDS99862.1| flagellar motor component-like protein [Burkholderia ambifaria
           IOP40-10]
 gi|171991761|gb|ACB62680.1| flagellar motor protein MotA [Burkholderia ambifaria MC40-6]
          Length = 286

 Score =  255 bits (652), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 105/285 (36%), Positives = 170/285 (59%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  +T+L + GG+   GG+   L+QP EI+++ GAG+G F++ N +K IK +   
Sbjct: 1   MLIIVGTLVTLLSVFGGYALAGGHLGALVQPLEILMITGAGVGAFILGNGMKTIKATLRV 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +D Y +++ LLY+L+   +K      E  IDDP  S IFT  P +L + 
Sbjct: 61  LPTLFKGSKYTKDVYMELMALLYVLLAKARKEGTLTLEADIDDPDKSPIFTQYPKILADR 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  F+ DY+R+++ GN  ++EIE+LMDEEI+    E   P HA+  +G+++PA GIV A
Sbjct: 121 HIVEFLTDYLRLMVGGNMNAFEIESLMDEEIETHHTEGEGPAHALMRVGDAMPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  M +  + P +LG  I  +L GT LGI+LSY L  PL S  +    +  +++  
Sbjct: 181 VMGVVHTMASADKPPAVLGAMIAQALVGTFLGILLSYGLIGPLASLAEQRVAESTKMFQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           +K  ++A +NG  P +A+E+GRKVL  +ERPS   + + V +   
Sbjct: 241 IKVTILASLNGYAPAIAVEFGRKVLFSTERPSFTELEEHVRRVKA 285


>gi|17989454|ref|NP_542087.1| flagellar motor protein MotA [Brucella melitensis bv. 1 str. 16M]
 gi|189022345|ref|YP_001932086.1| flagellar motor protein MotA [Brucella abortus S19]
 gi|297249976|ref|ZP_06933677.1| chemotaxis protein MotA [Brucella abortus bv. 5 str. B3196]
 gi|17985333|gb|AAL54351.1| chemotaxis mota protein [Brucella melitensis bv. 1 str. 16M]
 gi|189020919|gb|ACD73640.1| flagellar motor protein [Brucella abortus S19]
 gi|297173845|gb|EFH33209.1| chemotaxis protein MotA [Brucella abortus bv. 5 str. B3196]
          Length = 323

 Score =  255 bits (651), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 153/290 (52%), Positives = 207/290 (71%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           +  I+GL IT+ C++GGF AMGG+  +LIQP+E +I+ GA LG F +ANP  ++KD+G +
Sbjct: 34  LGIIVGLVITLGCMLGGFIAMGGHVSVLIQPWEFIIILGAALGTFFVANPFSLVKDTGRA 93

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            +E F      Q  Y DVL +LY LM  L+  SRNE E HID+P  S IF + P+VL+  
Sbjct: 94  CMEAFTDAVPKQRDYLDVLGVLYSLMRELRAKSRNEVEVHIDNPKESPIFLAYPSVLKKE 153

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +LT FICDY R+IIVGN RSYEIE LMDEEI  I  +KLKPY A+  + E+LPA+GIV A
Sbjct: 154 DLTNFICDYCRLIIVGNVRSYEIEALMDEEIRTIARDKLKPYQAMITISEALPALGIVAA 213

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +L +IKAMG L QSP++LG  IG +L GT  GI  SY +  P+ ++IKSTR K +RLYI+
Sbjct: 214 VLSVIKAMGALDQSPEVLGHLIGAALVGTFAGIFFSYGVIGPIANKIKSTREKNNRLYIV 273

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK+ L+AYMNG++PQ+A+EYGRK +   ERP+I++V QE +     ++A+
Sbjct: 274 VKQTLLAYMNGSLPQIAVEYGRKTISAYERPTIDVVEQETMASVPTQQAA 323


>gi|283785635|ref|YP_003365500.1| chemotaxis protein MotA (motility protein A) [Citrobacter rodentium
           ICC168]
 gi|282949089|emb|CBG88695.1| chemotaxis protein MotA (motility protein A) [Citrobacter rodentium
           ICC168]
          Length = 294

 Score =  254 bits (650), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 103/286 (36%), Positives = 162/286 (56%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++G  + I  + GG+   GG+   L QP E VI+ GAG+G F++ N  K IK +  +
Sbjct: 1   MLILLGYLVVIGTVFGGYMMTGGHLGALYQPAEFVIIGGAGIGAFIVGNNGKAIKGTLKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y D+L LLY LM   ++      E  I++P  S IF S P +L + 
Sbjct: 61  LPLLFRRSKYTKAMYMDLLALLYRLMAKSRQQGMFSLERDIENPKESEIFASYPRILADA 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FI DY+R+II GN  ++EIE LMDEEI+    E   P ++++ MG+SLPA GIV A
Sbjct: 121 VMLEFIVDYLRLIISGNMNTFEIEALMDEEIETHESEAEVPANSLALMGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+ +  +    LG  I  ++ GT LGI+L+Y   +PL + ++    +  ++   
Sbjct: 181 VMGVVHALASADRPAAELGALIAHAMVGTFLGILLAYGFISPLATVLRQKSAETTKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHN 286
           VK  L++ +NG  P +A+E+GRK L  SERPS   + + V    + 
Sbjct: 241 VKVTLLSNLNGYAPPIAVEFGRKTLYSSERPSFIELEEHVRAVRNP 286


>gi|206558532|ref|YP_002229292.1| flagellar motor protein MotA [Burkholderia cenocepacia J2315]
 gi|198034569|emb|CAR50434.1| chemotaxis protein MotA [Burkholderia cenocepacia J2315]
          Length = 286

 Score =  254 bits (650), Expect = 8e-66,   Method: Composition-based stats.
 Identities = 107/285 (37%), Positives = 171/285 (60%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  +T+L + GG+   GG+   LIQP EI+++AGAG+G F++ N  K IK +   
Sbjct: 1   MLIIVGTLVTLLSVFGGYALAGGHLGALIQPVEILMIAGAGVGAFILGNGGKTIKATLRV 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +D Y +++ LLY+L+   +K      E  IDDP  S IFT  P +L ++
Sbjct: 61  LPTLFKGSKYTKDVYMELMALLYVLLAKARKEGTLTLEADIDDPQKSPIFTQYPKILADH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  F+ DY+R+++ GN  ++EIE+LMDEEI+    E   P HA+  +G+++PA GIV A
Sbjct: 121 HIVEFLTDYLRLMVGGNMNAFEIESLMDEEIETHHAEGEGPAHALMRVGDAMPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  M +  + P +LG  I  +L GT LGI+LSY L  PL S  +    +  +++  
Sbjct: 181 VMGVVHTMASADKPPAVLGAMIAQALVGTFLGILLSYGLIGPLASLAEQRVAESTKMFQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           +K  ++A +NG  P +A+E+GRKVL  +ERPS   + + V +   
Sbjct: 241 IKVTILATLNGYAPAIAVEFGRKVLFSTERPSFSELEEHVRRVKA 285


>gi|224824156|ref|ZP_03697264.1| flagellar motor protein MotA [Lutiella nitroferrum 2002]
 gi|224603575|gb|EEG09750.1| flagellar motor protein MotA [Lutiella nitroferrum 2002]
          Length = 286

 Score =  254 bits (650), Expect = 9e-66,   Method: Composition-based stats.
 Identities = 97/284 (34%), Positives = 166/284 (58%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   IG  + +L ++GGF   GG+   L+QP E++++ GA +G FV+AN    +K +  +
Sbjct: 1   MFVGIGYVVILLSVLGGFVMAGGHLAALLQPLEVLMIGGAAIGAFVVANGGTPLKATLAA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F   +  +  Y ++  LL+ ++  ++K      E  +D+P +S +F+  P VL ++
Sbjct: 61  LPTLFKGSSYTKAFYMELFALLFEILAKVRKEGLMSVEADVDNPESSPVFSKYPAVLHDH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FICDY+R+++ GN  ++EIENLMD EI+   +E   P +A+  + + +PA GIV A
Sbjct: 121 HVVEFICDYLRLMVGGNLNAFEIENLMDVEIETHHHEGEVPVNAMKGLADGMPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  M ++   P  LG  I  +L GT LGI+L+Y    PL + ++       R++  
Sbjct: 181 VMGVVHTMESVGIPPSELGMLIAHALVGTFLGILLAYGFVGPLATILEHKLADGTRVFQT 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYN 284
           +K  L+A +NG  PQV++E+GRKVL   +RPS + +   V Q  
Sbjct: 241 IKVTLLASLNGYAPQVSVEFGRKVLASHDRPSFKELEDHVKQAK 284


>gi|186477723|ref|YP_001859193.1| flagellar motor protein MotA [Burkholderia phymatum STM815]
 gi|184194182|gb|ACC72147.1| chemotaxis protein MotA [Burkholderia phymatum STM815]
          Length = 286

 Score =  254 bits (650), Expect = 9e-66,   Method: Composition-based stats.
 Identities = 103/285 (36%), Positives = 171/285 (60%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   +G  +T+L + GG+   GG+   L+QP E++++AGAG+G F++ N +K IK +   
Sbjct: 1   MLIFVGTLVTLLSVFGGYALEGGHLGALMQPVEVLMIAGAGVGAFILGNGMKTIKATLRV 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  +F      +D Y +++ LLY+L+   +K      E  IDDP  S IFT  P +L ++
Sbjct: 61  IPTLFKGAKYNKDVYMELMALLYVLLAKARKEGTLTLEADIDDPQKSPIFTQYPKILADH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  F+ DY+R+++ GN  ++EIE+LMDEEI+    E   P HA+  +G+++PA GIV A
Sbjct: 121 HIVEFLTDYLRLMVGGNMNAFEIESLMDEEIETHHAEGEAPAHALMKVGDAMPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  M +  + P +LG  I  +L GT LGI+LSY L  PL S  +    +  +++  
Sbjct: 181 VMGVVHTMASADKPPAVLGEMIAQALVGTFLGILLSYGLIGPLASVAEQRVTESTKMFQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           +K  ++A +NG  P +A+E+GRKVL  +ERPS   + + V +   
Sbjct: 241 IKVTILASLNGYAPAIAVEFGRKVLFSTERPSFAELEEHVRRVKA 285


>gi|187920654|ref|YP_001889686.1| flagellar motor component-like protein [Burkholderia phytofirmans
           PsJN]
 gi|187719092|gb|ACD20315.1| flagellar motor component-like protein [Burkholderia phytofirmans
           PsJN]
          Length = 289

 Score =  254 bits (649), Expect = 9e-66,   Method: Composition-based stats.
 Identities = 99/289 (34%), Positives = 157/289 (54%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   IG  + I  +IG F  +GG+   L+QPFE++ + GA +G FV++NP   +K +  +
Sbjct: 1   MFVAIGWLLVIGSVIGSFVGVGGHLPALLQPFELLCIFGAAIGAFVVSNPTSTLKKTIKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +   F      ++ Y +++ LLY L+   +K      E  +  P  S IF     VLE++
Sbjct: 61  IPSCFKGGGYTKEKYLELIALLYELLQKARKEGMMSLEADVGAPEESVIFQKYSHVLEDH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FI DY+RM+  GN    E+++LMDEE+     E     +AI  M + LPA GIV A
Sbjct: 121 HLLDFIVDYLRMMSGGNVNVLEVQDLMDEELATHHAEASVAANAIQKMADGLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  MG++   P +LG  I  +L GT LGI+L+Y    P+   + +    + + Y  
Sbjct: 181 VMGVVHTMGSVGAPPAVLGEMIAGALVGTFLGILLAYGFIGPVADLLNAKGRAEAKPYQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKA 289
           VK  L+A ++G  P +A+E+GRKVL  ++RPS + +   V      K A
Sbjct: 241 VKAVLLASLSGYAPPIAVEFGRKVLFTADRPSFQELDDAVRATKMPKSA 289


>gi|220934495|ref|YP_002513394.1| putative chemotaxis (motility protein A) transmembrane
           [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995805|gb|ACL72407.1| putative chemotaxis (motility protein A) transmembrane
           [Thioalkalivibrio sp. HL-EbGR7]
          Length = 285

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 96/281 (34%), Positives = 163/281 (58%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M+ I+G  I  + ++GGF A GG    + QPFE+VI+ GA LG F+++N +K I      
Sbjct: 1   MNLILGAIIVTVSVLGGFMAHGGKLLAIWQPFEVVIICGAALGAFIISNSMKTIMKVFKG 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  + G     +  Y D+L LLY L    +K      E  I++P  S IF   P++L+++
Sbjct: 61  IPGLLGGPKYKKTHYLDLLALLYDLFTKARKEGLMGIEPDIEEPQESAIFQKYPSILKDH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FI DYMR+++ G+   +E++NLMD E++   +E  +P HA+  + ++LPA GIV A
Sbjct: 121 HVVEFISDYMRLVVSGSMNPFELDNLMDIELETHHHEVGEPAHAVQRVADALPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGI+  M +L    + +G  +  +L GT LGI+L+Y    P+++ ++     + + Y  
Sbjct: 181 VLGIVNTMDSLGGPIEEIGGKVAAALVGTFLGILLAYGFVGPMSTALERRAEDEAKFYAC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
           +K  ++A + G  PQVA+E+GRK +  + RPS + + Q + 
Sbjct: 241 LKACILANVQGYSPQVAVEFGRKTMASTLRPSFQELEQHLR 281


>gi|13472568|ref|NP_104135.1| flagellar motor protein MotA [Mesorhizobium loti MAFF303099]
 gi|14023314|dbj|BAB49921.1| flagellar motor protein; MotA [Mesorhizobium loti MAFF303099]
          Length = 291

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 151/290 (52%), Positives = 212/290 (73%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  +IGL +T+ C++GGF AMGG+ ++L+QP+E V++ GA LG F++ANP+K +KD+G  
Sbjct: 1   MGILIGLVVTLGCVLGGFMAMGGHLHVLVQPWEAVVICGAALGTFLVANPMKTVKDTGKG 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +LE F      +  Y + L +L+ LM  L+  SR+E E HID+P  S IF + PTVL+N+
Sbjct: 61  ILEAFKQAVPKEQDYLETLGVLHSLMRELRSKSRSEVEAHIDNPEESAIFQAFPTVLKNH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +L  FICDY R+II+GNARS+EIE LMDEEI  I  +K+K YHA+  +G+ LPA+GIV A
Sbjct: 121 DLMNFICDYCRIIIIGNARSHEIEALMDEEIQTIRSDKMKAYHALVAVGDGLPALGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG++KAMG L QSP+ILG  IG +L GT LGI LSY++  P+ ++IK+ R K++RLYII
Sbjct: 181 VLGVVKAMGALDQSPEILGGLIGAALVGTFLGIFLSYAVVGPVATKIKTVREKKNRLYII 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK+ L+AYMNGA+PQVAIE+GRK +   ERP+I+ V Q  +     +K +
Sbjct: 241 VKQTLLAYMNGALPQVAIEFGRKTISSYERPTIDAVEQSTMNTGSAEKKA 290


>gi|301018262|ref|ZP_07182775.1| flagellar motor protein MotA [Escherichia coli MS 69-1]
 gi|300399772|gb|EFJ83310.1| flagellar motor protein MotA [Escherichia coli MS 69-1]
          Length = 295

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 103/288 (35%), Positives = 167/288 (57%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++G  + +  + GG+   GG+   L QP E+VI+AGAG+G F++ N  K IK +  +
Sbjct: 1   MLILLGYLVVLGTVFGGYLMTGGSLGALYQPAELVIIAGAGIGSFIVGNNGKAIKGTLKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y D+L LLY LM   ++      E  I++P  S IF S P +L + 
Sbjct: 61  LPLLFRRSKYTKAMYMDLLALLYRLMAKSRQMGMFSLERDIENPRESEIFASYPRILADC 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FI DY+R+II G+  ++EIE LMDEEI+    E   P ++++ +G+SLPA GIV A
Sbjct: 121 VMLDFIVDYLRLIISGHMNTFEIEALMDEEIETHESEAEVPANSLALVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+G+  +    LG  I  ++ GT LGI+L+Y   +PL S ++    +  ++   
Sbjct: 181 VMGVVHALGSADRPAAELGALIAHAMVGTFLGILLAYGFISPLASVLRQKSAETSKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
           VK  L++ +NG  P +A+E+GRK L  SERPS   + + V    + ++
Sbjct: 241 VKVTLLSNLNGYAPPIAVEFGRKTLYSSERPSFIELEEHVRAVKNPQQ 288


>gi|254250907|ref|ZP_04944225.1| Flagellar motor component [Burkholderia dolosa AUO158]
 gi|124893516|gb|EAY67396.1| Flagellar motor component [Burkholderia dolosa AUO158]
          Length = 286

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 107/285 (37%), Positives = 171/285 (60%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  +T+L + GG+   GG+   LIQP EI+++AGAG+G F++ N +K IK +   
Sbjct: 1   MLIIVGTLVTLLSVFGGYALAGGHLGALIQPVEILMIAGAGVGAFILGNGMKTIKATLRV 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +D Y +++ LLY+L+   +K      E  IDDP  S IFT  P +L + 
Sbjct: 61  LPTLFKGSKYTKDVYMELMALLYVLLAKARKEGTLTLEADIDDPDKSPIFTQYPKILADR 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  F+ DY+R+++ GN  ++EIE+LMDEEI+    E   P HA+  +G+++PA GIV A
Sbjct: 121 HIVEFLTDYLRLMVGGNMNAFEIESLMDEEIETHHAEGEGPAHALMRVGDAMPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  M +  + P +LG  I  +L GT LGI+LSY L  PL S  +    +  +++  
Sbjct: 181 VMGVVHTMASADKPPAVLGAMIAQALVGTFLGILLSYGLIGPLASLAEQRVAESTKMFQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           +K  ++A +NG  P +A+E+GRKVL  +ERPS   + + V +   
Sbjct: 241 IKVTILASLNGYAPAIAVEFGRKVLFSTERPSFAELEEHVRRVKA 285


>gi|218699540|ref|YP_002407169.1| flagellar motor protein MotA [Escherichia coli IAI39]
 gi|218369526|emb|CAR17295.1| proton conductor component of flagella motor [Escherichia coli
           IAI39]
          Length = 295

 Score =  254 bits (648), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 102/288 (35%), Positives = 167/288 (57%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++G  + +  + GG+   GG+     QP E+VI+AGAG+G F++ N  K IK +  +
Sbjct: 1   MLILLGYLVVLGTVFGGYLMTGGSLGAFYQPAELVIIAGAGIGSFIVGNNGKAIKGTLKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y D+L LLY LM   ++      E  I++P  S IF S P +L ++
Sbjct: 61  LPLLFRRSKYTKAMYMDLLALLYRLMAKSRQMGMFSLERDIENPRESEIFASYPRILADS 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FI DY+R+II G+  ++EIE LMDEEI+    E   P ++++ +G+SLPA GIV A
Sbjct: 121 VMLEFIVDYLRLIISGHMNTFEIEALMDEEIETHESEAEVPANSLALVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+G+  +    LG  I  ++ GT LGI+L+Y   +PL S ++    +  ++   
Sbjct: 181 VMGVVHALGSADRPAAELGALIAHAMVGTFLGILLAYGFISPLASVLRQKSAETSKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
           VK  L++ +NG  P +A+E+GRK L  SERPS   + + V    + ++
Sbjct: 241 VKVTLLSNLNGYAPPIAVEFGRKTLYSSERPSFIELEEHVRAVKNPQQ 288


>gi|260844300|ref|YP_003222078.1| proton conductor component MotA [Escherichia coli O103:H2 str.
           12009]
 gi|257759447|dbj|BAI30944.1| proton conductor component MotA [Escherichia coli O103:H2 str.
           12009]
          Length = 295

 Score =  254 bits (648), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 103/288 (35%), Positives = 167/288 (57%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++G  + +  + GG+   GG+   L QP E+VI+AGAG+G F++ N  K IK +  +
Sbjct: 1   MLILLGYLVVLGTVFGGYLMTGGSLGALYQPAELVIIAGAGIGSFIVGNNGKAIKGTLKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y D+L LLY LM   ++      E  I++P  S IF S P +L ++
Sbjct: 61  LPLLFRRSKYTKAMYMDLLALLYRLMAKSRQMGMFSLERDIENPRESEIFASYPRILADS 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FI DY+R+II G+  ++EIE LMDEEI+    E   P ++++ +G+SLPA GIV A
Sbjct: 121 VMLDFIVDYLRLIISGHMNTFEIEALMDEEIETHESEAEVPANSLALVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+G+  +    LG  I  ++ GT LGI+L+Y   +PL S ++    +  ++   
Sbjct: 181 VMGVVHALGSADRPAAELGALIAHAMVGTFLGILLAYGFISPLASVLRQKSAETSKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
           VK  L++ +NG  P +A+E+GRK L  SERPS   + + V      ++
Sbjct: 241 VKVTLLSNLNGYAPPIAVEFGRKTLYSSERPSFIELEEHVRAVKSPQQ 288


>gi|83719743|ref|YP_443679.1| flagellar motor protein MotA [Burkholderia thailandensis E264]
 gi|167582719|ref|ZP_02375593.1| flagellar motor protein MotA [Burkholderia thailandensis TXDOH]
 gi|167620833|ref|ZP_02389464.1| flagellar motor protein MotA [Burkholderia thailandensis Bt4]
 gi|83653568|gb|ABC37631.1| chemotaxis MotA protein [Burkholderia thailandensis E264]
          Length = 286

 Score =  254 bits (648), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 104/285 (36%), Positives = 171/285 (60%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   +G  +T+L + GG+   GG+   L+QP EI+++ GAG+G F++ N +K IK +   
Sbjct: 1   MLIFVGTLVTLLSVFGGYALAGGHLGALVQPVEILMITGAGVGAFILGNGIKTIKATLRV 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +D Y +++ LLY+L+   +K      E  IDDP  S IFT  P +L ++
Sbjct: 61  LPTLFKGSKYNKDIYMELMALLYVLLAKARKEGTLTLEADIDDPEKSPIFTQYPKILADH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  F+ DY+R+++ GN  ++EIE+LMDEEI+    E   P HA+  +G+++PA GIV A
Sbjct: 121 HIVEFLTDYLRLMVGGNMNAFEIESLMDEEIETHHAEGEGPAHALMRVGDAMPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  M +  + P +LG  I  +L GT LGI+LSY L  PL+S  +    +  +++  
Sbjct: 181 VMGVVHTMASADKPPAVLGAMIAQALVGTFLGILLSYGLIGPLSSLAEQRVAESTKMFQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           +K  ++A +NG  P +A+E+GRKVL  +ERPS   + + V +   
Sbjct: 241 IKVTILASLNGYAPAIAVEFGRKVLFSTERPSFAELEEHVRRVKA 285


>gi|222084858|ref|YP_002543387.1| chemotaxis motility protein [Agrobacterium radiobacter K84]
 gi|221722306|gb|ACM25462.1| chemotaxis motility protein [Agrobacterium radiobacter K84]
          Length = 290

 Score =  254 bits (648), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 173/290 (59%), Positives = 222/290 (76%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M+ IIG  +T  CIIG F AMGG+   L QPFE VI+AGAG+GGF+MANP+KV+KDSG +
Sbjct: 1   MNIIIGFVVTCGCIIGSFMAMGGDVNALFQPFEFVIIAGAGIGGFIMANPMKVLKDSGKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L E F +    +  Y D L +LY LM +L+  SRNE E HID+P  S IF + PTVL+N 
Sbjct: 61  LGEAFRHAVPKERDYLDTLGVLYALMRDLRTKSRNEIEAHIDNPDESVIFQAAPTVLKNR 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +LT FICDY+R+II+GNARS+EIE LMDEEI+ I ++K+KPYHAI+ MG+S PAIGIV A
Sbjct: 121 DLTAFICDYVRLIIIGNARSHEIEALMDEEINTIQHDKMKPYHAITIMGDSFPAIGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKAM ++++SP++LG  IG +L GT LGIILSYS+C PL SQIK  R KQHRLY+I
Sbjct: 181 VLGVIKAMSHINESPEVLGHLIGSALVGTFLGIILSYSVCAPLVSQIKIVRNKQHRLYVI 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK+ L+AYMNG++PQVA+EYGRK +   ERPSI+ V QE++      KA+
Sbjct: 241 VKQTLLAYMNGSVPQVALEYGRKTISSYERPSIDAVEQEMMNPGGESKAA 290


>gi|167564511|ref|ZP_02357427.1| flagellar motor protein MotA [Burkholderia oklahomensis EO147]
 gi|167571660|ref|ZP_02364534.1| flagellar motor protein MotA [Burkholderia oklahomensis C6786]
          Length = 286

 Score =  254 bits (648), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 104/285 (36%), Positives = 170/285 (59%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   +G  +T+L + GG+   GG+   L+QP EI+++ GAG+G F++ N +K IK +   
Sbjct: 1   MLIFVGTLVTLLSVFGGYALAGGHLGALVQPVEILMIVGAGVGAFILGNGIKTIKATLRV 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +D Y +++ LLY+L+   +K      E  IDDP  S IFT  P +L + 
Sbjct: 61  LPSLFKGSKYNKDIYMELMALLYVLLAKARKEGTLTLEADIDDPEKSPIFTQYPKILADK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  F+ DY+R+++ GN  ++EIE+LMDEEI+    E   P HA+  +G+++PA GIV A
Sbjct: 121 HIVEFLTDYLRLMVGGNMNAFEIESLMDEEIETHHAEGEGPAHALMRVGDAMPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  M +  + P +LG  I  +L GT LGI+LSY L  PL+S  +    +  +++  
Sbjct: 181 VMGVVHTMASADKPPAVLGAMIAQALVGTFLGILLSYGLIGPLSSLAEQRVAESTKMFQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           +K  ++A +NG  P +A+E+GRKVL  +ERPS   + + V +   
Sbjct: 241 IKVTILASLNGYAPAIAVEFGRKVLFSTERPSFTELEEHVRRVKA 285


>gi|300904778|ref|ZP_07122606.1| flagellar motor protein MotA [Escherichia coli MS 84-1]
 gi|301305234|ref|ZP_07211331.1| flagellar motor protein MotA [Escherichia coli MS 124-1]
 gi|300403292|gb|EFJ86830.1| flagellar motor protein MotA [Escherichia coli MS 84-1]
 gi|300839440|gb|EFK67200.1| flagellar motor protein MotA [Escherichia coli MS 124-1]
 gi|315257276|gb|EFU37244.1| flagellar motor protein MotA [Escherichia coli MS 85-1]
          Length = 295

 Score =  254 bits (648), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 103/288 (35%), Positives = 168/288 (58%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++G  + +  + GG+   GGN   L QP E+VI+AGAG+G F++ N  K IK +  +
Sbjct: 1   MLILLGYLVVLGTVFGGYLMTGGNLGALYQPAELVIIAGAGIGSFIVGNNGKAIKGTLKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y D+L LLY LM   ++      E  I++P  S IF S P +L ++
Sbjct: 61  LPLLFRRSKYTKAMYMDLLALLYRLMAKSRQMGMFSLERDIENPRESEIFASYPRILADS 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FI DY+R+II G+  ++EIE LMDEEI+    E   P ++++ +G+SLPA GIV A
Sbjct: 121 VMLDFIVDYLRLIISGHMNTFEIEALMDEEIETHESEAEVPANSLALVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+G+  +    LG  I  ++ GT LGI+L+Y   +PL + ++    +  ++   
Sbjct: 181 VMGVVHALGSADRPAAELGALIAHAMVGTFLGILLAYGFISPLATVLRQKSAETSKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
           VK  L++ +NG  P +A+E+GRK L  SERPS   + + V    + ++
Sbjct: 241 VKVTLLSNLNGYAPPIAVEFGRKTLYSSERPSFIELEEHVRAVKNPQQ 288


>gi|15887906|ref|NP_353587.1| flagellar motor protein MotA [Agrobacterium tumefaciens str. C58]
 gi|3914040|sp|Q44456|MOTA_AGRT5 RecName: Full=Motility protein A; AltName: Full=Chemotaxis protein
           MotA
 gi|1480837|gb|AAC45321.1| MotA [Agrobacterium tumefaciens]
 gi|2459706|gb|AAB71782.1| MotA [Agrobacterium tumefaciens]
 gi|15155498|gb|AAK86372.1| flagellar motor protein [Agrobacterium tumefaciens str. C58]
          Length = 290

 Score =  254 bits (648), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 180/290 (62%), Positives = 232/290 (80%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M+ +IGL IT  CIIGG+ AMGG+  +L+QPFE++I+ GAGLGGF+MANP+KV+KDSG +
Sbjct: 1   MNIVIGLIITFGCIIGGYMAMGGHLNVLVQPFELMIIGGAGLGGFIMANPMKVVKDSGKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L E F +    +  Y DVL +LY LM +L+  SRNE E HID+P  S+IF S P+VL+N 
Sbjct: 61  LGEAFKHSVPKERNYLDVLGVLYSLMRDLRTKSRNEIEAHIDNPEESSIFQSAPSVLKNK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           ELT+FICDY+R+II+GNARS+EIE LMDEEI+ IL++KLKPYHAI+ MG+S PAIGIV A
Sbjct: 121 ELTSFICDYVRLIIIGNARSHEIEALMDEEIETILHDKLKPYHAITTMGDSFPAIGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKAMG +++SP++LG  IG +L GT+LGIILSYS+CNPL SQ+K  R KQHRLYII
Sbjct: 181 VLGVIKAMGKINESPEVLGGLIGAALVGTMLGIILSYSICNPLASQVKIVRTKQHRLYII 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK+ LIAYMNG++PQVA+EYGRK +   ERPSI+ V QE++      KA+
Sbjct: 241 VKQTLIAYMNGSVPQVALEYGRKTISNYERPSIDAVEQEMMNPGGENKAA 290


>gi|26248157|ref|NP_754197.1| flagellar motor protein MotA [Escherichia coli CFT073]
 gi|300994030|ref|ZP_07180649.1| flagellar motor protein MotA [Escherichia coli MS 45-1]
 gi|26108561|gb|AAN80764.1|AE016762_17 Chemotaxis motA protein [Escherichia coli CFT073]
 gi|300406398|gb|EFJ89936.1| flagellar motor protein MotA [Escherichia coli MS 45-1]
 gi|315290319|gb|EFU49695.1| flagellar motor protein MotA [Escherichia coli MS 153-1]
          Length = 295

 Score =  253 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 104/288 (36%), Positives = 168/288 (58%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++G  + +  + GG+   GGN   L QP E+VI+AGAG+G F++ N  K IK +  +
Sbjct: 1   MLILLGYLVVLGTVFGGYLMTGGNLGALYQPAELVIIAGAGIGSFIVGNNGKAIKGTLKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y D+L LLY LM   ++      E  I++P  S IF S P +L ++
Sbjct: 61  LPLLFRRSKYTKAMYMDLLALLYRLMAKSRQMGMFSLERDIENPRESEIFASYPRILADS 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FI DY+R+II G+  ++EIE LMDEEI+    E   P ++++ +G+SLPA GIV A
Sbjct: 121 VMLEFIVDYLRLIISGHMNTFEIEALMDEEIETHESEAEVPANSLALVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+G+  +    LG  I  ++ GT LGI+L+Y   +PL S ++    +  ++   
Sbjct: 181 VMGVVHALGSADRPAAELGALIAHAMVGTFLGILLAYGFISPLASVLRQKSAETSKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
           VK  L++ +NG  P +A+E+GRK L  SERPS   + + V    + ++
Sbjct: 241 VKVTLLSNLNGYAPPIAVEFGRKTLYSSERPSFIELEEHVRAVKNPQQ 288


>gi|157156438|ref|YP_001463196.1| flagellar motor protein MotA [Escherichia coli E24377A]
 gi|170681052|ref|YP_001743352.1| flagellar motor protein MotA [Escherichia coli SMS-3-5]
 gi|191168080|ref|ZP_03029879.1| chemotaxis protein MotA [Escherichia coli B7A]
 gi|194429332|ref|ZP_03061858.1| chemotaxis protein MotA [Escherichia coli B171]
 gi|194434129|ref|ZP_03066398.1| chemotaxis protein MotA [Shigella dysenteriae 1012]
 gi|209919316|ref|YP_002293400.1| flagellar motor protein MotA [Escherichia coli SE11]
 gi|256022445|ref|ZP_05436310.1| flagellar motor protein MotA [Escherichia sp. 4_1_40B]
 gi|260868488|ref|YP_003234890.1| proton conductor component MotA [Escherichia coli O111:H- str.
           11128]
 gi|293410202|ref|ZP_06653778.1| conserved hypothetical protein [Escherichia coli B354]
 gi|293415205|ref|ZP_06657848.1| chemotaxis protein MotA [Escherichia coli B185]
 gi|300917527|ref|ZP_07134184.1| flagellar motor protein MotA [Escherichia coli MS 115-1]
 gi|300924983|ref|ZP_07140908.1| flagellar motor protein MotA [Escherichia coli MS 182-1]
 gi|301327681|ref|ZP_07220888.1| flagellar motor protein MotA [Escherichia coli MS 78-1]
 gi|307314198|ref|ZP_07593808.1| proton conductor component MotA [Escherichia coli W]
 gi|309795999|ref|ZP_07690412.1| flagellar motor protein MotA [Escherichia coli MS 145-7]
 gi|331653300|ref|ZP_08354305.1| chemotaxis protein MotA [Escherichia coli M718]
 gi|331668587|ref|ZP_08369435.1| chemotaxis protein MotA [Escherichia coli TA271]
 gi|157078468|gb|ABV18176.1| chemotaxis protein MotA [Escherichia coli E24377A]
 gi|170518770|gb|ACB16948.1| chemotaxis protein MotA [Escherichia coli SMS-3-5]
 gi|190901878|gb|EDV61628.1| chemotaxis protein MotA [Escherichia coli B7A]
 gi|194412639|gb|EDX28935.1| chemotaxis protein MotA [Escherichia coli B171]
 gi|194417673|gb|EDX33773.1| chemotaxis protein MotA [Shigella dysenteriae 1012]
 gi|209912575|dbj|BAG77649.1| proton conductor component of motor [Escherichia coli SE11]
 gi|257764844|dbj|BAI36339.1| proton conductor component MotA [Escherichia coli O111:H- str.
           11128]
 gi|284921809|emb|CBG34882.1| chemotaxis protein MotA (motility protein A) [Escherichia coli 042]
 gi|291432853|gb|EFF05832.1| chemotaxis protein MotA [Escherichia coli B185]
 gi|291470670|gb|EFF13154.1| conserved hypothetical protein [Escherichia coli B354]
 gi|300415232|gb|EFJ98542.1| flagellar motor protein MotA [Escherichia coli MS 115-1]
 gi|300418858|gb|EFK02169.1| flagellar motor protein MotA [Escherichia coli MS 182-1]
 gi|300845776|gb|EFK73536.1| flagellar motor protein MotA [Escherichia coli MS 78-1]
 gi|306906167|gb|EFN36685.1| proton conductor component MotA [Escherichia coli W]
 gi|308120449|gb|EFO57711.1| flagellar motor protein MotA [Escherichia coli MS 145-7]
 gi|315061196|gb|ADT75523.1| proton conductor component of flagella motor [Escherichia coli W]
 gi|320177400|gb|EFW52401.1| Flagellar motor rotation protein MotA [Shigella dysenteriae CDC
           74-1112]
 gi|320178161|gb|EFW53138.1| Flagellar motor rotation protein MotA [Shigella boydii ATCC 9905]
 gi|320198586|gb|EFW73186.1| Flagellar motor rotation protein MotA [Escherichia coli EC4100B]
 gi|323158624|gb|EFZ44638.1| chemotaxis protein motA [Escherichia coli E128010]
 gi|323180689|gb|EFZ66234.1| chemotaxis protein motA [Escherichia coli 1180]
 gi|323186333|gb|EFZ71683.1| chemotaxis protein motA [Escherichia coli 1357]
 gi|323378227|gb|ADX50495.1| flagellar motor protein MotA [Escherichia coli KO11]
 gi|323968312|gb|EGB63719.1| chemotaxis protein MotA [Escherichia coli M863]
 gi|323977925|gb|EGB73011.1| chemotaxis protein MotA [Escherichia coli TW10509]
 gi|324017972|gb|EGB87191.1| flagellar motor protein MotA [Escherichia coli MS 117-3]
 gi|324118950|gb|EGC12839.1| chemotaxis protein MotA [Escherichia coli E1167]
 gi|327253020|gb|EGE64674.1| chemotaxis protein motA [Escherichia coli STEC_7v]
 gi|331049398|gb|EGI21470.1| chemotaxis protein MotA [Escherichia coli M718]
 gi|331063781|gb|EGI35692.1| chemotaxis protein MotA [Escherichia coli TA271]
          Length = 295

 Score =  253 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 103/288 (35%), Positives = 168/288 (58%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++G  + +  + GG+   GG+   L QP E+VI+AGAG+G F++ N  K IK +  +
Sbjct: 1   MLILLGYLVVLGTVFGGYLMTGGSLGALYQPAELVIIAGAGIGSFIVGNNGKAIKGTLKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y D+L LLY LM   ++      E  I++P  S IF S P +L ++
Sbjct: 61  LPLLFRRSKYTKAMYMDLLALLYRLMAKSRQMGMFSLERDIENPRESEIFASYPRILADS 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FI DY+R+II G+  ++EIE LMDEEI+    E   P ++++ +G+SLPA GIV A
Sbjct: 121 VMLDFIVDYLRLIISGHMNTFEIEALMDEEIETHESEAEVPANSLALVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+G+  +    LG  I  ++ GT LGI+L+Y   +PL S ++    +  ++   
Sbjct: 181 VMGVVHALGSADRPAAELGALIAHAMVGTFLGILLAYGFISPLASVLRQKSAETSKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
           VK  L++ +NG  P +A+E+GRK L  SERPS   + + V    + ++
Sbjct: 241 VKVTLLSNLNGYAPPIAVEFGRKTLYSSERPSFIELEEHVRAVKNPQQ 288


>gi|163856410|ref|YP_001630708.1| flagellar motor protein MotA [Bordetella petrii DSM 12804]
 gi|163260138|emb|CAP42439.1| flagellar motor component MotA [Bordetella petrii]
          Length = 291

 Score =  253 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 105/287 (36%), Positives = 169/287 (58%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  +IG  + ++ +IG F A+GG+   L QPFE+ ++AG  LG F+  N  K +     +
Sbjct: 1   MLIVIGYAVVLVAVIGSFAALGGHMGALYQPFELTLIAGGALGAFLAGNSRKSLALMRRA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L +        ++ Y +++ LLY+L+   ++      E+HI+DP  S IF+  P + +++
Sbjct: 61  LPQAIKGAPYSKEVYMELMALLYVLLNKARREGLMAIESHIEDPDASAIFSEYPRIRQDD 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +L  FI DY+R++I GN  S+EIE LMDEEI+   +E+  P H++  M + LPA GIV A
Sbjct: 121 KLMEFITDYLRIMISGNMSSFEIETLMDEEIETYRHEREVPSHSLQQMADGLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKA+G + Q   +LG  I  ++ GT LG++L+Y    PL S++     +  ++   
Sbjct: 181 VLGVIKALGAVDQPAAVLGDLISKAMVGTFLGVLLAYGFVAPLASRLDRRTSESVKVLEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
           +K  L+A MNG  PQ+A+E+GRKVL  + RPS   + + V Q     
Sbjct: 241 IKVTLLASMNGYPPQLAVEFGRKVLFSTVRPSFGELEEHVRQAKSAA 287


>gi|161502955|ref|YP_001570067.1| flagellar motor protein MotA [Salmonella enterica subsp. arizonae
           serovar 62:z4,z23:-- str. RSK2980]
 gi|160864302|gb|ABX20925.1| hypothetical protein SARI_01017 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 295

 Score =  253 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 101/288 (35%), Positives = 164/288 (56%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++G  + I  + GG+   GG+   L QP E+VI+ GAG+G F++ N  K IK +  +
Sbjct: 1   MLILLGYLVVIGTVFGGYVMTGGHLGALYQPAELVIIGGAGIGAFIVGNNGKAIKGTMKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  +F      +  Y D+L LLY LM   ++      E  I++P  S IF S P +L + 
Sbjct: 61  IPLLFRRSKYTKTMYMDLLALLYRLMAKSRQQGMFSLERDIENPKESEIFASYPRILADA 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FI DY+R+II GN  ++EIE LMDEEI+    E   P ++++ +G+SLPA GIV A
Sbjct: 121 VMLDFIVDYLRLIISGNMNTFEIEALMDEEIETHESESEVPANSLAMVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+ +  +    LG  I  ++ GT LGI+L+Y   +PL + ++    +  ++   
Sbjct: 181 VMGVVHALASADRPAAELGALIAHAMVGTFLGILLAYGFISPLATVLRQKSAETTKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
           VK  L++ +NG  P +A+E+GRK L  SERPS   + + V    +  +
Sbjct: 241 VKITLLSNLNGYAPPIAVEFGRKTLYSSERPSFIELEEHVRAVRNPNQ 288


>gi|114320661|ref|YP_742344.1| putative chemotaxis (motility protein A) transmembrane
           [Alkalilimnicola ehrlichii MLHE-1]
 gi|114227055|gb|ABI56854.1| putative chemotaxis (motility protein A) transmembrane
           [Alkalilimnicola ehrlichii MLHE-1]
          Length = 285

 Score =  253 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 99/285 (34%), Positives = 168/285 (58%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G+ I ++ +  G+ A GGN  +L QPFE++I+ GA  G F++ANP+KV+K    +
Sbjct: 1   MKLILGVIIVLVSVAVGYTAHGGNLAVLWQPFEVLIIFGAAGGAFLIANPMKVVKQVAGN 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  I       +  Y D+L LLY +    ++      E  +D+P+ S +F   P+VL ++
Sbjct: 61  VPRIMKGPPYRKQHYMDLLALLYEVFQKTQRDGLLSIEADVDNPHESELFRKYPSVLNDH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           E   F+CDY+R+++ GN   +E+ENLMD E++    E   P HA++ + ++LP  GI+ A
Sbjct: 121 EALHFLCDYLRLMVGGNMNPFELENLMDVELETHHQEAELPAHAVNRVADALPGFGIIAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGI+ AMG +    + +G+ +  +L GT +GI+  YSL  PL   ++    ++ +   +
Sbjct: 181 LLGIVIAMGEIDGPVQQIGSLVAAALIGTFIGILAGYSLVGPLGIAMEHRAREKAKYLEV 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           +K  ++A +NG  P VA+E+GRK +  +ERPS E +   V  +N 
Sbjct: 241 IKVTIMAVLNGYKPVVAVEFGRKAMYEAERPSFEELENHVKGHNA 285


>gi|167838310|ref|ZP_02465169.1| flagellar motor protein MotA [Burkholderia thailandensis MSMB43]
          Length = 286

 Score =  253 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 102/285 (35%), Positives = 170/285 (59%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   +G  +T+L + GG+   GG+   L+QP EI+++ GAG+G F++ N +K IK +   
Sbjct: 1   MLIFVGTLVTLLSVFGGYALAGGHLGALVQPVEILMIVGAGVGAFIIGNGIKTIKATLRV 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +       +D Y +++ LLY+L+   +K      E  ID+P  S IFT  P +L ++
Sbjct: 61  LPTLLKGSKYNKDIYMELMALLYVLLAKARKEGTLTLEADIDEPEKSPIFTQYPKILADH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  F+ DY+R+++ GN  ++EIE+LMDEEI+    E   P HA+  +G+++PA GIV A
Sbjct: 121 HIVEFLTDYLRLMVGGNMNAFEIESLMDEEIETHHAEGEGPAHALMRVGDAMPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  M +  + P +LG  I  +L GT LGI+LSY L  PL+S  +    +  +++  
Sbjct: 181 VMGVVHTMASADKPPAVLGAMIAQALVGTFLGILLSYGLIGPLSSLAEQRVAESTKMFQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           +K  ++A +NG  P +A+E+GRKVL  +ERPS   + + V +   
Sbjct: 241 IKVTILASLNGYAPAIAVEFGRKVLFSTERPSFAELEEHVRRVKA 285


>gi|16129842|ref|NP_416404.1| proton conductor component of flagella motor [Escherichia coli str.
           K-12 substr. MG1655]
 gi|89108730|ref|AP_002510.1| proton conductor component of flagella motor [Escherichia coli str.
           K-12 substr. W3110]
 gi|157161362|ref|YP_001458680.1| flagellar motor protein MotA [Escherichia coli HS]
 gi|170019765|ref|YP_001724719.1| flagellar motor protein MotA [Escherichia coli ATCC 8739]
 gi|170081545|ref|YP_001730865.1| proton conductor component of flagella motor [Escherichia coli str.
           K-12 substr. DH10B]
 gi|188495499|ref|ZP_03002769.1| chemotaxis protein MotA [Escherichia coli 53638]
 gi|193069861|ref|ZP_03050810.1| chemotaxis protein MotA [Escherichia coli E110019]
 gi|218554478|ref|YP_002387391.1| flagellar motor protein MotA [Escherichia coli IAI1]
 gi|218695456|ref|YP_002403123.1| flagellar motor protein MotA [Escherichia coli 55989]
 gi|238901105|ref|YP_002926901.1| proton conductor component of flagella motor [Escherichia coli
           BW2952]
 gi|253773153|ref|YP_003035984.1| flagellar motor protein MotA [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|254161950|ref|YP_003045058.1| flagellar motor protein MotA [Escherichia coli B str. REL606]
 gi|256017906|ref|ZP_05431771.1| flagellar motor protein MotA [Shigella sp. D9]
 gi|293446277|ref|ZP_06662699.1| chemotaxis protein motA [Escherichia coli B088]
 gi|300819875|ref|ZP_07100060.1| flagellar motor protein MotA [Escherichia coli MS 107-1]
 gi|300928924|ref|ZP_07144428.1| flagellar motor protein MotA [Escherichia coli MS 187-1]
 gi|300951514|ref|ZP_07165349.1| flagellar motor protein MotA [Escherichia coli MS 116-1]
 gi|300956596|ref|ZP_07168875.1| flagellar motor protein MotA [Escherichia coli MS 175-1]
 gi|301645592|ref|ZP_07245521.1| flagellar motor protein MotA [Escherichia coli MS 146-1]
 gi|307138555|ref|ZP_07497911.1| flagellar motor protein MotA [Escherichia coli H736]
 gi|312969934|ref|ZP_07784117.1| chemotaxis protein motA [Escherichia coli 1827-70]
 gi|331642508|ref|ZP_08343643.1| chemotaxis protein MotA [Escherichia coli H736]
 gi|331677775|ref|ZP_08378450.1| chemotaxis protein MotA [Escherichia coli H591]
 gi|332278937|ref|ZP_08391350.1| proton conductor component of flagella motor [Shigella sp. D9]
 gi|127249|sp|P09348|MOTA_ECOLI RecName: Full=Motility protein A; AltName: Full=Chemotaxis protein
           MotA
 gi|146882|gb|AAA24177.1| chemotaxis protein MotA [Escherichia coli]
 gi|1736549|dbj|BAA15711.1| proton conductor component of flagella motor [Escherichia coli str.
           K12 substr. W3110]
 gi|1788199|gb|AAC74960.1| proton conductor component of flagella motor [Escherichia coli str.
           K-12 substr. MG1655]
 gi|157067042|gb|ABV06297.1| chemotaxis protein MotA [Escherichia coli HS]
 gi|169754693|gb|ACA77392.1| proton conductor component of motor [Escherichia coli ATCC 8739]
 gi|169889380|gb|ACB03087.1| proton conductor component of flagella motor [Escherichia coli str.
           K-12 substr. DH10B]
 gi|188490698|gb|EDU65801.1| chemotaxis protein MotA [Escherichia coli 53638]
 gi|192956761|gb|EDV87215.1| chemotaxis protein MotA [Escherichia coli E110019]
 gi|218352188|emb|CAU97929.1| proton conductor component of flagella motor [Escherichia coli
           55989]
 gi|218361246|emb|CAQ98830.1| proton conductor component of flagella motor [Escherichia coli
           IAI1]
 gi|238863327|gb|ACR65325.1| proton conductor component of flagella motor [Escherichia coli
           BW2952]
 gi|242377611|emb|CAQ32367.1| MotA protein, proton conductor component of motor; no effect on
           switching, subunit of Flagellar Motor Complex and
           Flagellum [Escherichia coli BL21(DE3)]
 gi|253324197|gb|ACT28799.1| Flagellar motor component-like protein [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253973851|gb|ACT39522.1| flagellar motor protein MotA [Escherichia coli B str. REL606]
 gi|253978045|gb|ACT43715.1| flagellar motor protein MotA [Escherichia coli BL21(DE3)]
 gi|260448987|gb|ACX39409.1| flagellar motor protein MotA [Escherichia coli DH1]
 gi|291323107|gb|EFE62535.1| chemotaxis protein motA [Escherichia coli B088]
 gi|300316578|gb|EFJ66362.1| flagellar motor protein MotA [Escherichia coli MS 175-1]
 gi|300449264|gb|EFK12884.1| flagellar motor protein MotA [Escherichia coli MS 116-1]
 gi|300463078|gb|EFK26571.1| flagellar motor protein MotA [Escherichia coli MS 187-1]
 gi|300527572|gb|EFK48634.1| flagellar motor protein MotA [Escherichia coli MS 107-1]
 gi|301076124|gb|EFK90930.1| flagellar motor protein MotA [Escherichia coli MS 146-1]
 gi|309702113|emb|CBJ01428.1| chemotaxis protein MotA (motility protein A) [Escherichia coli ETEC
           H10407]
 gi|310338219|gb|EFQ03308.1| chemotaxis protein motA [Escherichia coli 1827-70]
 gi|315136533|dbj|BAJ43692.1| flagellar motor protein MotA [Escherichia coli DH1]
 gi|315617884|gb|EFU98482.1| chemotaxis protein motA [Escherichia coli 3431]
 gi|323937149|gb|EGB33429.1| chemotaxis protein MotA [Escherichia coli E1520]
 gi|323940441|gb|EGB36632.1| chemotaxis protein MotA [Escherichia coli E482]
 gi|323948224|gb|EGB44212.1| chemotaxis protein MotA [Escherichia coli H120]
 gi|323961945|gb|EGB57544.1| chemotaxis protein MotA [Escherichia coli H489]
 gi|331039306|gb|EGI11526.1| chemotaxis protein MotA [Escherichia coli H736]
 gi|331074235|gb|EGI45555.1| chemotaxis protein MotA [Escherichia coli H591]
 gi|332089625|gb|EGI94727.1| chemotaxis protein motA [Shigella boydii 5216-82]
 gi|332101289|gb|EGJ04635.1| proton conductor component of flagella motor [Shigella sp. D9]
          Length = 295

 Score =  253 bits (646), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 102/288 (35%), Positives = 168/288 (58%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++G  + +  + GG+   GG+   L QP E+VI+AGAG+G F++ N  K IK +  +
Sbjct: 1   MLILLGYLVVLGTVFGGYLMTGGSLGALYQPAELVIIAGAGIGSFIVGNNGKAIKGTLKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y D+L LLY LM   ++      E  I++P  S IF S P +L ++
Sbjct: 61  LPLLFRRSKYTKAMYMDLLALLYRLMAKSRQMGMFSLERDIENPRESEIFASYPRILADS 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FI DY+R+II G+  ++EIE LMDEEI+    E   P ++++ +G+SLPA GIV A
Sbjct: 121 VMLDFIVDYLRLIISGHMNTFEIEALMDEEIETHESEAEVPANSLALVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+G+  +    LG  I  ++ GT LGI+L+Y   +PL + ++    +  ++   
Sbjct: 181 VMGVVHALGSADRPAAELGALIAHAMVGTFLGILLAYGFISPLATVLRQKSAETSKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
           VK  L++ +NG  P +A+E+GRK L  SERPS   + + V    + ++
Sbjct: 241 VKVTLLSNLNGYAPPIAVEFGRKTLYSSERPSFIELEEHVRAVKNPQQ 288


>gi|331673415|ref|ZP_08374183.1| chemotaxis protein MotA [Escherichia coli TA280]
 gi|331069613|gb|EGI41000.1| chemotaxis protein MotA [Escherichia coli TA280]
          Length = 295

 Score =  253 bits (646), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 103/288 (35%), Positives = 167/288 (57%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++G  + +  + GG+   GG+   L QP E+VI+AGAG+G F++ N  K IK +  +
Sbjct: 1   MLILLGYLVVLGTVFGGYLMTGGSLGALYQPAELVIIAGAGIGSFIVGNNGKAIKGTLKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y D+L LLY LM   ++      E  I++P  S IF S P +L ++
Sbjct: 61  LPLLFRRSKYTKAMYMDLLALLYRLMAKSRQMGMFSLERDIENPRESEIFASYPRILADS 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FI DY+R+II G+  ++EIE LMDEEI+    E   P ++++  G+SLPA GIV A
Sbjct: 121 VMLDFIVDYLRLIISGHMNTFEIEALMDEEIETHESEAEVPANSLALAGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+G+  +    LG  I  ++ GT LGI+L+Y   +PL S ++    +  ++   
Sbjct: 181 VMGVVHALGSADRPAAELGALIAHAMVGTFLGILLAYGFISPLASVLRQKSAETSKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
           VK  L++ +NG  P +A+E+GRK L  SERPS   + + V    + ++
Sbjct: 241 VKVTLLSNLNGYAPPIAVEFGRKTLYSSERPSFIELEEHVRAVKNPQQ 288


>gi|295678084|ref|YP_003606608.1| flagellar motor protein MotA [Burkholderia sp. CCGE1002]
 gi|295437927|gb|ADG17097.1| flagellar motor protein MotA [Burkholderia sp. CCGE1002]
          Length = 286

 Score =  253 bits (646), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 102/285 (35%), Positives = 170/285 (59%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   +G  +T+L + GG+   GG+   L+QP E++++AGAGLG F++ N +K I+ +   
Sbjct: 1   MLIFVGTLVTLLSVFGGYALEGGHLGALLQPVEVLMIAGAGLGAFILGNGMKTIRATLRV 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  +F      +D Y +++ LLY+L+   +K      E  IDDP  S IFT  P +L + 
Sbjct: 61  IPTLFKGAKYNKDVYMELMALLYVLLAKARKEGTLTLEADIDDPSKSPIFTQYPKILADK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  F+ DY+R+++ GN  ++EIE+LMDEEI+    E   P  A++ +G+++PA GIV A
Sbjct: 121 HIIEFLTDYLRLMVGGNMNAFEIESLMDEEIETHHQEGEAPAQALAKVGDAMPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  M +  + P +LG  I  +L GT LGI+LSY L  PL S  +    +  +++  
Sbjct: 181 VMGVVHTMASADRPPAVLGEMIAQALVGTFLGILLSYGLIGPLASVAEQRVTESTKMFQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           +K  ++A +NG  P +A+E+GRKVL  +ERPS   + + V +   
Sbjct: 241 IKVTILASLNGYAPAIAVEFGRKVLFSTERPSFAELEEHVRRVKA 285


>gi|16765265|ref|NP_460880.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|56413158|ref|YP_150233.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|62180500|ref|YP_216917.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|161613517|ref|YP_001587482.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Paratyphi B str. SPB7]
 gi|167552437|ref|ZP_02346190.1| chemotaxis protein MotA [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|167994229|ref|ZP_02575321.1| chemotaxis protein MotA [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|168234011|ref|ZP_02659069.1| chemotaxis protein MotA [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|168238557|ref|ZP_02663615.1| chemotaxis protein MotA [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|168241556|ref|ZP_02666488.1| chemotaxis protein MotA [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|168259798|ref|ZP_02681771.1| chemotaxis protein MotA [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|168462542|ref|ZP_02696473.1| chemotaxis protein MotA [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|168820751|ref|ZP_02832751.1| chemotaxis protein MotA [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|194444912|ref|YP_002041190.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194450514|ref|YP_002045978.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194468783|ref|ZP_03074767.1| chemotaxis protein MotA [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194735541|ref|YP_002114960.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197248635|ref|YP_002146097.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197265988|ref|ZP_03166062.1| chemotaxis protein MotA [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|198243470|ref|YP_002215159.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|200389572|ref|ZP_03216183.1| chemotaxis protein MotA [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|204931070|ref|ZP_03221896.1| chemotaxis protein MotA [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|224583573|ref|YP_002637371.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|238912500|ref|ZP_04656337.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
 gi|2494510|sp|P55891|MOTA_SALTY RecName: Full=Motility protein A; AltName: Full=Chemotaxis protein
           MotA
 gi|1764127|gb|AAC45265.1| MotA [Salmonella enterica subsp. enterica serovar Typhimurium]
 gi|6045177|dbj|BAA85316.1| MotA protein [Salmonella enterica subsp. enterica serovar
           Typhimurium]
 gi|16420460|gb|AAL20839.1| proton conductor component of motor [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|56127415|gb|AAV76921.1| motility protein A [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|62128133|gb|AAX65836.1| proton conductor component of motor, torque generator [Salmonella
           enterica subsp. enterica serovar Choleraesuis str.
           SC-B67]
 gi|161362881|gb|ABX66649.1| hypothetical protein SPAB_01237 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194403575|gb|ACF63797.1| chemotaxis protein MotA [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194408818|gb|ACF69037.1| chemotaxis protein MotA [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194455147|gb|EDX43986.1| chemotaxis protein MotA [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194711043|gb|ACF90264.1| chemotaxis protein MotA [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|195634498|gb|EDX52850.1| chemotaxis protein MotA [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|197212338|gb|ACH49735.1| chemotaxis protein MotA [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197244243|gb|EDY26863.1| chemotaxis protein MotA [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197288649|gb|EDY28024.1| chemotaxis protein MotA [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|197937986|gb|ACH75319.1| chemotaxis protein MotA [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|199602017|gb|EDZ00563.1| chemotaxis protein MotA [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|204320114|gb|EDZ05319.1| chemotaxis protein MotA [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|205322878|gb|EDZ10717.1| chemotaxis protein MotA [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205327857|gb|EDZ14621.1| chemotaxis protein MotA [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205331990|gb|EDZ18754.1| chemotaxis protein MotA [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|205339404|gb|EDZ26168.1| chemotaxis protein MotA [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|205342756|gb|EDZ29520.1| chemotaxis protein MotA [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|205350824|gb|EDZ37455.1| chemotaxis protein MotA [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|224468100|gb|ACN45930.1| flagellar motor protein [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|267993910|gb|ACY88795.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|312912917|dbj|BAJ36891.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|320085457|emb|CBY95238.1| Chemotaxis protein motA Motility protein A [Salmonella enterica
           subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|321224567|gb|EFX49630.1| Flagellar motor rotation protein MotA [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|322714976|gb|EFZ06547.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
 gi|323130207|gb|ADX17637.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|326622908|gb|EGE29253.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
 gi|326627425|gb|EGE33768.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
 gi|332988816|gb|AEF07799.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 295

 Score =  253 bits (646), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 101/288 (35%), Positives = 164/288 (56%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++G  + I  + GG+   GG+   L QP E+VI+ GAG+G F++ N  K IK +  +
Sbjct: 1   MLILLGYLVVIGTVFGGYVMTGGHLGALYQPAELVIIGGAGIGAFIVGNNGKAIKGTMKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  +F      +  Y D+L LLY LM   ++      E  I++P  S IF S P +L + 
Sbjct: 61  IPLLFRRSKYTKSMYMDLLALLYRLMAKSRQQGMFSLERDIENPKESEIFASYPRILADA 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FI DY+R+II GN  ++EIE LMDEEI+    E   P ++++ +G+SLPA GIV A
Sbjct: 121 VMLDFIVDYLRLIISGNMNTFEIEALMDEEIETHESEAEVPANSLAMVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+ +  +    LG  I  ++ GT LGI+L+Y   +PL + ++    +  ++   
Sbjct: 181 VMGVVHALASADRPAAELGALIAHAMVGTFLGILLAYGFISPLATVLRQKSAETTKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
           VK  L++ +NG  P +A+E+GRK L  SERPS   + + V    +  +
Sbjct: 241 VKITLLSNLNGYAPPIAVEFGRKTLYSSERPSFIELEEHVRAVRNPNQ 288


>gi|324013536|gb|EGB82755.1| flagellar motor protein MotA [Escherichia coli MS 60-1]
          Length = 295

 Score =  253 bits (646), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 104/288 (36%), Positives = 169/288 (58%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++G  + +  + GGF+  GG+   L QP E+VI+AGAG+G F++ N  K IK +  +
Sbjct: 1   MLILLGYLVVLGTVFGGFFLTGGSLGALYQPAELVIIAGAGIGSFIVGNNGKAIKGTLKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y D+L LLY LM   ++      E  I++P  S IF S P +L ++
Sbjct: 61  LPLLFRRTKYTKAMYMDLLALLYRLMAKSRQMGMFSLERDIENPRESEIFASYPRILADS 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FI DY+R+II G+  ++EIE LMDEEI+    E   P ++++ +G+SLPA GIV A
Sbjct: 121 VMLEFIVDYLRLIISGHMNTFEIEALMDEEIETHESEAEVPANSLALVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+G+  +    LG  I  ++ GT LGI+L+Y   +PL S ++    +  ++   
Sbjct: 181 VMGVVHALGSADRPAAELGALIAHAMVGTFLGILLAYGFISPLASVLRQKSAETSKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
           VK  L++ +NG  P +A+E+GRK L  SERPS   + + V    + ++
Sbjct: 241 VKVTLLSNLNGYAPPIAVEFGRKTLYSSERPSFIELEEHVRAVKNPQQ 288


>gi|170769361|ref|ZP_02903814.1| chemotaxis protein MotA [Escherichia albertii TW07627]
 gi|170121685|gb|EDS90616.1| chemotaxis protein MotA [Escherichia albertii TW07627]
          Length = 295

 Score =  253 bits (646), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 102/288 (35%), Positives = 168/288 (58%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++G  + +  + GG+   GG+   L QP E+VI+AGAG+G F++ N  K IK +  +
Sbjct: 1   MLILLGYLVVLGTVFGGYLMTGGSLGALYQPAELVIIAGAGIGSFIVGNNGKAIKGTLKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y D+L LLY LM   ++      E  I++P  S IF S P +L ++
Sbjct: 61  LPLLFRRSKYTKAMYMDLLALLYRLMTKSRQMGMFSLERDIENPRESEIFASYPRILADS 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FI DY+R+II G+  ++EIE LMDEEI+    E   P ++++ +G+SLPA GIV A
Sbjct: 121 VMLDFIVDYLRLIISGHMNTFEIEALMDEEIETHESEAEVPANSLALVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+G+  +    LG  I  ++ GT LGI+L+Y   +PL + ++    +  ++   
Sbjct: 181 VMGVVHALGSADRPAAELGMLIAHAMVGTFLGILLAYGFISPLATVLRQKSAETSKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
           VK  L++ +NG  P +A+E+GRK L  SERPS   + + V    + ++
Sbjct: 241 VKVTLLSNLNGYAPPIAVEFGRKTLYSSERPSFIELEEHVRAVKNPQQ 288


>gi|23499889|ref|NP_699329.1| flagellar motor protein MotA [Brucella suis 1330]
 gi|254702554|ref|ZP_05164382.1| flagellar motor protein MotA [Brucella suis bv. 3 str. 686]
 gi|254706316|ref|ZP_05168144.1| flagellar motor protein MotA [Brucella pinnipedialis M163/99/10]
 gi|254711392|ref|ZP_05173203.1| flagellar motor protein MotA [Brucella pinnipedialis B2/94]
 gi|256014916|ref|YP_003104925.1| flagellar motor protein [Brucella microti CCM 4915]
 gi|256029978|ref|ZP_05443592.1| flagellar motor protein MotA [Brucella pinnipedialis M292/94/1]
 gi|23463464|gb|AAN33334.1| chemotaxis motA protein [Brucella suis 1330]
 gi|255997576|gb|ACU49263.1| flagellar motor protein [Brucella microti CCM 4915]
          Length = 290

 Score =  253 bits (646), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 155/290 (53%), Positives = 208/290 (71%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+GL IT+ C++GGF AMGG+  +LIQP+E +I+ GA LG F +ANP  ++KD+G +
Sbjct: 1   MGIIVGLVITLGCMLGGFIAMGGHVSVLIQPWEFIIILGAALGTFFVANPFSLVKDTGRA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            +E F      Q  Y DVL +LY LM  L+  SRNE E HID+P  S IF + P+VL+  
Sbjct: 61  CMEAFTDAVPKQRDYLDVLGVLYSLMRELRAKSRNEVEVHIDNPKESPIFLAYPSVLKKE 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +LT FICDY R+IIVGN RSYEIE LMDEEI  I  +KLKPY A+  + E+LPA+GIV A
Sbjct: 121 DLTNFICDYCRLIIVGNVRSYEIEALMDEEIRTIARDKLKPYQAMITISEALPALGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKAMG L QSP++LG  IG +L GT  GI  SY +  P+ ++IKSTR K +RLYI+
Sbjct: 181 VLGVIKAMGALDQSPEVLGHLIGAALVGTFAGIFFSYGVIGPIANKIKSTREKNNRLYIV 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK+ L+AYMNG++PQ+A+EYGRK +   ERP+I++V QE +     ++A+
Sbjct: 241 VKQTLLAYMNGSLPQIAVEYGRKTISAYERPTIDVVEQETMASVPTQQAA 290


>gi|115350222|ref|YP_772061.1| flagellar motor protein MotA [Burkholderia ambifaria AMMD]
 gi|171322725|ref|ZP_02911472.1| flagellar motor protein MotA [Burkholderia ambifaria MEX-5]
 gi|115280210|gb|ABI85727.1| flagellar motor component-like protein [Burkholderia ambifaria
           AMMD]
 gi|171091927|gb|EDT37394.1| flagellar motor protein MotA [Burkholderia ambifaria MEX-5]
          Length = 286

 Score =  253 bits (646), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 105/285 (36%), Positives = 171/285 (60%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  +T+L + GG+   GG+   L+QP EI+++ GAG+G F++ N +K IK + + 
Sbjct: 1   MLIIVGTLVTLLSVFGGYALAGGHLGALVQPLEILMITGAGVGAFILGNGMKTIKATLLV 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +D Y +++ LLY+L+   +K      E  IDDP  S IFT  P +L + 
Sbjct: 61  LPTLFKGSKYTKDVYMELMALLYVLLAKARKEGTLTLEADIDDPDKSPIFTQYPKILADR 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  F+ DY+R+++ GN  ++EIE+LMDEEI+    E   P HA+  +G+++PA GIV A
Sbjct: 121 HIVEFLTDYLRLMVGGNMNAFEIESLMDEEIETHHTEGEGPAHALMRVGDAMPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  M +  + P +LG  I  +L GT LGI+LSY L  PL S  +    +  +++  
Sbjct: 181 VMGVVHTMASADKPPAVLGAMIAQALVGTFLGILLSYGLIGPLASLAEQRVAESTKMFQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           +K  ++A +NG  P +A+E+GRKVL  +ERPS   + + V +   
Sbjct: 241 IKVTILASLNGYAPAIAVEFGRKVLFSTERPSFTELEEHVRRVKA 285


>gi|91211114|ref|YP_541100.1| flagellar motor protein MotA [Escherichia coli UTI89]
 gi|117624040|ref|YP_852953.1| flagellar motor protein MotA [Escherichia coli APEC O1]
 gi|215487101|ref|YP_002329532.1| flagellar motor protein MotA [Escherichia coli O127:H6 str.
           E2348/69]
 gi|218558753|ref|YP_002391666.1| flagellar motor protein MotA [Escherichia coli S88]
 gi|218689886|ref|YP_002398098.1| flagellar motor protein MotA [Escherichia coli ED1a]
 gi|227885681|ref|ZP_04003486.1| flagellar motor protein MotA [Escherichia coli 83972]
 gi|237705848|ref|ZP_04536329.1| flagellar motor protein MotA [Escherichia sp. 3_2_53FAA]
 gi|300935868|ref|ZP_07150826.1| flagellar motor protein MotA [Escherichia coli MS 21-1]
 gi|301050753|ref|ZP_07197611.1| flagellar motor protein MotA [Escherichia coli MS 185-1]
 gi|306814280|ref|ZP_07448446.1| flagellar motor protein MotA [Escherichia coli NC101]
 gi|312967093|ref|ZP_07781311.1| chemotaxis protein motA [Escherichia coli 2362-75]
 gi|331647485|ref|ZP_08348577.1| chemotaxis protein MotA [Escherichia coli M605]
 gi|331657938|ref|ZP_08358900.1| chemotaxis protein MotA [Escherichia coli TA206]
 gi|331683397|ref|ZP_08383998.1| chemotaxis protein MotA [Escherichia coli H299]
 gi|91072688|gb|ABE07569.1| chemotaxis MotA protein [Escherichia coli UTI89]
 gi|115513164|gb|ABJ01239.1| flagellar motor protein MotA [Escherichia coli APEC O1]
 gi|215265173|emb|CAS09561.1| proton conductor component MotA of flagella motor [Escherichia coli
           O127:H6 str. E2348/69]
 gi|218365522|emb|CAR03249.1| proton conductor component of flagella motor [Escherichia coli S88]
 gi|218427450|emb|CAR08347.2| proton conductor component of flagella motor [Escherichia coli
           ED1a]
 gi|222033637|emb|CAP76378.1| chemotaxis protein motA [Escherichia coli LF82]
 gi|226900605|gb|EEH86864.1| flagellar motor protein MotA [Escherichia sp. 3_2_53FAA]
 gi|227837254|gb|EEJ47720.1| flagellar motor protein MotA [Escherichia coli 83972]
 gi|281178958|dbj|BAI55288.1| proton conductor component of motor [Escherichia coli SE15]
 gi|294491110|gb|ADE89866.1| chemotaxis protein MotA [Escherichia coli IHE3034]
 gi|300297570|gb|EFJ53955.1| flagellar motor protein MotA [Escherichia coli MS 185-1]
 gi|300458980|gb|EFK22473.1| flagellar motor protein MotA [Escherichia coli MS 21-1]
 gi|305852439|gb|EFM52890.1| flagellar motor protein MotA [Escherichia coli NC101]
 gi|307553907|gb|ADN46682.1| proton conductor component of motor [Escherichia coli ABU 83972]
 gi|307626627|gb|ADN70931.1| flagellar motor protein MotA [Escherichia coli UM146]
 gi|312288557|gb|EFR16459.1| chemotaxis protein motA [Escherichia coli 2362-75]
 gi|312946488|gb|ADR27315.1| flagellar motor protein MotA [Escherichia coli O83:H1 str. NRG
           857C]
 gi|315286596|gb|EFU46029.1| flagellar motor protein MotA [Escherichia coli MS 110-3]
 gi|320194395|gb|EFW69026.1| Flagellar motor rotation protein MotA [Escherichia coli WV_060327]
 gi|323186772|gb|EFZ72092.1| chemotaxis protein motA [Escherichia coli RN587/1]
 gi|323952391|gb|EGB48264.1| chemotaxis protein MotA [Escherichia coli H252]
 gi|323956292|gb|EGB52035.1| chemotaxis protein MotA [Escherichia coli H263]
 gi|324007254|gb|EGB76473.1| flagellar motor protein MotA [Escherichia coli MS 57-2]
 gi|330911700|gb|EGH40210.1| flagellar motor rotation protein MotA [Escherichia coli AA86]
 gi|331043209|gb|EGI15347.1| chemotaxis protein MotA [Escherichia coli M605]
 gi|331056186|gb|EGI28195.1| chemotaxis protein MotA [Escherichia coli TA206]
 gi|331079612|gb|EGI50809.1| chemotaxis protein MotA [Escherichia coli H299]
          Length = 295

 Score =  253 bits (646), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 103/288 (35%), Positives = 168/288 (58%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++G  + +  + GG+   GG+   L QP E+VI+AGAG+G F++ N  K IK +  +
Sbjct: 1   MLILLGYLVVLGTVFGGYLMTGGSLGALYQPAELVIIAGAGIGSFIVGNNGKAIKGTLKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y D+L LLY LM   ++      E  I++P  S IF S P +L ++
Sbjct: 61  LPLLFRRSKYTKAMYMDLLALLYRLMAKSRQMGMFSLERDIENPRESEIFASYPRILADS 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FI DY+R+II G+  ++EIE LMDEEI+    E   P ++++ +G+SLPA GIV A
Sbjct: 121 VMLEFIVDYLRLIISGHMNTFEIEALMDEEIETHESEAEVPANSLALVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+G+  +    LG  I  ++ GT LGI+L+Y   +PL S ++    +  ++   
Sbjct: 181 VMGVVHALGSADRPAAELGALIAHAMVGTFLGILLAYGFISPLASVLRQKSAETSKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
           VK  L++ +NG  P +A+E+GRK L  SERPS   + + V    + ++
Sbjct: 241 VKVTLLSNLNGYAPPIAVEFGRKTLYSSERPSFIELEEHVRAVKNPQQ 288


>gi|332756041|gb|EGJ86394.1| chemotaxis protein motA [Shigella flexneri 4343-70]
 gi|333003362|gb|EGK22908.1| chemotaxis protein motA [Shigella flexneri K-218]
          Length = 295

 Score =  253 bits (645), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 103/288 (35%), Positives = 167/288 (57%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++G  + +  + GG+   GG+   L QP E+VI+AGAG+G F++ N  K IK +  +
Sbjct: 1   MLILLGYLVVLGTVFGGYLMTGGSLGALYQPAELVIIAGAGIGSFIVGNNGKAIKGTLKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y D+L LLY LM   ++      E  I++P  S IF S P +L ++
Sbjct: 61  LPLLFRRSKYTKAMYMDLLALLYRLMAKSRQMGMFSLERDIENPRESEIFASYPRILADS 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FI DY+R+II G+  ++EIE LMDEEI+    E   P ++++ +G+SLPA GIV A
Sbjct: 121 VMLDFIVDYLRLIISGHMNTFEIEALMDEEIETHESEAEVPANSLALVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G + A+G+  +    LG  I  ++ GT LGI+L+Y   +PL S ++    +  ++   
Sbjct: 181 VMGGVHALGSADRPAAELGVLIAHAMVGTFLGILLAYGFISPLASVLRQKSAETSKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
           VK  L++ +NG  P +A+E+GRK L  SERPS   + + V    + ++
Sbjct: 241 VKVTLLSNLNGYAPPIAVEFGRKTLYSSERPSFIELEEHVRAVKNPQQ 288


>gi|218705390|ref|YP_002412909.1| flagellar motor protein MotA [Escherichia coli UMN026]
 gi|293405382|ref|ZP_06649374.1| chemotaxis protein motA [Escherichia coli FVEC1412]
 gi|298381026|ref|ZP_06990625.1| chemotaxis protein MotA [Escherichia coli FVEC1302]
 gi|300899143|ref|ZP_07117424.1| flagellar motor protein MotA [Escherichia coli MS 198-1]
 gi|218432487|emb|CAR13380.1| proton conductor component of flagella motor [Escherichia coli
           UMN026]
 gi|291427590|gb|EFF00617.1| chemotaxis protein motA [Escherichia coli FVEC1412]
 gi|298278468|gb|EFI19982.1| chemotaxis protein MotA [Escherichia coli FVEC1302]
 gi|300357233|gb|EFJ73103.1| flagellar motor protein MotA [Escherichia coli MS 198-1]
          Length = 295

 Score =  253 bits (645), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 103/288 (35%), Positives = 168/288 (58%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++G  + +  + GG+   GG+   L QP E+VI+AGAG+G F++ N  K IK +  +
Sbjct: 1   MLILLGYLVVLGTVFGGYLMTGGSLGALYQPAELVIIAGAGIGSFIVGNNGKAIKGTLKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y D+L LLY LM   ++      E  I++P  S IF S P +L ++
Sbjct: 61  LPLLFRRSKYTKAMYMDLLALLYRLMAKSRQMGMFSLERDIENPRESEIFASYPRILADS 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FI DY+R+II G+  ++EIE LMDEEI+    E   P ++++ +G+SLPA GIV A
Sbjct: 121 VMLDFIVDYLRLIISGHMNTFEIEALMDEEIETHESEAEVPANSLALVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+G+  +    LG  I  ++ GT LGI+L+Y   +PL S ++    +  ++   
Sbjct: 181 VMGVVHALGSADRPAAELGALIAHAMVGTFLGILLAYGFISPLASVLRQKSAETSKMMHC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
           VK  L++ +NG  P +A+E+GRK L  SERPS   + + V    + ++
Sbjct: 241 VKVTLLSNLNGYAPPIAVEFGRKTLYSSERPSFIELEEHVRAVKNPQQ 288


>gi|319409194|emb|CBI82838.1| Chemotaxis protein motA [Bartonella schoenbuchensis R1]
          Length = 291

 Score =  253 bits (645), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 139/290 (47%), Positives = 204/290 (70%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  IIGL +T+ CIIGG+ AMGG+  +L+QP+E VI+ G+ +G F+++NP  VIKD+  +
Sbjct: 1   MGVIIGLVLTLGCIIGGYVAMGGHLDVLVQPWEFVIILGSAIGIFIVSNPFSVIKDAMKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            LE        Q  +   L LLY+LM  ++  SR+E E H+D+P  S +F   P VL+++
Sbjct: 61  TLEATTDAVPKQKDFLATLGLLYVLMREMRSKSRSEMEGHVDNPRESALFQQYPLVLKDS 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            LT+FICDY R+II+GNAR +EIE LMDEEI  I+ +  K  HA+ +M ++LPA+GIV A
Sbjct: 121 SLTSFICDYCRLIIMGNARPFEIEALMDEEIHTIVKDSEKSSHALQNMADALPALGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKAMG +S+ P++LG  IG +L GT  GI  SYS+ +P+ ++IK+ R K+ R+YI+
Sbjct: 181 VLGVIKAMGAISEPPEVLGRLIGAALVGTFAGIFFSYSVFSPIATKIKTVRHKKTRIYIV 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK+ L+AYMNGAIPQ+A+EYGRK +   +RP+I++V Q  +     +K +
Sbjct: 241 VKQTLLAYMNGAIPQIALEYGRKTISAKDRPTIDVVEQHTIVGPGAEKEA 290


>gi|242238951|ref|YP_002987132.1| flagellar motor protein MotA [Dickeya dadantii Ech703]
 gi|242131008|gb|ACS85310.1| flagellar motor protein MotA [Dickeya dadantii Ech703]
          Length = 295

 Score =  253 bits (645), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 94/290 (32%), Positives = 167/290 (57%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  +TI  I+GG+  +GG    L QP E++I+ G+ +G F++ N  K IK +  +
Sbjct: 1   MLVILGYLVTIGSILGGYLIVGGELGALYQPSELLIIGGSAIGAFIVGNTGKGIKGTLRA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y D++ +L+ LM   ++      E  ID+P  S IF++ P +L +N
Sbjct: 61  LPTLFKGSKYTKAVYMDLMAVLFRLMAKSRQQGMLSLEFDIDNPKESEIFSTYPRILSDN 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  F+ DY+R+++ GN  ++EIE LMDEEI+ + +E   P  +++ MG+ LPA GIV A
Sbjct: 121 YVIEFVTDYLRLMVSGNMNAFEIETLMDEEIETVEHEIEVPATSLNLMGDGLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ ++  + +    LG  I  ++ GT LGI+L+Y   +PL S ++    ++ ++   
Sbjct: 181 VMGVVHSLAFVDRPAAELGMMIAHAMVGTFLGILLAYGFVSPLASLLRQKNSEKIKVLQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           +K  L++ +NG  PQ+A+E+GRK L  + RPS   +   +       + +
Sbjct: 241 IKVTLLSSLNGYAPQIAVEFGRKTLYSTVRPSFTEMEDHIRSVKAPPQQA 290


>gi|24113275|ref|NP_707785.1| flagellar motor protein MotA [Shigella flexneri 2a str. 301]
 gi|30063342|ref|NP_837513.1| flagellar motor protein MotA [Shigella flexneri 2a str. 2457T]
 gi|74311760|ref|YP_310179.1| flagellar motor protein MotA [Shigella sonnei Ss046]
 gi|110805870|ref|YP_689390.1| flagellar motor protein MotA [Shigella flexneri 5 str. 8401]
 gi|24052279|gb|AAN43492.1| proton conductor component of motor [Shigella flexneri 2a str. 301]
 gi|30041594|gb|AAP17322.1| proton conductor component of motor [Shigella flexneri 2a str.
           2457T]
 gi|73855237|gb|AAZ87944.1| proton conductor component of motor [Shigella sonnei Ss046]
 gi|110615418|gb|ABF04085.1| flagellar motor protein [Shigella flexneri 5 str. 8401]
 gi|281601337|gb|ADA74321.1| Proton conductor component of motor [Shigella flexneri 2002017]
 gi|313650106|gb|EFS14519.1| chemotaxis protein motA [Shigella flexneri 2a str. 2457T]
 gi|323165314|gb|EFZ51102.1| chemotaxis protein motA [Shigella sonnei 53G]
 gi|332757195|gb|EGJ87532.1| chemotaxis protein motA [Shigella flexneri 2747-71]
 gi|332757450|gb|EGJ87785.1| chemotaxis protein motA [Shigella flexneri K-671]
 gi|332766621|gb|EGJ96825.1| motA protein, proton conductor component of motor no effect on
           switching [Shigella flexneri 2930-71]
 gi|333004151|gb|EGK23683.1| chemotaxis protein motA [Shigella flexneri K-272]
 gi|333017628|gb|EGK36940.1| chemotaxis protein motA [Shigella flexneri K-304]
 gi|333017761|gb|EGK37068.1| chemotaxis protein motA [Shigella flexneri K-227]
          Length = 295

 Score =  253 bits (645), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 103/288 (35%), Positives = 167/288 (57%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++G  + +  + GG+   GG+   L QP E+VI+AGAG+G F++ N  K IK +  +
Sbjct: 1   MLILLGYLVVLGTVFGGYLMTGGSLGALYQPAELVIIAGAGIGSFIVGNNGKAIKGTLKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y D+L LLY LM   ++      E  I++P  S IF S P +L ++
Sbjct: 61  LPLLFRRSKYTKAMYMDLLALLYRLMAKSRQMGMFSLERDIENPRESEIFASYPRILADS 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FI DY+R+II G+  ++EIE LMDEEI+    E   P ++++ +G+SLPA GIV A
Sbjct: 121 VMLDFIVDYLRLIISGHMNTFEIEALMDEEIETHESEAEVPANSLALVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G + A+G+  +    LG  I  ++ GT LGI+L+Y   +PL S ++    +  ++   
Sbjct: 181 VMGGVHALGSADRPAAELGALIAHAMVGTFLGILLAYGFISPLASVLRQKSAETSKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
           VK  L++ +NG  P +A+E+GRK L  SERPS   + + V    + ++
Sbjct: 241 VKVTLLSNLNGYAPPIAVEFGRKTLYSSERPSFIELEEHVRAVKNPQQ 288


>gi|110642006|ref|YP_669736.1| flagellar motor protein MotA [Escherichia coli 536]
 gi|191173025|ref|ZP_03034559.1| chemotaxis protein MotA [Escherichia coli F11]
 gi|300982220|ref|ZP_07175932.1| flagellar motor protein MotA [Escherichia coli MS 200-1]
 gi|110343598|gb|ABG69835.1| chemotaxis MotA protein [Escherichia coli 536]
 gi|190906736|gb|EDV66341.1| chemotaxis protein MotA [Escherichia coli F11]
 gi|300307290|gb|EFJ61810.1| flagellar motor protein MotA [Escherichia coli MS 200-1]
          Length = 295

 Score =  253 bits (645), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 103/288 (35%), Positives = 168/288 (58%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++G  + +  + GG+   GG+   L QP E+VI+AGAG+G F++ N  K IK +  +
Sbjct: 1   MLILLGYLVVLGTVFGGYLMTGGSLGALYQPAELVIIAGAGIGSFIVGNNGKAIKGTLKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y D+L LLY LM   ++      E  I++P  S IF S P +L ++
Sbjct: 61  LPLLFRRTKYTKAMYMDLLALLYRLMAKSRQMGMFSLERDIENPRESEIFASYPRILADS 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FI DY+R+II G+  ++EIE LMDEEI+    E   P ++++ +G+SLPA GIV A
Sbjct: 121 VMLEFIVDYLRLIISGHMNTFEIEALMDEEIETHESEAEVPANSLALVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+G+  +    LG  I  ++ GT LGI+L+Y   +PL S ++    +  ++   
Sbjct: 181 VMGVVHALGSADRPAAELGALIAHAMVGTFLGILLAYGFISPLASVLRQKSAETSKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
           VK  L++ +NG  P +A+E+GRK L  SERPS   + + V    + ++
Sbjct: 241 VKVTLLSNLNGYAPPIAVEFGRKTLYSSERPSFIELEEHVRAVKNPQQ 288


>gi|260466627|ref|ZP_05812815.1| flagellar motor protein MotA [Mesorhizobium opportunistum WSM2075]
 gi|259029633|gb|EEW30921.1| flagellar motor protein MotA [Mesorhizobium opportunistum WSM2075]
          Length = 291

 Score =  253 bits (645), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 151/290 (52%), Positives = 212/290 (73%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  +IGL +T+ C++GGF AMGG+ ++L+QP+E V++ GA LG F++ANP+K +KD+G  
Sbjct: 1   MGILIGLVVTLGCVLGGFMAMGGHLHVLVQPWEAVVICGAALGTFLVANPMKTVKDTGKG 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +LE F      +  Y + L +L+ LM  L+  SR+E E HID+P  S IF + PTVL+N+
Sbjct: 61  ILEAFKQAVPKEQDYLETLGVLHSLMRELRSKSRSEVEAHIDNPEESAIFQAFPTVLKNH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +L  FICDY R+II+GNARS+EIE LMDEEI  I  +K+K YHA+  +G+ LPA+GIV A
Sbjct: 121 DLMAFICDYCRIIIIGNARSHEIEALMDEEIQTIKSDKMKAYHALVAVGDGLPALGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG++KAMG L QSP+ILG  IG +L GT LGI LSY++  P+ ++IK+ R K++RLYII
Sbjct: 181 VLGVVKAMGALDQSPEILGGLIGAALVGTFLGIFLSYAVVGPVATKIKTVREKKNRLYII 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK+ L+AYMNGA+PQVAIE+GRK +   ERP+I+ V Q  +     +K +
Sbjct: 241 VKQTLLAYMNGALPQVAIEFGRKTISSYERPTIDAVEQSTMNTGAAEKKA 290


>gi|254699437|ref|ZP_05161265.1| flagellar motor protein MotA [Brucella suis bv. 5 str. 513]
          Length = 290

 Score =  253 bits (645), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 154/290 (53%), Positives = 207/290 (71%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+GL IT+ C++GGF AMGG+  +LIQP+E +I+ GA LG F +ANP  ++KD+G +
Sbjct: 1   MGIIVGLVITLGCMLGGFIAMGGHVSVLIQPWEFIIILGAALGTFFVANPFSLVKDTGRA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            +E F      Q  Y DVL +LY LM  L+  SRNE E HID+P  S IF + P+VL+  
Sbjct: 61  CMEAFTDAVPKQRDYLDVLGVLYSLMRELRAKSRNEVEVHIDNPKESPIFLAYPSVLKKE 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +LT FICDY R+IIVGN RSYEIE LMDEEI  I  +KLKPY A+  + E+LPA+GIV A
Sbjct: 121 DLTNFICDYCRLIIVGNVRSYEIEALMDEEIRTIARDKLKPYQAMITISEALPALGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKAMG L QSP++LG  IG +L GT  GI  SY +  P+ ++IKSTR K +RLYI+
Sbjct: 181 VLGVIKAMGALDQSPEVLGHLIGAALVGTFAGIFFSYGVIGPIANKIKSTREKNNRLYIV 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK+ L+AYMNG++PQ+A+EYGRK +   ERP+I++  QE +     ++A+
Sbjct: 241 VKQTLLAYMNGSLPQIAVEYGRKTISAYERPTIDVAEQETMASVPTQQAA 290


>gi|315296508|gb|EFU55805.1| flagellar motor protein MotA [Escherichia coli MS 16-3]
          Length = 295

 Score =  252 bits (644), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 103/288 (35%), Positives = 167/288 (57%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  + G  + +  + GG+   GG+   L QP E+VI+AGAG+G F++ N  K IK +  +
Sbjct: 1   MLILFGYLVVLGTVFGGYLMTGGSLGALYQPAELVIIAGAGIGSFIVGNNGKAIKGTLKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y D+L LLY LM   ++      E  I++P  S IF S P +L ++
Sbjct: 61  LPLLFRRSKYTKAMYMDLLALLYRLMAKSRQMGMFSLERDIENPRESEIFASYPRILADS 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FI DY+R+II G+  ++EIE LMDEEI+    E   P ++++ +G+SLPA GIV A
Sbjct: 121 VMLEFIVDYLRLIISGHMNTFEIEALMDEEIETHESEAEVPANSLALVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+G+  +    LG  I  ++ GT LGI+L+Y   +PL S ++    +  ++   
Sbjct: 181 VMGVVHALGSADRPAAELGALIAHAMVGTFLGILLAYGFISPLASVLRQKSAETSKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
           VK  L++ +NG  P +A+E+GRK L  SERPS   + + V    + ++
Sbjct: 241 VKVTLLSNLNGYAPPIAVEFGRKTLYSSERPSFIELEEHVRAVKNPQQ 288


>gi|193065493|ref|ZP_03046562.1| chemotaxis protein MotA [Escherichia coli E22]
 gi|192926898|gb|EDV81523.1| chemotaxis protein MotA [Escherichia coli E22]
          Length = 295

 Score =  252 bits (644), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 103/288 (35%), Positives = 169/288 (58%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++G  + +  + GG+   GG+   L QP E+VI+AGAG+G F++ N  K IK +  +
Sbjct: 1   MLILLGYLVVLGTVFGGYLMTGGSLGALYQPAELVIIAGAGIGSFIVGNNGKAIKGTLKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y D+L LLY LM   ++      E  I++P  S IF S P +L ++
Sbjct: 61  LPLLFRRSKYTKAMYMDLLALLYRLMAKSRQMGMFSLERDIENPRESEIFASYPRILADS 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FI DY+R+II G+  ++EIE LMDEEI+    E   P ++++ +G+SLPA GIV A
Sbjct: 121 VMLDFIVDYLRLIISGHMNTFEIEALMDEEIETHESEAEVPANSLALVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+G+  +    LG  I  ++ GT LGI+L+Y   +PL S ++   ++  ++   
Sbjct: 181 VMGVVHALGSADRPAAELGALIAHAMVGTFLGILLAYGFISPLASVLRQKSVETSKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
           VK  L++ +NG  P +A+E+GRK L  SERPS   + + V    + ++
Sbjct: 241 VKVTLLSNLNGYAPPIAVEFGRKTLYSSERPSFIELEEHVRAVKNPQQ 288


>gi|254711991|ref|ZP_05173802.1| flagellar motor protein MotA [Brucella ceti M644/93/1]
 gi|254715061|ref|ZP_05176872.1| flagellar motor protein MotA [Brucella ceti M13/05/1]
          Length = 290

 Score =  252 bits (644), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 154/290 (53%), Positives = 207/290 (71%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+GL IT+ C++GGF AMGG+  +LIQP+E +I+ GA LG F +ANP  ++KD+G +
Sbjct: 1   MGIIVGLVITLGCMLGGFIAMGGHVSVLIQPWEFIIILGAALGTFFVANPFSLVKDTGRA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            +E F      Q  Y DVL +LY LM  L+  SRNE E HID+P  S IF + P+VL+  
Sbjct: 61  CMEAFTDAVPKQRDYLDVLGVLYSLMRELRAKSRNEVEVHIDNPKESPIFLAYPSVLKKE 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +LT FICDY R+IIVGN RSYEIE LMDEEI  I  +KLKPY A+  + E+LPA+GIV A
Sbjct: 121 DLTNFICDYCRLIIVGNVRSYEIEALMDEEIRTIARDKLKPYQAMITISEALPALGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKAMG L QSP++LG  IG +L GT  GI  SY +  P+ ++IKSTR K + LYI+
Sbjct: 181 VLGVIKAMGALDQSPEVLGHLIGAALVGTFAGIFFSYGVIGPIANKIKSTREKNNCLYIV 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK+ L+AYMNG++PQ+A+EYGRK +   ERP+I++V QE +     ++A+
Sbjct: 241 VKQTLLAYMNGSLPQIAVEYGRKTISAYERPTIDVVEQETMASVPTQQAA 290


>gi|221202106|ref|ZP_03575141.1| chemotaxis protein MotA [Burkholderia multivorans CGD2M]
 gi|221209086|ref|ZP_03582081.1| chemotaxis protein MotA [Burkholderia multivorans CGD2]
 gi|221171081|gb|EEE03533.1| chemotaxis protein MotA [Burkholderia multivorans CGD2]
 gi|221177900|gb|EEE10312.1| chemotaxis protein MotA [Burkholderia multivorans CGD2M]
          Length = 286

 Score =  252 bits (644), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 107/285 (37%), Positives = 169/285 (59%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  +T+L + GG+   GG+   L+QP EI+++AGAGLG F++ N  K IK +   
Sbjct: 1   MLIIVGTLVTLLSVFGGYALAGGHLGALVQPLEILMIAGAGLGAFILGNGTKTIKATVRV 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +D Y +++ LLY+L+   +K      E  IDDP  S IFT  P +L + 
Sbjct: 61  LPTLFKGSKYTKDVYMELMALLYVLLAKARKEGTLTLEADIDDPEKSPIFTQYPKILADR 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  F+ DY+R+++ GN  ++EIE+LMDEEI+    E   P HA+  +G+++PA GIV A
Sbjct: 121 HIVEFLTDYLRLMVGGNMNAFEIESLMDEEIETHHAEGEGPAHALMRVGDAMPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  M +  + P +LG  I  +L GT LGI+LSY L  PL S  +    +  +++  
Sbjct: 181 VMGVVHTMASADKPPAVLGAMIAQALVGTFLGILLSYGLIGPLASLAEQRVAESTKMFQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           +K  ++A +NG  P +A+E+GRKVL   ERPS   + + V +   
Sbjct: 241 IKVTILASLNGYAPAIAVEFGRKVLFSPERPSFAELEEHVRRVKA 285


>gi|221214226|ref|ZP_03587198.1| chemotaxis protein MotA [Burkholderia multivorans CGD1]
 gi|221165881|gb|EED98355.1| chemotaxis protein MotA [Burkholderia multivorans CGD1]
          Length = 286

 Score =  252 bits (644), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 107/285 (37%), Positives = 169/285 (59%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  +T+L + GG+   GG+   L+QP EI+++AGAGLG F++ N  K IK +   
Sbjct: 1   MLIIVGTLVTLLSVFGGYALAGGHLGALVQPLEILMIAGAGLGAFILGNGSKTIKATVRV 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +D Y +++ LLY+L+   +K      E  IDDP  S IFT  P +L + 
Sbjct: 61  LPTLFKGSKYTKDVYMELMALLYVLLAKARKEGTLTLEADIDDPEKSPIFTQYPKILADR 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  F+ DY+R+++ GN  ++EIE+LMDEEI+    E   P HA+  +G+++PA GIV A
Sbjct: 121 HIVEFLTDYLRLMVGGNMNAFEIESLMDEEIETHHAEGEGPAHALMRVGDAMPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  M +  + P +LG  I  +L GT LGI+LSY L  PL S  +    +  +++  
Sbjct: 181 VMGVVHTMASADKPPAVLGAMIAQALVGTFLGILLSYGLIGPLASLAEQRVAESTKMFQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           +K  ++A +NG  P +A+E+GRKVL   ERPS   + + V +   
Sbjct: 241 IKVTILASLNGYAPAIAVEFGRKVLFSPERPSFAELEEHVRRVKA 285


>gi|15802302|ref|NP_288327.1| flagellar motor protein MotA [Escherichia coli O157:H7 EDL933]
 gi|15831854|ref|NP_310627.1| flagellar motor protein MotA [Escherichia coli O157:H7 str. Sakai]
 gi|168757930|ref|ZP_02782937.1| chemotaxis protein MotA [Escherichia coli O157:H7 str. EC4401]
 gi|168762312|ref|ZP_02787319.1| chemotaxis protein MotA [Escherichia coli O157:H7 str. EC4501]
 gi|168770877|ref|ZP_02795884.1| chemotaxis protein MotA [Escherichia coli O157:H7 str. EC4486]
 gi|168776559|ref|ZP_02801566.1| chemotaxis protein MotA [Escherichia coli O157:H7 str. EC4196]
 gi|168783194|ref|ZP_02808201.1| chemotaxis protein MotA [Escherichia coli O157:H7 str. EC4076]
 gi|168789759|ref|ZP_02814766.1| chemotaxis protein MotA [Escherichia coli O157:H7 str. EC869]
 gi|168801870|ref|ZP_02826877.1| chemotaxis protein MotA [Escherichia coli O157:H7 str. EC508]
 gi|195939594|ref|ZP_03084976.1| flagellar motor protein MotA [Escherichia coli O157:H7 str. EC4024]
 gi|208810209|ref|ZP_03252085.1| chemotaxis protein MotA [Escherichia coli O157:H7 str. EC4206]
 gi|208816669|ref|ZP_03257789.1| chemotaxis protein MotA [Escherichia coli O157:H7 str. EC4045]
 gi|208819593|ref|ZP_03259913.1| chemotaxis protein MotA [Escherichia coli O157:H7 str. EC4042]
 gi|209396503|ref|YP_002270974.1| chemotaxis protein MotA [Escherichia coli O157:H7 str. EC4115]
 gi|217328719|ref|ZP_03444800.1| chemotaxis protein MotA [Escherichia coli O157:H7 str. TW14588]
 gi|254793514|ref|YP_003078351.1| flagellar motor protein MotA [Escherichia coli O157:H7 str.
           TW14359]
 gi|261227609|ref|ZP_05941890.1| proton conductor component of flagella motor [Escherichia coli
           O157:H7 str. FRIK2000]
 gi|261258225|ref|ZP_05950758.1| proton conductor component of flagella motor [Escherichia coli
           O157:H7 str. FRIK966]
 gi|291283072|ref|YP_003499890.1| Chemotaxis protein MotA [Escherichia coli O55:H7 str. CB9615]
 gi|12515954|gb|AAG56880.1|AE005411_4 proton conductor component of motor; no effect on switching
           [Escherichia coli O157:H7 str. EDL933]
 gi|13362068|dbj|BAB36023.1| proton conductor component of motor [Escherichia coli O157:H7 str.
           Sakai]
 gi|187768064|gb|EDU31908.1| chemotaxis protein MotA [Escherichia coli O157:H7 str. EC4196]
 gi|188999438|gb|EDU68424.1| chemotaxis protein MotA [Escherichia coli O157:H7 str. EC4076]
 gi|189355203|gb|EDU73622.1| chemotaxis protein MotA [Escherichia coli O157:H7 str. EC4401]
 gi|189360283|gb|EDU78702.1| chemotaxis protein MotA [Escherichia coli O157:H7 str. EC4486]
 gi|189367341|gb|EDU85757.1| chemotaxis protein MotA [Escherichia coli O157:H7 str. EC4501]
 gi|189370701|gb|EDU89117.1| chemotaxis protein MotA [Escherichia coli O157:H7 str. EC869]
 gi|189376043|gb|EDU94459.1| chemotaxis protein MotA [Escherichia coli O157:H7 str. EC508]
 gi|208724725|gb|EDZ74432.1| chemotaxis protein MotA [Escherichia coli O157:H7 str. EC4206]
 gi|208731012|gb|EDZ79701.1| chemotaxis protein MotA [Escherichia coli O157:H7 str. EC4045]
 gi|208739716|gb|EDZ87398.1| chemotaxis protein MotA [Escherichia coli O157:H7 str. EC4042]
 gi|209157903|gb|ACI35336.1| chemotaxis protein MotA [Escherichia coli O157:H7 str. EC4115]
 gi|209767208|gb|ACI81916.1| proton conductor component of motor [Escherichia coli]
 gi|209767210|gb|ACI81917.1| proton conductor component of motor [Escherichia coli]
 gi|209767212|gb|ACI81918.1| proton conductor component of motor [Escherichia coli]
 gi|209767214|gb|ACI81919.1| proton conductor component of motor [Escherichia coli]
 gi|209767216|gb|ACI81920.1| proton conductor component of motor [Escherichia coli]
 gi|217318066|gb|EEC26493.1| chemotaxis protein MotA [Escherichia coli O157:H7 str. TW14588]
 gi|254592914|gb|ACT72275.1| proton conductor component of flagella motor [Escherichia coli
           O157:H7 str. TW14359]
 gi|290762945|gb|ADD56906.1| Chemotaxis protein MotA [Escherichia coli O55:H7 str. CB9615]
 gi|320188590|gb|EFW63252.1| Flagellar motor rotation protein MotA [Escherichia coli O157:H7
           str. EC1212]
 gi|320641744|gb|EFX11132.1| flagellar motor protein MotA [Escherichia coli O157:H7 str. G5101]
 gi|320647104|gb|EFX15937.1| flagellar motor protein MotA [Escherichia coli O157:H- str. 493-89]
 gi|320652387|gb|EFX20685.1| flagellar motor protein MotA [Escherichia coli O157:H- str. H 2687]
 gi|320657988|gb|EFX25750.1| flagellar motor protein MotA [Escherichia coli O55:H7 str. 3256-97
           TW 07815]
 gi|320658561|gb|EFX26255.1| flagellar motor protein MotA [Escherichia coli O55:H7 str. USDA
           5905]
 gi|320668459|gb|EFX35286.1| flagellar motor protein MotA [Escherichia coli O157:H7 str. LSU-61]
 gi|326342268|gb|EGD66049.1| Flagellar motor rotation protein MotA [Escherichia coli O157:H7
           str. 1044]
 gi|326343819|gb|EGD67581.1| Flagellar motor rotation protein MotA [Escherichia coli O157:H7
           str. 1125]
          Length = 295

 Score =  252 bits (644), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 102/288 (35%), Positives = 168/288 (58%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++G  + +  + GG+   GG+   L QP E+VI+AGAG+G F++ N  K IK +  +
Sbjct: 1   MLILLGYLVVLGTVFGGYLMTGGSLGALYQPAELVIIAGAGIGSFIVGNNGKAIKGTLKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y D+L LLY LM   ++      E  I++P  S IF S P ++ ++
Sbjct: 61  LPLLFRRSKYTKAMYMDLLALLYRLMAKSRQMGMFSLERDIENPRESEIFASYPRIIADS 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FI DY+R+II G+  ++EIE LMDEEI+    E   P ++++ +G+SLPA GIV A
Sbjct: 121 VMLDFIVDYLRLIISGHMNTFEIEALMDEEIETHESEAEVPANSLALVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+G+  +    LG  I  ++ GT LGI+L+Y   +PL S ++    +  ++   
Sbjct: 181 VMGVVHALGSADRPAAELGALIAHAMVGTFLGILLAYGFISPLASVLRQKSAETSKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
           VK  L++ +NG  P +A+E+GRK L  SERPS   + + V    + ++
Sbjct: 241 VKVTLLSNLNGYAPPIAVEFGRKTLYSSERPSFIELEEHVRAVKNPQQ 288


>gi|254720631|ref|ZP_05182442.1| flagellar motor protein MotA [Brucella sp. 83/13]
          Length = 290

 Score =  252 bits (644), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 154/290 (53%), Positives = 208/290 (71%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+GL IT+ C++GGF AMGG+  +LIQP+E +I+ GA LG F +ANP  ++KD+G +
Sbjct: 1   MGIIVGLVITLGCMLGGFIAMGGHVSVLIQPWEFIIILGAALGTFFVANPFSLVKDTGRA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            +E F      Q  Y DVL +LY LM  L+  SRNE E HID+P  S IF + P+VL+  
Sbjct: 61  CMEAFTDAVPKQRDYLDVLGVLYSLMRELRAKSRNEVEVHIDNPKESPIFLAYPSVLKKE 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +LT FICDY R+IIVGN RSYEIE LMDEEI  I  +KLKP+ A+  + E+LPA+GIV A
Sbjct: 121 DLTNFICDYCRLIIVGNVRSYEIEALMDEEIRTIARDKLKPHQAMITISEALPALGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKAMG L QSP++LG  IG +L GT  GI  SY +  P+ ++IKSTR K +RLYI+
Sbjct: 181 VLGVIKAMGALDQSPEVLGHLIGAALVGTFAGIFFSYGVIGPIANKIKSTREKNNRLYIV 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK+ L+AYMNG++PQ+A+EYGRK +   ERP+I++V QE +     ++A+
Sbjct: 241 VKQTLLAYMNGSLPQIAVEYGRKTISAYERPTIDVVEQETMASVPTQQAA 290


>gi|16760872|ref|NP_456489.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|29141436|ref|NP_804778.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|213163276|ref|ZP_03348986.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
 gi|213622330|ref|ZP_03375113.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-2068]
 gi|213647164|ref|ZP_03377217.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|213855851|ref|ZP_03384091.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Typhi str. M223]
 gi|25298881|pir||AG0746 motility protein A [imported] - Salmonella enterica subsp. enterica
           serovar Typhi (strain CT18)
 gi|16503169|emb|CAD05674.1| motility protein A [Salmonella enterica subsp. enterica serovar
           Typhi]
 gi|29137063|gb|AAO68627.1| motility protein A [Salmonella enterica subsp. enterica serovar
           Typhi str. Ty2]
          Length = 295

 Score =  252 bits (643), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 101/288 (35%), Positives = 164/288 (56%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++G  + I  + GG+   GG+   L QP E+VI+ GAG+G F++ N  K IK +  +
Sbjct: 1   MLILLGYLVVIGTVFGGYVMTGGHLGALYQPAELVIIGGAGMGAFIVGNNGKAIKGTMKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  +F      +  Y D+L LLY LM   ++      E  I++P  S IF S P +L + 
Sbjct: 61  IPLLFRRSKYTKSMYMDLLALLYRLMAKSRQQGMFSLERDIENPKESEIFASYPRILADA 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FI DY+R+II GN  ++EIE LMDEEI+    E   P ++++ +G+SLPA GIV A
Sbjct: 121 VMLDFIVDYLRLIISGNMNTFEIEALMDEEIETHESEAEVPANSLAMVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+ +  +    LG  I  ++ GT LGI+L+Y   +PL + ++    +  ++   
Sbjct: 181 VMGVVHALASADRPAAELGALIAHAMVGTFLGILLAYGFISPLATVLRQKSAETTKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
           VK  L++ +NG  P +A+E+GRK L  SERPS   + + V    +  +
Sbjct: 241 VKITLLSNLNGYAPPIAVEFGRKTLYSSERPSFIELEEHVRAVRNPNQ 288


>gi|161523342|ref|YP_001578354.1| flagellar motor protein MotA [Burkholderia multivorans ATCC 17616]
 gi|189351885|ref|YP_001947513.1| flagellar motor protein MotA [Burkholderia multivorans ATCC 17616]
 gi|160340771|gb|ABX13857.1| flagellar motor component-like protein [Burkholderia multivorans
           ATCC 17616]
 gi|189335907|dbj|BAG44977.1| chemotaxis MotA protein [Burkholderia multivorans ATCC 17616]
          Length = 286

 Score =  252 bits (643), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 106/285 (37%), Positives = 169/285 (59%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  +T+L + GG+   GG+   L+QP EI+++AGAG+G F++ N  K IK +   
Sbjct: 1   MLIIVGTLVTLLSVFGGYALAGGHLGALVQPLEILMIAGAGIGAFILGNGSKTIKATVRV 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +D Y +++ LLY+L+   +K      E  IDDP  S IFT  P +L + 
Sbjct: 61  LPTLFKGSKYTKDVYMELMALLYVLLAKARKEGTLTLEADIDDPEKSPIFTQYPKILADR 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  F+ DY+R+++ GN  ++EIE+LMDEEI+    E   P HA+  +G+++PA GIV A
Sbjct: 121 HIVEFLTDYLRLMVGGNMNAFEIESLMDEEIETHHAEGEGPAHALMRVGDAMPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  M +  + P +LG  I  +L GT LGI+LSY L  PL S  +    +  +++  
Sbjct: 181 VMGVVHTMASADKPPAVLGAMIAQALVGTFLGILLSYGLIGPLASLAEQRVAESTKMFQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           +K  ++A +NG  P +A+E+GRKVL   ERPS   + + V +   
Sbjct: 241 IKVTILASLNGYAPAIAVEFGRKVLFSPERPSFAELEEHVRRVKA 285


>gi|33592171|ref|NP_879815.1| flagellar motor protein MotA [Bordetella pertussis Tohama I]
 gi|33596123|ref|NP_883766.1| flagellar motor protein MotA [Bordetella parapertussis 12822]
 gi|33601522|ref|NP_889082.1| flagellar motor protein MotA [Bordetella bronchiseptica RB50]
 gi|33571816|emb|CAE41325.1| chemotaxis protein MotA [Bordetella pertussis Tohama I]
 gi|33573126|emb|CAE36771.1| chemotaxis protein MotA [Bordetella parapertussis]
 gi|33575958|emb|CAE33037.1| chemotaxis protein MotA [Bordetella bronchiseptica RB50]
 gi|332381587|gb|AEE66434.1| flagellar motor protein MotA [Bordetella pertussis CS]
          Length = 291

 Score =  252 bits (643), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 107/287 (37%), Positives = 172/287 (59%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  +IG  + IL ++G F  +GG+   L QPFE+ ++AGA +G F+  N  K +     +
Sbjct: 1   MLIVIGYAVVILAVVGSFIGLGGHLGALYQPFELTLIAGAAVGAFMAGNSRKSLGLVAKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           + E F      +D Y +++ LLY+L+   ++      E+HI+DP +S IF   P ++++ 
Sbjct: 61  IPEAFRSSPYSKDVYMELMALLYVLLNKARREGLMAIESHIEDPLSSPIFNEYPRIMKDA 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +L  FI DY+R++I GN  S+EIE LMDEEI+   +E+  P HA+  + ++LPA GIV A
Sbjct: 121 KLMEFITDYLRIMISGNMSSFEIETLMDEEIETYRHEREVPTHALQQVADALPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKA+  + Q P ILG  I  ++ GT LG++L+Y    P+ ++I+    +  ++   
Sbjct: 181 VLGVIKALAAVDQPPAILGDLISKAMVGTFLGVLLAYGFVAPMAARIERRTSESVKVLEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
           +K  L+A MNG  PQ+A+E+GRKVL  + RPS   + + V Q     
Sbjct: 241 IKVTLLASMNGYPPQLAVEFGRKVLFSAVRPSFGELEEHVRQAKSAA 287


>gi|256059631|ref|ZP_05449828.1| flagellar motor protein MotA [Brucella neotomae 5K33]
          Length = 290

 Score =  252 bits (643), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 155/289 (53%), Positives = 207/289 (71%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+GL IT+ C++GGF AMGG+  +LIQP+E +I+ GA LG F +ANP  ++KD+G +
Sbjct: 1   MGIIVGLVITLGCMLGGFIAMGGHVSVLIQPWEFIIILGAALGTFFVANPFSLVKDTGRA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            +E F      Q  Y DVL +LY LM  L+  SRNE E HID+P  S IF + P+VL+  
Sbjct: 61  CMEAFTDAVPKQRDYLDVLGVLYSLMRELRAKSRNEVEVHIDNPKESPIFLAYPSVLKKE 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +LT FICDY R+IIVGN RSYEIE LMDEEI  I  +KLKPY A+  + E+LPA+GIV A
Sbjct: 121 DLTNFICDYCRLIIVGNVRSYEIEALMDEEIRTIARDKLKPYQAMITISEALPALGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKAMG L QSP++LG  IG +L GT  GI  SY +  P+ ++IKSTR K +RLYI+
Sbjct: 181 VLGVIKAMGALDQSPEVLGHLIGAALVGTFAGIFFSYGVIGPIANKIKSTREKNNRLYIV 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKA 289
           VK+ L+AYMNG++PQ+A+EYGRK +   ERP+I++V QE +     ++A
Sbjct: 241 VKQTLLAYMNGSLPQIAVEYGRKTISAYERPTIDVVEQETMASVPTQQA 289


>gi|325525469|gb|EGD03282.1| flagellar motor protein MotA [Burkholderia sp. TJI49]
          Length = 286

 Score =  252 bits (643), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 106/285 (37%), Positives = 171/285 (60%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  +T+L + GG+   GG+   L+QP EI+++AGAG+G F++ N +K IK +   
Sbjct: 1   MLIIVGTLVTLLSVFGGYALAGGHLGALVQPLEILMIAGAGVGAFILGNGIKTIKATLRV 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +D Y +++ LLY+L+   +K      E  IDDP  S IFT  P +L + 
Sbjct: 61  LPTLFKGSKYTKDVYMELMALLYVLLAKARKEGTLTLEADIDDPDKSPIFTQYPKILADR 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  F+ DY+R+++ GN  ++EIE+LMDEEI+    E   P HA+  +G+++PA GIV A
Sbjct: 121 HIVEFLTDYLRLMVGGNMNAFEIESLMDEEIETHHVEGEGPAHALMRVGDAMPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  M +  + P +LG  I  +L GT LGI+LSY L  PL S  +    +  +++  
Sbjct: 181 VMGVVHTMASADKPPAVLGAMIAQALVGTFLGILLSYGLIGPLASLAEQRVAESTKMFQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           +K  ++A +NG  P +A+E+GRKVL  +ERPS   + + V +   
Sbjct: 241 IKVTILASLNGYAPAIAVEFGRKVLFSTERPSFAELEEHVRRVKA 285


>gi|260855830|ref|YP_003229721.1| proton conductor component MotA [Escherichia coli O26:H11 str.
           11368]
 gi|257754479|dbj|BAI25981.1| proton conductor component MotA [Escherichia coli O26:H11 str.
           11368]
          Length = 295

 Score =  252 bits (643), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 103/288 (35%), Positives = 168/288 (58%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++G  + +  + GG+   GG+   L QP E+VI+AGAG+G F++ N  K IK +  +
Sbjct: 1   MLILLGYLVVLGTVFGGYLMTGGSLGALYQPAELVIIAGAGIGSFIVGNNGKAIKGTLKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y D+L LLY LM   ++      E  I++P  S IF S P +L ++
Sbjct: 61  LPLLFRRSKYTKAMYMDLLALLYRLMAKSRQMGMFSLERDIENPRESEIFASYPRILADS 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FI DY+R+II G+  ++EIE LMDEEI+    E   P ++++ +G+SLPA GIV A
Sbjct: 121 VMLDFIVDYLRLIISGHMNTFEIEALMDEEIETHESEAEVPANSLALVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+G+  +    LG  I  ++ GT LGI+L+Y   +PL S ++    +  ++   
Sbjct: 181 VMGVVHALGSADRPAAELGALIAHAMVGTFLGILLAYGFISPLASVLRQKSAETSKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
           VK  L++ +NG  P +A+E+GRK L  SERPS   + + V    + ++
Sbjct: 241 VKVTLLSNLNGYAPPIAVEFGRKTLYSSERPSFIELEEHVRAVKNPQQ 288


>gi|192360488|ref|YP_001981666.1| chemotaxis motA protein [Cellvibrio japonicus Ueda107]
 gi|190686653|gb|ACE84331.1| chemotaxis motA protein [Cellvibrio japonicus Ueda107]
          Length = 285

 Score =  252 bits (643), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 97/285 (34%), Positives = 159/285 (55%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M+ I+G+ + + C+IGGF   GGN   L+ P EI+I+ GA  G  ++ NPL V  +   S
Sbjct: 1   MNIILGIIVVLGCVIGGFVIHGGNALALMSPIEIMIICGASFGAMIIGNPLSVTINVVKS 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
              +       +  Y D+L LLY ++   ++      E  I++P +S IF + P +L+++
Sbjct: 61  AGALMTPSKYNKIFYLDMLTLLYDILNKTRREGLMAIEGDIEEPESSPIFANYPEILKDH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FICDY+R+++ GN   +E+E+LM++E++    E      AI +  + LP  GIV A
Sbjct: 121 HIVEFICDYLRIMVAGNMAPHELESLMEQELEGHHQEASIVPGAIQNAADGLPGFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG++  MG +   P  +G ++  +L GTLLGI+ +Y    P +S +      + R +  
Sbjct: 181 VLGVVITMGKIGGPPSEIGASVAAALVGTLLGILFAYGFIGPFSSYLNHKVRDESRAFEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           +K  L+A MNG  PQVA+E+GRKVL  S RPS   + ++      
Sbjct: 241 IKAVLVASMNGVPPQVAVEFGRKVLFHSVRPSFSELEEQYRASKK 285


>gi|194439071|ref|ZP_03071154.1| chemotaxis protein MotA [Escherichia coli 101-1]
 gi|300822335|ref|ZP_07102476.1| flagellar motor protein MotA [Escherichia coli MS 119-7]
 gi|301029342|ref|ZP_07192439.1| flagellar motor protein MotA [Escherichia coli MS 196-1]
 gi|194422030|gb|EDX38034.1| chemotaxis protein MotA [Escherichia coli 101-1]
 gi|299877768|gb|EFI85979.1| flagellar motor protein MotA [Escherichia coli MS 196-1]
 gi|300525218|gb|EFK46287.1| flagellar motor protein MotA [Escherichia coli MS 119-7]
 gi|323972600|gb|EGB67803.1| chemotaxis protein MotA [Escherichia coli TA007]
 gi|332343617|gb|AEE56951.1| chemotaxis protein MotA [Escherichia coli UMNK88]
          Length = 295

 Score =  251 bits (642), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 103/288 (35%), Positives = 168/288 (58%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++G  + +  + GG+   GG+   L QP E+VI+AGAG+G F++ N  K IK +  +
Sbjct: 1   MLILLGYLVVLGTVFGGYLMTGGSLGALYQPAELVIIAGAGIGSFIVGNNGKAIKGTLKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y D+L LLY LM   ++      E  I++P  S IF S P +L ++
Sbjct: 61  LPLLFRRSKYTKAMYMDLLALLYRLMAKSRQMGMFSLERDIENPRESEIFASYPRILADS 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FI DY+R+II G+  ++EIE LMDEEI+    E   P ++++ +G+SLPA GIV A
Sbjct: 121 VMLDFIVDYLRLIISGHMNTFEIEALMDEEIETHASEAEVPANSLALVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+G+  +    LG  I  ++ GT LGI+L+Y   +PL S ++    +  ++   
Sbjct: 181 VMGVVHALGSADRPAAELGALIAHAMVGTFLGILLAYGFISPLASVLRQKSAETSKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
           VK  L++ +NG  P +A+E+GRK L  SERPS   + + V    + ++
Sbjct: 241 VKVTLLSNLNGYAPPIAVEFGRKTLYSSERPSFIELEEHVRAVKNPQQ 288


>gi|237731927|ref|ZP_04562408.1| motility protein A [Citrobacter sp. 30_2]
 gi|226907466|gb|EEH93384.1| motility protein A [Citrobacter sp. 30_2]
          Length = 295

 Score =  251 bits (642), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 102/286 (35%), Positives = 163/286 (56%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++G  + I  + GG+   GG+   L QP E+VI+ GAG+G F++ N  K IK +  +
Sbjct: 1   MLILLGYLVVIGTVFGGYMMTGGHLGALYQPAELVIIGGAGIGAFIVGNNGKAIKGTMKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  +F      +  Y D+L LLY LM   ++      E  I++P  S IF S P +L + 
Sbjct: 61  IPLLFRRSKYTKAMYMDLLALLYRLMAKSRQQGMFSLERDIENPKESEIFASYPRILADA 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FI DY+R+II GN  ++EIE LMDEEI+    E   P ++++ +G+SLPA GIV A
Sbjct: 121 VMLDFIVDYLRLIISGNMNTFEIEALMDEEIETHESEAEVPANSLAMVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+ +  +    LG  I  ++ GT LGI+L+Y   +PL S ++    +  ++   
Sbjct: 181 VMGVVHALASADRPAAELGALIAHAMVGTFLGILLAYGFISPLASVLRQKSAETTKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHN 286
           VK  L++ +NG  P +A+E+GRK L  SERPS   + + V    + 
Sbjct: 241 VKITLLSNLNGYAPPIAVEFGRKTLYSSERPSFIELEEHVRAVRNP 286


>gi|62317078|ref|YP_222931.1| flagellar motor protein MotA [Brucella abortus bv. 1 str. 9-941]
 gi|83269071|ref|YP_418362.1| flagellar motor protein MotA [Brucella melitensis biovar Abortus
           2308]
 gi|225685987|ref|YP_002733959.1| flagellar motor protein MotA [Brucella melitensis ATCC 23457]
 gi|254691433|ref|ZP_05154687.1| flagellar motor protein MotA [Brucella abortus bv. 6 str. 870]
 gi|254698367|ref|ZP_05160195.1| flagellar motor protein MotA [Brucella abortus bv. 2 str. 86/8/59]
 gi|254731812|ref|ZP_05190390.1| flagellar motor protein MotA [Brucella abortus bv. 4 str. 292]
 gi|256043049|ref|ZP_05445994.1| flagellar motor protein MotA [Brucella melitensis bv. 1 str. Rev.1]
 gi|256256619|ref|ZP_05462155.1| flagellar motor protein MotA [Brucella abortus bv. 9 str. C68]
 gi|62197271|gb|AAX75570.1| chemotaxis motA protein [Brucella abortus bv. 1 str. 9-941]
 gi|82939345|emb|CAJ12292.1| Flagellar motor protein MotA [Brucella melitensis biovar Abortus
           2308]
 gi|225642092|gb|ACO02005.1| chemotaxis motA protein [Brucella melitensis ATCC 23457]
          Length = 290

 Score =  251 bits (642), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 154/290 (53%), Positives = 207/290 (71%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+GL IT+ C++GGF AMGG+  +LIQP+E +I+ GA LG F +ANP  ++KD+G +
Sbjct: 1   MGIIVGLVITLGCMLGGFIAMGGHVSVLIQPWEFIIILGAALGTFFVANPFSLVKDTGRA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            +E F      Q  Y DVL +LY LM  L+  SRNE E HID+P  S IF + P+VL+  
Sbjct: 61  CMEAFTDAVPKQRDYLDVLGVLYSLMRELRAKSRNEVEVHIDNPKESPIFLAYPSVLKKE 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +LT FICDY R+IIVGN RSYEIE LMDEEI  I  +KLKPY A+  + E+LPA+GIV A
Sbjct: 121 DLTNFICDYCRLIIVGNVRSYEIEALMDEEIRTIARDKLKPYQAMITISEALPALGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +L +IKAMG L QSP++LG  IG +L GT  GI  SY +  P+ ++IKSTR K +RLYI+
Sbjct: 181 VLSVIKAMGALDQSPEVLGHLIGAALVGTFAGIFFSYGVIGPIANKIKSTREKNNRLYIV 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK+ L+AYMNG++PQ+A+EYGRK +   ERP+I++V QE +     ++A+
Sbjct: 241 VKQTLLAYMNGSLPQIAVEYGRKTISAYERPTIDVVEQETMASVPTQQAA 290


>gi|154253327|ref|YP_001414151.1| MotA/TolQ/ExbB proton channel [Parvibaculum lavamentivorans DS-1]
 gi|154157277|gb|ABS64494.1| MotA/TolQ/ExbB proton channel [Parvibaculum lavamentivorans DS-1]
          Length = 312

 Score =  251 bits (641), Expect = 9e-65,   Method: Composition-based stats.
 Identities = 100/287 (34%), Positives = 159/287 (55%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G+ + +L + GG+ AMGG+  +L QPFE VI+ GA  G F +ANP  V+K  G  
Sbjct: 26  MRLIVGIAVVLLSVFGGYAAMGGHLEVLWQPFEAVIILGAAFGAFCIANPPSVLKAVGGI 85

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
              +F      +  + ++L L Y L    K       E H+++P  STIF   P    ++
Sbjct: 86  FGTLFKGPRYDKAAFLELLGLQYTLFKLAKSKGNLALEAHVENPGESTIFAQFPKFSADH 145

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+CDY+RMI +G   ++E+E+LMDEE++    E+ +   A+  + +  PA+GIV A
Sbjct: 146 HAVEFMCDYLRMITLGTENAHELESLMDEELETHHQERERIVSAMQALADGTPALGIVAA 205

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IK MG++ Q P +LG  IG +L GT LG+ ++Y    P+   +++T   + + ++ 
Sbjct: 206 VLGVIKTMGSIDQPPSVLGGLIGGALVGTFLGVFVAYGFFGPMAQSLRNTYEAESKYFLS 265

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
           +K  L+A+M G  P V+IE+ RK L    RP+   V Q         
Sbjct: 266 MKAGLLAHMAGYAPAVSIEFARKALMSEVRPTFIEVEQSTAALQPAA 312


>gi|256111965|ref|ZP_05452916.1| flagellar motor protein MotA [Brucella melitensis bv. 3 str. Ether]
          Length = 290

 Score =  251 bits (641), Expect = 9e-65,   Method: Composition-based stats.
 Identities = 155/290 (53%), Positives = 207/290 (71%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+GL IT+ C++GGF AMGG+  +LIQP+E +I+ GA LG F +ANP  ++KD+G +
Sbjct: 1   MGIIVGLVITLGCMLGGFIAMGGHVSVLIQPWEFIIILGAALGTFFVANPFSLVKDTGRA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            +E F      Q  Y DVL +LY LM  L+  SRNE E HID+P  S IF + P+VL+  
Sbjct: 61  CMEAFTDAVPKQRDYLDVLGVLYSLMRELRAKSRNEVEVHIDNPKESPIFLAYPSVLKKE 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +LT FICDY R+IIVGN RSYEIE LMDEEI  I  +KLKPY A+  + E+LPA+GIV A
Sbjct: 121 DLTNFICDYCRLIIVGNVRSYEIEALMDEEIRTIARDKLKPYQAMITISEALPALGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +L +IKAMG L QSP++LG  IG +L GT  GI  SY +  P+ ++IKSTR K +RLYI+
Sbjct: 181 VLSVIKAMGALDQSPEVLGHLIGAALVGTFAGIFFSYGVIGPIANKIKSTREKNNRLYIV 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK+ L+AYMNG++PQ+A+EYGRK +   ERP+I++V QE L     ++A+
Sbjct: 241 VKQTLLAYMNGSLPQIAVEYGRKTISAYERPTIDVVEQETLASVPTQQAA 290


>gi|254695268|ref|ZP_05157096.1| flagellar motor protein MotA [Brucella abortus bv. 3 str. Tulya]
          Length = 290

 Score =  251 bits (641), Expect = 9e-65,   Method: Composition-based stats.
 Identities = 153/290 (52%), Positives = 207/290 (71%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+GL IT+ C++GGF AMGG+  +LIQP+E +I+ GA LG F +ANP  ++KD+G +
Sbjct: 1   MGIIVGLVITLGCMLGGFIAMGGHVSVLIQPWEFIIILGAALGTFFVANPFSLVKDTGRA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            +E F      Q  Y DVL +LY LM  L+  SRNE E HID+P  S IF + P+VL+  
Sbjct: 61  CMEAFTDAVPKQRDYLDVLGVLYSLMRELRAKSRNEVEVHIDNPKESPIFLAYPSVLKKE 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +LT FICDY R+IIVGN RSYEI+ LMDEEI  I  +KLKPY A+  + E+LPA+GIV A
Sbjct: 121 DLTNFICDYCRLIIVGNVRSYEIDALMDEEIRTIARDKLKPYQAMITISEALPALGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +L +IKAMG L QSP++LG  IG +L GT  GI  SY +  P+ ++IKSTR K +RLYI+
Sbjct: 181 VLSVIKAMGALDQSPEVLGHLIGAALVGTFAGIFFSYGVIGPIANKIKSTREKNNRLYIV 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK+ L+AYMNG++PQ+A+EYGRK +   ERP+I++V QE +     ++A+
Sbjct: 241 VKQTLLAYMNGSLPQIAVEYGRKTISAYERPTIDVVEQETMASVPTQQAA 290


>gi|323174593|gb|EFZ60214.1| chemotaxis protein motA [Escherichia coli LT-68]
          Length = 295

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 102/288 (35%), Positives = 167/288 (57%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++G  + +  + GG+   GG+   L QP E+VI+AGAG+G F++ N  K IK +  +
Sbjct: 1   MLILLGYLVVLGTVFGGYLMTGGSLGALYQPAELVIIAGAGIGSFIVGNNGKAIKGTLKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y D+L LLY LM   ++      E  I++P  S IF S P +L ++
Sbjct: 61  LPLLFRRSKYTKAMYMDLLALLYRLMAKSRQMGMFSLERDIENPRESEIFASYPRILADS 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FI DY+R+II G+  ++EIE LMDEEI+    E   P ++++ +G+SLPA GIV A
Sbjct: 121 VMLDFIVDYLRLIISGHMNTFEIEALMDEEIETNESEAEVPANSLALVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G + A+G+  +    LG  I  ++ GT LGI+L+Y   +PL + ++    +  ++   
Sbjct: 181 VMGGVHALGSADRPAAELGALIAHAMVGTFLGILLAYGFISPLATVLRQKSAETSKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
           VK  L++ +NG  P +A+E+GRK L  SERPS   + + V    + ++
Sbjct: 241 VKVTLLSNLNGYAPPIAVEFGRKTLYSSERPSFIELEEHVRAVKNPQQ 288


>gi|260568538|ref|ZP_05839007.1| flagellar motor protein [Brucella suis bv. 4 str. 40]
 gi|261313763|ref|ZP_05952960.1| flagellar motor protein MotA [Brucella pinnipedialis M163/99/10]
 gi|261318998|ref|ZP_05958195.1| flagellar motor protein MotA [Brucella pinnipedialis B2/94]
 gi|261753132|ref|ZP_05996841.1| flagellar motor protein MotA [Brucella suis bv. 3 str. 686]
 gi|265986999|ref|ZP_06099556.1| flagellar motor protein MotA [Brucella pinnipedialis M292/94/1]
 gi|294853150|ref|ZP_06793822.1| chemotaxis protein MotA [Brucella sp. NVSL 07-0026]
 gi|306841069|ref|ZP_07473792.1| flagellar motor protein MotA [Brucella sp. BO2]
 gi|260155203|gb|EEW90284.1| flagellar motor protein [Brucella suis bv. 4 str. 40]
 gi|261298221|gb|EEY01718.1| flagellar motor protein MotA [Brucella pinnipedialis B2/94]
 gi|261302789|gb|EEY06286.1| flagellar motor protein MotA [Brucella pinnipedialis M163/99/10]
 gi|261742885|gb|EEY30811.1| flagellar motor protein MotA [Brucella suis bv. 3 str. 686]
 gi|264659196|gb|EEZ29457.1| flagellar motor protein MotA [Brucella pinnipedialis M292/94/1]
 gi|294818805|gb|EFG35805.1| chemotaxis protein MotA [Brucella sp. NVSL 07-0026]
 gi|306288907|gb|EFM60210.1| flagellar motor protein MotA [Brucella sp. BO2]
          Length = 296

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 154/290 (53%), Positives = 208/290 (71%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           +  I+GL IT+ C++GGF AMGG+  +LIQP+E +I+ GA LG F +ANP  ++KD+G +
Sbjct: 7   LGIIVGLVITLGCMLGGFIAMGGHVSVLIQPWEFIIILGAALGTFFVANPFSLVKDTGRA 66

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            +E F      Q  Y DVL +LY LM  L+  SRNE E HID+P  S IF + P+VL+  
Sbjct: 67  CMEAFTDAVPKQRDYLDVLGVLYSLMRELRAKSRNEVEVHIDNPKESPIFLAYPSVLKKE 126

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +LT FICDY R+IIVGN RSYEIE LMDEEI  I  +KLKPY A+  + E+LPA+GIV A
Sbjct: 127 DLTNFICDYCRLIIVGNVRSYEIEALMDEEIRTIARDKLKPYQAMITISEALPALGIVAA 186

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKAMG L QSP++LG  IG +L GT  GI  SY +  P+ ++IKSTR K +RLYI+
Sbjct: 187 VLGVIKAMGALDQSPEVLGHLIGAALVGTFAGIFFSYGVIGPIANKIKSTREKNNRLYIV 246

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK+ L+AYMNG++PQ+A+EYGRK +   ERP+I++V QE +     ++A+
Sbjct: 247 VKQTLLAYMNGSLPQIAVEYGRKTISAYERPTIDVVEQETMASVPTQQAA 296


>gi|118589945|ref|ZP_01547349.1| flagellar motor protein MotA [Stappia aggregata IAM 12614]
 gi|118437442|gb|EAV44079.1| flagellar motor protein MotA [Stappia aggregata IAM 12614]
          Length = 298

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 141/286 (49%), Positives = 199/286 (69%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M+ +IGL I    +IGGF A+GG   +L QP+E+VI+ G  +G FV+ANP+KVIK + V+
Sbjct: 1   MTILIGLIIAGASLIGGFAALGGKVSVLWQPWELVIILGVAIGAFVVANPMKVIKGTLVA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           + +        +  Y DVL LLY LM  L+   RN+ E HI+DP  S IF   P+VL N 
Sbjct: 61  VSDALRNAVPNKREYLDVLALLYGLMRELRAKGRNQVEPHIEDPNTSPIFQKYPSVLRNA 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            LTTFICDY R+IIVGNAR++EIE L+DEE+  I  +++KPYHA+S + ++LPAIGI+ A
Sbjct: 121 SLTTFICDYFRLIIVGNARAHEIEALVDEELQTIHRDQMKPYHAMSSIADALPAIGIIAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKAMG + QSP++LG+ IG +L GT +GI  SYSL  P+ S+I++ R  + R YI+
Sbjct: 181 VLGVIKAMGAIDQSPQLLGSLIGAALVGTFVGIFFSYSLFGPIASKIRNVRENRLRTYIV 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHN 286
           VK+ L+A+MNGA PQ+A+E+GRK +   +RP+I+ V  E +     
Sbjct: 241 VKQTLLAFMNGADPQIALEHGRKTISDYDRPTIDEVENETMSAGGA 286


>gi|218513717|ref|ZP_03510557.1| flagellar motor protein MotA [Rhizobium etli 8C-3]
          Length = 282

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 165/282 (58%), Positives = 214/282 (75%)

Query: 9   ITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYK 68
           +T  C++G F AMGG+   L QPFE VI+ GAGLG F+MANP+KV+KDSG +L E F + 
Sbjct: 1   MTCGCVVGSFMAMGGHVEALFQPFEFVIIGGAGLGSFIMANPMKVVKDSGKALGEAFKHA 60

Query: 69  ALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICD 128
              +  Y D L +LY LM +L+  SRNE E HID+P  STIF   PTVL+N ELT FICD
Sbjct: 61  VPKERNYLDTLGVLYSLMRDLRTKSRNEIEAHIDNPAESTIFQQAPTVLKNKELTAFICD 120

Query: 129 YMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAM 188
           Y+R+II+GNARS+EIE LMDEE++ I+++K+KPYHAI  MG+S PAIGIV A+LG+IKAM
Sbjct: 121 YVRLIIIGNARSHEIEALMDEELNTIMHDKMKPYHAIQIMGDSFPAIGIVAAVLGVIKAM 180

Query: 189 GNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAY 248
            +++ SP++LG  IG +L GT LGI+LSY +C+PL SQIK  R KQHRLY+IVK+ L+AY
Sbjct: 181 AHINDSPEVLGHLIGSALVGTFLGILLSYCVCSPLVSQIKVVRNKQHRLYVIVKQTLLAY 240

Query: 249 MNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           MNG++PQVA+EYGRK +   ERPSI+ V QE++      KA+
Sbjct: 241 MNGSVPQVALEYGRKTISAYERPSIDAVEQEMMNPGGENKAA 282


>gi|319898629|ref|YP_004158722.1| Chemotaxis protein motA (Motility protein A) [Bartonella
           clarridgeiae 73]
 gi|319402593|emb|CBI76138.1| Chemotaxis protein motA (Motility protein A) [Bartonella
           clarridgeiae 73]
          Length = 291

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 135/290 (46%), Positives = 199/290 (68%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  IIGL I   CI+GG+ AMGG+  +LIQP+E VI+ G+ +G F+++NP   IKD+  +
Sbjct: 1   MGVIIGLVIIFGCILGGYVAMGGHLDVLIQPWEFVIILGSAIGTFIVSNPFPAIKDTLKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            +E        Q  +  +L LLY+LM  ++  SR+E E HID+P  ST+F   P +L++ 
Sbjct: 61  TIEAMKDAVPKQKDFLALLGLLYVLMREMRSKSRSEMEGHIDNPKESTLFQQYPLILKDE 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            LT FICDY R+I++GN R +EIE LMDEEI  I ++  KPY A+ +M ++LPA+GIV A
Sbjct: 121 SLTNFICDYCRLIVMGNTRHFEIEALMDEEIHTISHDSQKPYQAMQNMADALPALGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG++KAMG +S+ P++LG  IG +L GT  GI  +Y +  P+ S+IK+ R K+ R+YI+
Sbjct: 181 VLGVVKAMGAISEPPEVLGHLIGAALVGTFAGIFFAYGIFGPIASKIKTVRNKKVRIYIV 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK+ L+AYMNGAIPQ+A+EYGRK +   +RP+I++V Q  +     +K +
Sbjct: 241 VKQTLLAYMNGAIPQIALEYGRKTISAKDRPTIDVVEQHAIAGQGTEKEA 290


>gi|323139661|ref|ZP_08074703.1| MotA/TolQ/ExbB proton channel [Methylocystis sp. ATCC 49242]
 gi|322395093|gb|EFX97652.1| MotA/TolQ/ExbB proton channel [Methylocystis sp. ATCC 49242]
          Length = 291

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 145/290 (50%), Positives = 209/290 (72%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           MS IIGL +T+ C++GGF A+GG+  +L QP+E VI+ G+ LG F++ANP+KVIKD+G +
Sbjct: 1   MSFIIGLIVTMGCMLGGFAALGGHLIVLWQPWEFVIIMGSALGTFIVANPVKVIKDTGKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +++    K   +  Y D+L LL+ LM  L+  +RNE E HID P  S +FT+ P VL+N 
Sbjct: 61  VVQAVLEKTPKRRDYLDILGLLHALMRELRSKARNEVEVHIDQPSESPLFTAFPNVLKNT 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           E+TTFICDY R+ I+GN +++EIE+LMDEE+  I ++KLKPYHA++ +G+ LPA+GIV A
Sbjct: 121 EITTFICDYCRLYIIGNVKTFEIESLMDEEMAEIKHDKLKPYHALTAIGDGLPALGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKAMG L QSP++LG  IG ++ GT  GI +SY +  PL  ++K  R K+  +Y+I
Sbjct: 181 VLGVIKAMGALDQSPELLGGLIGAAMVGTFAGIFVSYGIMTPLAYKVKVARSKECHVYLI 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           +K+ L+A+MNGA+PQVAIE+GRK +P  ERP+I+ V  E L        +
Sbjct: 241 IKQTLLAFMNGALPQVAIEHGRKSIPSHERPTIDEVENETLSGGGPSAEA 290


>gi|291085222|ref|ZP_06352452.2| chemotaxis MotA protein [Citrobacter youngae ATCC 29220]
 gi|291072390|gb|EFE10499.1| chemotaxis MotA protein [Citrobacter youngae ATCC 29220]
          Length = 301

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 101/286 (35%), Positives = 163/286 (56%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
             ++G  + I  + GG+   GG+   L QP E+VI+ GAG+G F++ N  K IK +  ++
Sbjct: 8   LILLGYLVVIGTVFGGYMMTGGHLGALYQPAELVIIGGAGIGAFIVGNNGKAIKGTMKAI 67

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
             +F      +  Y D+L LLY LM   ++      E  I++P  S IF S P +L +  
Sbjct: 68  PMLFRRSKYTKAMYMDLLALLYRLMAKSRQQGMFSLERDIENPKESEIFASYPRILADAV 127

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
           +  FI DY+R+II GN  ++EIE LMDEEI+    E   P ++++ +G+SLPA GIV A+
Sbjct: 128 MLDFIVDYLRLIISGNMNTFEIEALMDEEIETHESEAEVPANSLAMVGDSLPAFGIVAAV 187

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           +G++ A+ +  +    LG+ I  ++ GT LGI+L+Y   +PL S ++    +  ++   V
Sbjct: 188 MGVVHALASADRPAAELGSLIAHAMVGTFLGILLAYGFISPLASVLRQKSAETTKMMQCV 247

Query: 242 KKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
           K  L++ +NG  P +A+E+GRK L  SERPS   + + V    +  
Sbjct: 248 KITLLSNLNGYAPPIAVEFGRKTLYSSERPSFIELEEHVRAVRNPA 293


>gi|261749888|ref|ZP_05993597.1| flagellar motor protein MotA [Brucella suis bv. 5 str. 513]
 gi|261739641|gb|EEY27567.1| flagellar motor protein MotA [Brucella suis bv. 5 str. 513]
          Length = 296

 Score =  250 bits (639), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 153/290 (52%), Positives = 207/290 (71%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           +  I+GL IT+ C++GGF AMGG+  +LIQP+E +I+ GA LG F +ANP  ++KD+G +
Sbjct: 7   LGIIVGLVITLGCMLGGFIAMGGHVSVLIQPWEFIIILGAALGTFFVANPFSLVKDTGRA 66

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            +E F      Q  Y DVL +LY LM  L+  SRNE E HID+P  S IF + P+VL+  
Sbjct: 67  CMEAFTDAVPKQRDYLDVLGVLYSLMRELRAKSRNEVEVHIDNPKESPIFLAYPSVLKKE 126

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +LT FICDY R+IIVGN RSYEIE LMDEEI  I  +KLKPY A+  + E+LPA+GIV A
Sbjct: 127 DLTNFICDYCRLIIVGNVRSYEIEALMDEEIRTIARDKLKPYQAMITISEALPALGIVAA 186

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKAMG L QSP++LG  IG +L GT  GI  SY +  P+ ++IKSTR K +RLYI+
Sbjct: 187 VLGVIKAMGALDQSPEVLGHLIGAALVGTFAGIFFSYGVIGPIANKIKSTREKNNRLYIV 246

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK+ L+AYMNG++PQ+A+EYGRK +   ERP+I++  QE +     ++A+
Sbjct: 247 VKQTLLAYMNGSLPQIAVEYGRKTISAYERPTIDVAEQETMASVPTQQAA 296


>gi|238025854|ref|YP_002910085.1| flagellar motor protein MotA [Burkholderia glumae BGR1]
 gi|124695900|gb|ABN14294.1| MotA [Burkholderia glumae BGR1]
 gi|124695930|gb|ABN14298.1| MotA [Burkholderia glumae BGR1]
 gi|237875048|gb|ACR27381.1| MotA [Burkholderia glumae BGR1]
          Length = 286

 Score =  250 bits (639), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 105/285 (36%), Positives = 170/285 (59%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  +T+L + GG+   GG+   L+QP EI+++ GAG+G F++ N +K IK + + 
Sbjct: 1   MLIIVGTLVTLLSVFGGYALAGGHLGALVQPLEILMIVGAGVGAFILGNGVKTIKATLLV 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y +++ LLY+L+   +K      E  IDDP  S IFT  P +L + 
Sbjct: 61  LPPLFKSSKYTKALYMELMALLYVLLAKARKEGTLTLEADIDDPEKSPIFTQYPKILADK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  F+ DY+R+++ GN  ++EIE+LMDEEI+    E   P HA++ +G+++PA GIV A
Sbjct: 121 HMVEFLTDYLRLMVGGNMNAFEIESLMDEEIETHHVEGEGPAHALTRVGDAMPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  M +  + P +LG  I  +L GT LGI+LSY L  PL S  +    +  +L   
Sbjct: 181 VMGVVHTMASADKPPAVLGAMIAQALVGTFLGILLSYGLIGPLASLAEQRVAESTKLLQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           +K  ++A +NG  P +A+E+GRKVL  +ERPS   + + V +   
Sbjct: 241 IKVTILASLNGYAPAIAVEFGRKVLFSTERPSFAELEEHVRRVKA 285


>gi|323152619|gb|EFZ38895.1| chemotaxis protein motA [Escherichia coli EPECa14]
          Length = 295

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 103/288 (35%), Positives = 168/288 (58%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++G  + +  + GG+   GG+   L QP E+VI+AGAG+G F++ N  K IK +  +
Sbjct: 1   MLILLGYLVVLSTVFGGYLMTGGSLGALYQPAELVIIAGAGIGSFIVGNNGKAIKGTLKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y D+L LLY LM   ++      E  I++P  S IF S P +L ++
Sbjct: 61  LPLLFRRSKYTKAMYMDLLALLYRLMAKSRQMGMFSLERDIENPRESEIFASYPRILADS 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FI DY+R+II G+  ++EIE LMDEEI+    E   P ++++ +G+SLPA GIV A
Sbjct: 121 VMLDFIVDYLRLIISGHMNTFEIEALMDEEIETHESEAEVPANSLALVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+G+  +    LG  I  ++ GT LGI+L+Y   +PL S ++    +  ++   
Sbjct: 181 VMGVVHALGSADRPAAELGALIAHAMVGTFLGILLAYGFISPLASVLRQKSAETSKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
           VK  L++ +NG  P +A+E+GRK L  SERPS   + + V    + ++
Sbjct: 241 VKVTLLSNLNGYAPPIAVEFGRKTLYSSERPSFIELEEHVRAVKNPQQ 288


>gi|265985675|ref|ZP_06098410.1| flagellar motor protein MotA [Brucella sp. 83/13]
 gi|264664267|gb|EEZ34528.1| flagellar motor protein MotA [Brucella sp. 83/13]
          Length = 296

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 153/290 (52%), Positives = 208/290 (71%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           +  I+GL IT+ C++GGF AMGG+  +LIQP+E +I+ GA LG F +ANP  ++KD+G +
Sbjct: 7   LGIIVGLVITLGCMLGGFIAMGGHVSVLIQPWEFIIILGAALGTFFVANPFSLVKDTGRA 66

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            +E F      Q  Y DVL +LY LM  L+  SRNE E HID+P  S IF + P+VL+  
Sbjct: 67  CMEAFTDAVPKQRDYLDVLGVLYSLMRELRAKSRNEVEVHIDNPKESPIFLAYPSVLKKE 126

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +LT FICDY R+IIVGN RSYEIE LMDEEI  I  +KLKP+ A+  + E+LPA+GIV A
Sbjct: 127 DLTNFICDYCRLIIVGNVRSYEIEALMDEEIRTIARDKLKPHQAMITISEALPALGIVAA 186

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKAMG L QSP++LG  IG +L GT  GI  SY +  P+ ++IKSTR K +RLYI+
Sbjct: 187 VLGVIKAMGALDQSPEVLGHLIGAALVGTFAGIFFSYGVIGPIANKIKSTREKNNRLYIV 246

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK+ L+AYMNG++PQ+A+EYGRK +   ERP+I++V QE +     ++A+
Sbjct: 247 VKQTLLAYMNGSLPQIAVEYGRKTISAYERPTIDVVEQETMASVPTQQAA 296


>gi|261216768|ref|ZP_05931049.1| flagellar motor protein MotA [Brucella ceti M13/05/1]
 gi|261319635|ref|ZP_05958832.1| flagellar motor protein MotA [Brucella ceti M644/93/1]
 gi|260921857|gb|EEX88425.1| flagellar motor protein MotA [Brucella ceti M13/05/1]
 gi|261292325|gb|EEX95821.1| flagellar motor protein MotA [Brucella ceti M644/93/1]
          Length = 296

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 153/290 (52%), Positives = 207/290 (71%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           +  I+GL IT+ C++GGF AMGG+  +LIQP+E +I+ GA LG F +ANP  ++KD+G +
Sbjct: 7   LGIIVGLVITLGCMLGGFIAMGGHVSVLIQPWEFIIILGAALGTFFVANPFSLVKDTGRA 66

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            +E F      Q  Y DVL +LY LM  L+  SRNE E HID+P  S IF + P+VL+  
Sbjct: 67  CMEAFTDAVPKQRDYLDVLGVLYSLMRELRAKSRNEVEVHIDNPKESPIFLAYPSVLKKE 126

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +LT FICDY R+IIVGN RSYEIE LMDEEI  I  +KLKPY A+  + E+LPA+GIV A
Sbjct: 127 DLTNFICDYCRLIIVGNVRSYEIEALMDEEIRTIARDKLKPYQAMITISEALPALGIVAA 186

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKAMG L QSP++LG  IG +L GT  GI  SY +  P+ ++IKSTR K + LYI+
Sbjct: 187 VLGVIKAMGALDQSPEVLGHLIGAALVGTFAGIFFSYGVIGPIANKIKSTREKNNCLYIV 246

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK+ L+AYMNG++PQ+A+EYGRK +   ERP+I++V QE +     ++A+
Sbjct: 247 VKQTLLAYMNGSLPQIAVEYGRKTISAYERPTIDVVEQETMASVPTQQAA 296


>gi|23013134|ref|ZP_00053072.1| COG1291: Flagellar motor component [Magnetospirillum
           magnetotacticum MS-1]
          Length = 286

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 94/282 (33%), Positives = 168/282 (59%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  IIG+ +T + +IGG+ A GG+  +L QPFE +I+ GA +G  ++ NP  VI   G +
Sbjct: 1   MFAIIGIVVTFVSVIGGYAAPGGHLGVLFQPFEWLIIIGAAVGSLLLGNPKTVILGIGKN 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  +F     G+D Y ++L +LY +    K       E+H++ P  S +F   P    ++
Sbjct: 61  IGLVFKGAHHGKDDYIELLSVLYAVFKLAKTKGDLALESHVEKPDESPLFGKFPKFSSDH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
              TF CDY+R++ +G + ++E+E+++D E++       +  HA++ MG+++PA+GIV A
Sbjct: 121 HTRTFFCDYLRLLTLGTSNAHELESIIDGELEAHHKHYHEIAHAVNLMGDAMPALGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+I  MG++++ P++LG  IG +L GT  G+++SY+   P+   ++      H  ++ 
Sbjct: 181 VLGVIHTMGSITEPPEVLGHLIGAALVGTFSGVLISYAFIAPIARNMQLCFDSDHYYFMA 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQ 282
           +K  L+ +M G  PQV+IE+ RK+LP   RP+ + + + V  
Sbjct: 241 IKAGLLGHMQGYAPQVSIEFARKILPDELRPTFQELEETVTN 282


>gi|255764488|ref|YP_003065099.2| flagellar motor protein MotA [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254547839|gb|ACT57159.2| flagellar motor protein MotA [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 290

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 290/290 (100%), Positives = 290/290 (100%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS
Sbjct: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN
Sbjct: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA
Sbjct: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII
Sbjct: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS
Sbjct: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290


>gi|261323601|ref|ZP_05962798.1| flagellar motor protein MotA [Brucella neotomae 5K33]
 gi|261299581|gb|EEY03078.1| flagellar motor protein MotA [Brucella neotomae 5K33]
          Length = 296

 Score =  249 bits (637), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 154/289 (53%), Positives = 207/289 (71%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           +  I+GL IT+ C++GGF AMGG+  +LIQP+E +I+ GA LG F +ANP  ++KD+G +
Sbjct: 7   LGIIVGLVITLGCMLGGFIAMGGHVSVLIQPWEFIIILGAALGTFFVANPFSLVKDTGRA 66

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            +E F      Q  Y DVL +LY LM  L+  SRNE E HID+P  S IF + P+VL+  
Sbjct: 67  CMEAFTDAVPKQRDYLDVLGVLYSLMRELRAKSRNEVEVHIDNPKESPIFLAYPSVLKKE 126

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +LT FICDY R+IIVGN RSYEIE LMDEEI  I  +KLKPY A+  + E+LPA+GIV A
Sbjct: 127 DLTNFICDYCRLIIVGNVRSYEIEALMDEEIRTIARDKLKPYQAMITISEALPALGIVAA 186

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKAMG L QSP++LG  IG +L GT  GI  SY +  P+ ++IKSTR K +RLYI+
Sbjct: 187 VLGVIKAMGALDQSPEVLGHLIGAALVGTFAGIFFSYGVIGPIANKIKSTREKNNRLYIV 246

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKA 289
           VK+ L+AYMNG++PQ+A+EYGRK +   ERP+I++V QE +     ++A
Sbjct: 247 VKQTLLAYMNGSLPQIAVEYGRKTISAYERPTIDVVEQETMASVPTQQA 295


>gi|330815145|ref|YP_004358850.1| MotA [Burkholderia gladioli BSR3]
 gi|327367538|gb|AEA58894.1| MotA [Burkholderia gladioli BSR3]
          Length = 286

 Score =  249 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 104/285 (36%), Positives = 169/285 (59%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   +G  +T+L + GG+   GG+   LIQP E++++ GAG+G F++ N +K+IK +   
Sbjct: 1   MLIFVGTLVTLLSVFGGYALAGGHLGALIQPLEVLMIVGAGVGAFILGNGIKMIKATLRL 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y +++ LLY+L+   +K      E  IDDP  S IFT  P +L + 
Sbjct: 61  LPTLFKSSKYTKALYMELMALLYVLLAKARKEGTLTLEADIDDPEKSPIFTQYPKILADK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  F+ DY+R+++ GN  ++EIE+LMDEEI+    E   P HA++ +G+++PA GIV A
Sbjct: 121 HMVEFLTDYLRLMVGGNMNAFEIESLMDEEIETHHVEVEGPAHALTRVGDAMPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  M +  + P +LG  I  +L GT LGI+LSY L  PL S  +    +  +L   
Sbjct: 181 VMGVVHTMASADKPPAVLGAMIAQALVGTFLGILLSYGLIGPLASLAEQRAAESTKLLQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           +K  ++A +NG  P +A+E+GRKVL  +ERPS   + + V +   
Sbjct: 241 IKVTILASLNGYAPAIAVEFGRKVLFSTERPSFAELEEHVRRVKA 285


>gi|144899851|emb|CAM76715.1| chemotaxis (motility protein A) transmembrane [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 286

 Score =  249 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 91/282 (32%), Positives = 163/282 (57%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  IIG+ +TI  +IGG+ A GG+  +L QPFE +I+ GA  G   + NP  ++      
Sbjct: 1   MFAIIGIVVTIASVIGGYAAAGGHLDVLWQPFEFIIILGAAFGSMFLGNPKDIVMGVFKK 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  +F      +D Y ++L +LY +    K       E+H++ P  S +F   P    ++
Sbjct: 61  IGMVFKGAHYKKDAYIEMLSMLYAVFKLAKTKGDLALESHVEKPDESPLFQKFPGFSNDH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
              TF CDY+R++ +G + ++E+E+++D E++       +  HA++ M +++PA+GIV A
Sbjct: 121 HTRTFFCDYLRLLTLGTSNAHELESIIDGELEAHHKHYHEISHAVNLMADAMPALGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+I  MG++++ P++LG  IG +L GT  G+++SY+   P+   ++ +    H   + 
Sbjct: 181 VLGVIHTMGSITEPPEVLGHLIGAALVGTFTGVLISYAFFAPMARNMQMSFDSDHYYLLA 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQ 282
           +K  L+A+M G  PQV+IE+ RK+LP   RP+ + + + V  
Sbjct: 241 IKAGLLAHMQGYAPQVSIEFARKILPDELRPTFQELEETVTN 282


>gi|299531266|ref|ZP_07044676.1| MotA/TolQ/ExbB proton channel [Comamonas testosteroni S44]
 gi|298720673|gb|EFI61620.1| MotA/TolQ/ExbB proton channel [Comamonas testosteroni S44]
          Length = 286

 Score =  249 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 96/283 (33%), Positives = 159/283 (56%), Gaps = 2/283 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  +IG  +   CI G +   GG+  +L++  PFE+V + G  LG F+++N  KV+K + 
Sbjct: 1   MLVLIGYIVAFGCIFGMYVLHGGSVGVLVKALPFEMVTIGGGALGAFIVSNQPKVLKATA 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
            ++          +  Y +V+ LLY L+   +K      E+ ++DP +ST+F + P ++ 
Sbjct: 61  KAIPSALRPSRYNKARYMEVMALLYELLQKARKEGLMSIESDVEDPQSSTVFQNYPQLMA 120

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           ++ +  F+ DY+RM++ GN  S+EIE LMD EI+    E   P  A++ +  +LPA GI+
Sbjct: 121 DHHVVEFLTDYLRMMVSGNLNSHEIEALMDSEIEAHHAEAHAPVMALNRLAGALPAFGII 180

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG++  M  + Q P +LG  I  +L GT LGI+L+Y+L  P+ + ++       + +
Sbjct: 181 AAVLGVVNTMAFVGQPPAVLGGMIASALVGTFLGILLAYALVEPMAALLEQRAQDAAKEF 240

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
             +K  L+A M G  P  AIE+GRKVL  +ERP    +   V 
Sbjct: 241 ECIKATLLASMQGYNPGTAIEFGRKVLFSTERPGFLELESHVK 283


>gi|90418399|ref|ZP_01226311.1| chemotaxis protein motA [Aurantimonas manganoxydans SI85-9A1]
 gi|90338071|gb|EAS51722.1| chemotaxis protein motA [Aurantimonas manganoxydans SI85-9A1]
          Length = 285

 Score =  249 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 142/285 (49%), Positives = 198/285 (69%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++GL +T+ C++GGF AMGG+  +L+QPFE VI+ G+ +G F++ANP KV+KD+G +
Sbjct: 1   MGILVGLIVTLSCLLGGFVAMGGHLGVLVQPFEYVIILGSSIGTFLVANPTKVVKDTGKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           + E F  K   Q+ Y  VL LL+ LM  ++  SR E E HID+P  S IF + P ++++ 
Sbjct: 61  IKEAFANKVPTQNDYLKVLALLHQLMREMRSKSRGEVEAHIDEPKESPIFQAYPELMKDE 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FICDY R+II+GNAR +EIE LM+EEI  I  ++LKP HA+  M + LPA+GIV A
Sbjct: 121 SLVHFICDYCRLIIIGNARPHEIEALMEEEIQTISSDRLKPKHALQDMADGLPALGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKAMG L QSP++LG  IG +L GT  GI  SY +  P+ +++KS R K  R+++I
Sbjct: 181 VLGVIKAMGALDQSPEVLGHLIGAALVGTFAGIFFSYGVVGPVATKVKSVREKNIRVFVI 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           V+  LIAYMNGAIPQVA+EYGRK +   +RPSI+ V  E +    
Sbjct: 241 VRSTLIAYMNGAIPQVALEYGRKTISAYDRPSIDQVETETIGGGA 285


>gi|56695126|ref|YP_165473.1| flagellar motor protein MotA [Ruegeria pomeroyi DSS-3]
 gi|56676863|gb|AAV93529.1| chemotaxis protein MotA [Ruegeria pomeroyi DSS-3]
          Length = 289

 Score =  249 bits (636), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 87/289 (30%), Positives = 164/289 (56%), Gaps = 3/289 (1%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  I+G+ +  + + GG+ A GG   I+++  PFE++++ GA  G F+++N +  +K + 
Sbjct: 1   MIGILGIVVIFVMVFGGYLAAGGKMTIILKSLPFEMMMIGGAATGAFLISNDMGGVKHTL 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
             + ++F       + Y D+L LL+ L+   ++    E E HI+DP +S +F+  P +  
Sbjct: 61  KDVGKVFKGPKWKPEDYRDLLCLLFSLIRIARQNPV-EVEQHIEDPASSALFSKYPRIQA 119

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           ++E    ICD MR   +     +++E ++++ ++  L+  +   HA+  + + LPA+GIV
Sbjct: 120 DHEAVDLICDTMRSASMNYDDPHQVEEVLEKRMEANLHHAMHSSHALQTVADGLPALGIV 179

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG+IK MG++ Q P++LG  IG +L GT LG+ L+Y L  P  S++K+   + +  Y
Sbjct: 180 AAVLGVIKTMGSIDQPPEVLGRLIGGALVGTFLGVFLAYGLVGPFASKVKAVVEEDNHFY 239

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
           +++K+ L+A ++   P + IE GR+  P   RP    + Q +     + 
Sbjct: 240 LLIKEVLVANLHNHNPAMCIEVGRQNTPSHIRPGFTDLEQALKDLKQDA 288


>gi|260544319|ref|ZP_05820140.1| flagellar motor protein [Brucella abortus NCTC 8038]
 gi|260564281|ref|ZP_05834766.1| flagellar motor protein [Brucella melitensis bv. 1 str. 16M]
 gi|260757051|ref|ZP_05869399.1| flagellar motor protein MotA [Brucella abortus bv. 6 str. 870]
 gi|260759578|ref|ZP_05871926.1| flagellar motor protein MotA [Brucella abortus bv. 4 str. 292]
 gi|260762822|ref|ZP_05875154.1| flagellar motor protein MotA [Brucella abortus bv. 2 str. 86/8/59]
 gi|260882861|ref|ZP_05894475.1| flagellar motor protein MotA [Brucella abortus bv. 9 str. C68]
 gi|265989487|ref|ZP_06102044.1| flagellar motor protein MotA [Brucella melitensis bv. 1 str. Rev.1]
 gi|265999227|ref|ZP_05465419.2| flagellar motor protein [Brucella melitensis bv. 2 str. 63/9]
 gi|260097590|gb|EEW81464.1| flagellar motor protein [Brucella abortus NCTC 8038]
 gi|260151924|gb|EEW87017.1| flagellar motor protein [Brucella melitensis bv. 1 str. 16M]
 gi|260669896|gb|EEX56836.1| flagellar motor protein MotA [Brucella abortus bv. 4 str. 292]
 gi|260673243|gb|EEX60064.1| flagellar motor protein MotA [Brucella abortus bv. 2 str. 86/8/59]
 gi|260677159|gb|EEX63980.1| flagellar motor protein MotA [Brucella abortus bv. 6 str. 870]
 gi|260872389|gb|EEX79458.1| flagellar motor protein MotA [Brucella abortus bv. 9 str. C68]
 gi|263000156|gb|EEZ12846.1| flagellar motor protein MotA [Brucella melitensis bv. 1 str. Rev.1]
 gi|263092724|gb|EEZ16933.1| flagellar motor protein [Brucella melitensis bv. 2 str. 63/9]
 gi|326410313|gb|ADZ67377.1| flagellar motor protein MotA [Brucella melitensis M28]
 gi|326553606|gb|ADZ88245.1| flagellar motor protein MotA [Brucella melitensis M5-90]
          Length = 296

 Score =  249 bits (636), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 153/290 (52%), Positives = 207/290 (71%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           +  I+GL IT+ C++GGF AMGG+  +LIQP+E +I+ GA LG F +ANP  ++KD+G +
Sbjct: 7   LGIIVGLVITLGCMLGGFIAMGGHVSVLIQPWEFIIILGAALGTFFVANPFSLVKDTGRA 66

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            +E F      Q  Y DVL +LY LM  L+  SRNE E HID+P  S IF + P+VL+  
Sbjct: 67  CMEAFTDAVPKQRDYLDVLGVLYSLMRELRAKSRNEVEVHIDNPKESPIFLAYPSVLKKE 126

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +LT FICDY R+IIVGN RSYEIE LMDEEI  I  +KLKPY A+  + E+LPA+GIV A
Sbjct: 127 DLTNFICDYCRLIIVGNVRSYEIEALMDEEIRTIARDKLKPYQAMITISEALPALGIVAA 186

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +L +IKAMG L QSP++LG  IG +L GT  GI  SY +  P+ ++IKSTR K +RLYI+
Sbjct: 187 VLSVIKAMGALDQSPEVLGHLIGAALVGTFAGIFFSYGVIGPIANKIKSTREKNNRLYIV 246

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK+ L+AYMNG++PQ+A+EYGRK +   ERP+I++V QE +     ++A+
Sbjct: 247 VKQTLLAYMNGSLPQIAVEYGRKTISAYERPTIDVVEQETMASVPTQQAA 296


>gi|221069303|ref|ZP_03545408.1| MotA/TolQ/ExbB proton channel [Comamonas testosteroni KF-1]
 gi|264676589|ref|YP_003276495.1| MotA/TolQ/ExbB proton channel [Comamonas testosteroni CNB-2]
 gi|220714326|gb|EED69694.1| MotA/TolQ/ExbB proton channel [Comamonas testosteroni KF-1]
 gi|262207101|gb|ACY31199.1| MotA/TolQ/ExbB proton channel [Comamonas testosteroni CNB-2]
          Length = 286

 Score =  249 bits (636), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 96/283 (33%), Positives = 159/283 (56%), Gaps = 2/283 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  +IG  +   CI G +   GG+  +L++  PFE+V + G  LG F+++N  KV+K + 
Sbjct: 1   MLVLIGYIVAFGCIFGMYVLHGGSVGVLVKALPFEMVTIGGGALGAFIVSNQPKVLKATA 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
            ++          +  Y +V+ LLY L+   +K      E+ ++DP +ST+F + P ++ 
Sbjct: 61  KAIPSALKPSRYNKARYMEVMALLYELLQKARKEGLMSIESDVEDPQSSTVFQNYPQLMA 120

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           ++ +  F+ DY+RM++ GN  S+EIE LMD EI+    E   P  A++ +  +LPA GI+
Sbjct: 121 DHHVVEFLTDYLRMMVSGNLNSHEIEALMDSEIEAHHAEAHAPVMALNRLAGALPAFGII 180

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG++  M  + Q P +LG  I  +L GT LGI+L+Y+L  P+ + ++       + +
Sbjct: 181 AAVLGVVNTMAFVGQPPAVLGGMIASALVGTFLGILLAYALVEPMAALLEQRAQDAAKEF 240

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
             +K  L+A M G  P  AIE+GRKVL  +ERP    +   V 
Sbjct: 241 ECIKATLLASMQGYNPGTAIEFGRKVLFSTERPGFLELESHVK 283


>gi|226193298|ref|ZP_03788908.1| chemotaxis protein MotA [Burkholderia pseudomallei Pakistan 9]
 gi|254298790|ref|ZP_04966241.1| chemotaxis protein MotA [Burkholderia pseudomallei 406e]
 gi|157808541|gb|EDO85711.1| chemotaxis protein MotA [Burkholderia pseudomallei 406e]
 gi|225934898|gb|EEH30875.1| chemotaxis protein MotA [Burkholderia pseudomallei Pakistan 9]
          Length = 278

 Score =  249 bits (635), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 102/277 (36%), Positives = 167/277 (60%)

Query: 9   ITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYK 68
           +T+L + GG+   GG+   L+QP EI+++ GAG+G F++ N +K IK +   L  +F   
Sbjct: 1   MTLLSVFGGYALAGGHLGALVQPVEILMIVGAGVGAFIIGNGIKTIKATLRVLPTLFKGS 60

Query: 69  ALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICD 128
              +D Y +++ LLY+L+   +K      E  IDDP  S IFT  P +L ++ +  F+ D
Sbjct: 61  KYNKDIYMELMALLYVLLAKARKEGTLTLEADIDDPEKSPIFTQYPKILADHHIVEFLTD 120

Query: 129 YMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAM 188
           Y+R+++ GN  ++EIE+LMDEEI+    E   P HA+  +G+++PA GIV A++G++  M
Sbjct: 121 YLRLMVGGNMNAFEIESLMDEEIETHHAEGEGPAHALMRVGDAMPAFGIVAAVMGVVHTM 180

Query: 189 GNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAY 248
            +  + P +LG  I  +L GT LGI+LSY L  PL S  +    +  +++  +K  ++A 
Sbjct: 181 ASADKPPAVLGAMIAQALVGTFLGILLSYGLIGPLASLAEQRVAESTKMFQCIKVTILAS 240

Query: 249 MNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           +NG  P +A+E+GRKVL  +ERPS   + + V +   
Sbjct: 241 LNGYAPAIAVEFGRKVLFSTERPSFAELEEHVRRVKA 277


>gi|265993414|ref|ZP_06105971.1| flagellar motor protein MotA [Brucella melitensis bv. 3 str. Ether]
 gi|262764284|gb|EEZ10316.1| flagellar motor protein MotA [Brucella melitensis bv. 3 str. Ether]
          Length = 296

 Score =  249 bits (635), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 154/290 (53%), Positives = 207/290 (71%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           +  I+GL IT+ C++GGF AMGG+  +LIQP+E +I+ GA LG F +ANP  ++KD+G +
Sbjct: 7   LGIIVGLVITLGCMLGGFIAMGGHVSVLIQPWEFIIILGAALGTFFVANPFSLVKDTGRA 66

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            +E F      Q  Y DVL +LY LM  L+  SRNE E HID+P  S IF + P+VL+  
Sbjct: 67  CMEAFTDAVPKQRDYLDVLGVLYSLMRELRAKSRNEVEVHIDNPKESPIFLAYPSVLKKE 126

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +LT FICDY R+IIVGN RSYEIE LMDEEI  I  +KLKPY A+  + E+LPA+GIV A
Sbjct: 127 DLTNFICDYCRLIIVGNVRSYEIEALMDEEIRTIARDKLKPYQAMITISEALPALGIVAA 186

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +L +IKAMG L QSP++LG  IG +L GT  GI  SY +  P+ ++IKSTR K +RLYI+
Sbjct: 187 VLSVIKAMGALDQSPEVLGHLIGAALVGTFAGIFFSYGVIGPIANKIKSTREKNNRLYIV 246

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK+ L+AYMNG++PQ+A+EYGRK +   ERP+I++V QE L     ++A+
Sbjct: 247 VKQTLLAYMNGSLPQIAVEYGRKTISAYERPTIDVVEQETLASVPTQQAA 296


>gi|261215634|ref|ZP_05929915.1| flagellar motor protein MotA [Brucella abortus bv. 3 str. Tulya]
 gi|260917241|gb|EEX84102.1| flagellar motor protein MotA [Brucella abortus bv. 3 str. Tulya]
          Length = 296

 Score =  249 bits (635), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 152/290 (52%), Positives = 207/290 (71%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           +  I+GL IT+ C++GGF AMGG+  +LIQP+E +I+ GA LG F +ANP  ++KD+G +
Sbjct: 7   LGIIVGLVITLGCMLGGFIAMGGHVSVLIQPWEFIIILGAALGTFFVANPFSLVKDTGRA 66

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            +E F      Q  Y DVL +LY LM  L+  SRNE E HID+P  S IF + P+VL+  
Sbjct: 67  CMEAFTDAVPKQRDYLDVLGVLYSLMRELRAKSRNEVEVHIDNPKESPIFLAYPSVLKKE 126

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +LT FICDY R+IIVGN RSYEI+ LMDEEI  I  +KLKPY A+  + E+LPA+GIV A
Sbjct: 127 DLTNFICDYCRLIIVGNVRSYEIDALMDEEIRTIARDKLKPYQAMITISEALPALGIVAA 186

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +L +IKAMG L QSP++LG  IG +L GT  GI  SY +  P+ ++IKSTR K +RLYI+
Sbjct: 187 VLSVIKAMGALDQSPEVLGHLIGAALVGTFAGIFFSYGVIGPIANKIKSTREKNNRLYIV 246

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK+ L+AYMNG++PQ+A+EYGRK +   ERP+I++V QE +     ++A+
Sbjct: 247 VKQTLLAYMNGSLPQIAVEYGRKTISAYERPTIDVVEQETMASVPTQQAA 296


>gi|34497481|ref|NP_901696.1| flagellar motor protein MotA [Chromobacterium violaceum ATCC 12472]
 gi|34103336|gb|AAQ59698.1| chemotaxis motA protein [Chromobacterium violaceum ATCC 12472]
          Length = 284

 Score =  249 bits (635), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 101/282 (35%), Positives = 166/282 (58%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   IG  I +  ++GGF A GG+   L+QP E+V++AGA +G F++AN    +K +  +
Sbjct: 1   MFVGIGYLIILGSVLGGFIAAGGHVAALMQPLEVVMIAGAAIGAFIVANGGAPLKATTKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F     G+  Y D+  LL+ ++  ++K      E  +++P  S +F+  PT++ ++
Sbjct: 61  LPTVFKGSPYGKAFYMDLFSLLFEILTKVRKEGLMSIEADVENPEASPVFSKYPTIMHDH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FICDY+R+++ GN  ++EIENLMD EI+   +E   P  A+  + + LPA GIV A
Sbjct: 121 HVVEFICDYLRLMVGGNLNAFEIENLMDVEIETHHHEGEVPVSAVKGLADGLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  M ++   P  LG  I  +L GT LGI+L+Y    PL + ++    +  R+Y  
Sbjct: 181 VMGVVHTMESVGAPPSELGMLIAHALVGTFLGILLAYGFVGPLGTILEHKLAEGTRVYQT 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQ 282
           +K  L+A +NG  PQVA+E+GRK L   +RPS + +   V Q
Sbjct: 241 IKVTLLASLNGYAPQVAVEFGRKALSSMDRPSFKELEDHVKQ 282


>gi|120613044|ref|YP_972722.1| MotA/TolQ/ExbB proton channel [Acidovorax citrulli AAC00-1]
 gi|120591508|gb|ABM34948.1| MotA/TolQ/ExbB proton channel [Acidovorax citrulli AAC00-1]
          Length = 286

 Score =  249 bits (635), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 103/283 (36%), Positives = 156/283 (55%), Gaps = 2/283 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  IIG  + + CI G F A GGN  +++   PFEIV + G  LG FV+ N  KV+K + 
Sbjct: 1   MFVIIGYLVCLGCIFGVFIAHGGNISVVLHALPFEIVTILGGALGAFVVNNQPKVLKATL 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
            +L   F      +  Y +++ +LY ++   +K      E  ++ P+ S IF   PTV  
Sbjct: 61  KALPMAFKGSKYTKARYMELMAMLYEILQKARKEGLMAIEKDVEAPHESEIFKKYPTVGT 120

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           ++ +  F  DY+RM++ GN  ++EIE+LMD EI+    E   P  A++ +  +LPA GIV
Sbjct: 121 DHHVIEFTTDYLRMMVSGNLNAHEIESLMDSEIETHHQEAHAPVAALARLAGALPAFGIV 180

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG++  MG++ Q P +LG  IG +L GT LGI+L+Y +  PL   ++       +  
Sbjct: 181 AAVLGVVNTMGSVGQPPSVLGGMIGSALVGTFLGILLAYGVVEPLGGLVEQKLEDAAKEL 240

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
             +K  L+A M G  P  AIE+GRKVL   +RPS   +   V 
Sbjct: 241 QCIKTTLLASMQGYNPATAIEFGRKVLFSGDRPSFSELESHVK 283


>gi|296103599|ref|YP_003613745.1| chemotaxis protein MotA [Enterobacter cloacae subsp. cloacae ATCC
           13047]
 gi|295058058|gb|ADF62796.1| chemotaxis protein MotA [Enterobacter cloacae subsp. cloacae ATCC
           13047]
          Length = 313

 Score =  249 bits (635), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 105/286 (36%), Positives = 172/286 (60%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
             I+G  + IL + GGF   GGN   L QP E++I+ GAG+G F++ N +K +K +G +L
Sbjct: 17  LVIVGYLVVILTVFGGFLLSGGNLMALFQPLELLIIGGAGVGAFIVGNNVKSLKSTGKAL 76

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
           ++IF  K   +  Y D++ L+++L+   +       E  I+DP NS IF++ P ++ +  
Sbjct: 77  VKIFVGKRYNKAVYMDLMALMFLLLSQSRVHGLMSLEKDIEDPQNSDIFSAYPRLMSDPM 136

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
           L  FI DY R++I G+  S+EIE LMDEEI+    E   P H+++ +G++ PA GIV A+
Sbjct: 137 LANFILDYFRLMIGGSMNSHEIEALMDEEIETCEEELEVPAHSLNTVGDAFPAFGIVAAV 196

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           +G++ A+G+  +    LG  IG +L GT LGI+++Y    PL + ++     Q ++   +
Sbjct: 197 MGVVNALGSADRPAAELGMLIGHALVGTFLGILIAYGFVLPLATLLRQKSSDQVKILQCI 256

Query: 242 KKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
           K  L++ +NG  PQ+A+E+GRK +  SERPS E + + V +   N 
Sbjct: 257 KVTLLSSLNGYAPQIAVEFGRKTIFTSERPSFEELEEHVREVKSNA 302


>gi|317491634|ref|ZP_07950070.1| chemotaxis protein MotA [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316921181|gb|EFV42504.1| chemotaxis protein MotA [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 297

 Score =  249 bits (635), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 96/287 (33%), Positives = 168/287 (58%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++G  +  + ++GG+  +GG+   L QP E++I+AGAG+G F++ N  K IK +  +
Sbjct: 1   MLILLGYAVVTIAVLGGYVIVGGHLGALYQPAELLIIAGAGIGAFIVGNNGKAIKATLRT 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L ++       +  Y DV+ L+Y+L+   ++      E  I++P  S +F++ P +L + 
Sbjct: 61  LPKLGRSAKYNKALYMDVMGLMYLLLAKARQQGMLTLERDIENPQESELFSNYPRILADK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FI DYMR+++ GN  ++EIE LMDEEI+    E   P  +++ +G+SLPA GIV A
Sbjct: 121 ILIEFITDYMRLMVSGNMNAFEIEALMDEEIETFESEAEGPADSLAMVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+ +  +    LG  I  ++ GT LGI+L+Y   +PL S ++    +  ++   
Sbjct: 181 VMGVVHALASADRPAAELGALIAHAMVGTFLGILLAYGFVSPLASLMRQNCAETVKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
           +K  L++ ++G  PQ+A+E+GRK L  +ERPS   + + V Q     
Sbjct: 241 IKTTLLSSLHGYAPQIAVEFGRKTLYSTERPSFMELEEHVRQVKSPA 287


>gi|260432133|ref|ZP_05786104.1| lateral flagellar motor protein MotA [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260415961|gb|EEX09220.1| lateral flagellar motor protein MotA [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 289

 Score =  248 bits (634), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 86/289 (29%), Positives = 160/289 (55%), Gaps = 3/289 (1%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  I+G+ +  + + GG+ A GG   I+++  PFE++++ GA +G F+++N +  +K + 
Sbjct: 1   MIGILGIVVIFVMVFGGYLAAGGKMAIILKSLPFEMMMIGGAAVGAFLISNDMPAVKHTV 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
             L ++F       D Y D+L LL+ L+   +     E E HI+DP +S++F + P +  
Sbjct: 61  KDLGKVFKGPKWKPDDYRDLLCLLFALIRMARSNPV-EVEGHIEDPASSSLFAAYPKIQA 119

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           + E    ICD MR   +     +++E ++++ ++   +  +   HA+  + + LPA+GIV
Sbjct: 120 DKEAVDLICDTMRSAAMNYDDPHQVEEVLEKRMEANFHHAMHSSHALQTVADGLPALGIV 179

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG+IK MG++ Q P++LG  IG +L GT LG+ L+Y L  P   ++K+   + +  Y
Sbjct: 180 AAVLGVIKTMGSIDQPPEVLGKLIGGALVGTFLGVFLAYGLVGPFAGKLKAVVEEDNHFY 239

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
            ++K+ L+A ++   P + IE GR+  P   RP    + + +       
Sbjct: 240 QLIKEVLVANLHQHNPAMCIEVGRQNTPTHNRPGFTELEEALKGIKQAA 288


>gi|254474842|ref|ZP_05088228.1| chemotaxis protein MotA [Ruegeria sp. R11]
 gi|214029085|gb|EEB69920.1| chemotaxis protein MotA [Ruegeria sp. R11]
          Length = 289

 Score =  248 bits (634), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 90/289 (31%), Positives = 159/289 (55%), Gaps = 3/289 (1%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  I+G+ +  + + GG+   GG   I+I+  PFE +++ GAG+G F+++N +  +K + 
Sbjct: 1   MLGIVGIVVIFVMVFGGYLLAGGKFAIIIKALPFEFMMIGGAGIGAFLISNDMGGVKHTL 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
             L ++F       D Y D+L LL+ L+   +  +  E E HI+DP NS++F   P +L 
Sbjct: 61  KDLGKVFKGPKWKPDDYRDLLCLLFSLIRIAR-ANPVEVEQHIEDPENSSVFNRYPKILA 119

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           + E    ICD MR   +     +++E ++++ I+  L+  +   HA+  + + LPA+GIV
Sbjct: 120 DKEAVNLICDTMRSASMNYDDPHQVEEVLEKRIEANLHHAMHSSHALQSLADGLPALGIV 179

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LGIIK MG++ Q P++LG  IG +L GT LG+ L+Y +  P   ++KS   +    Y
Sbjct: 180 AAVLGIIKTMGSIDQPPEVLGKLIGGALVGTFLGVFLAYGIVGPFAGKVKSVTEEDGHFY 239

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
            ++++ L+A ++     + IE GR+  P   RP    +   +     + 
Sbjct: 240 SLIREVLVANLHNHAAAICIEVGRQNTPSHIRPGFSELEDALKSVKQDA 288


>gi|304311520|ref|YP_003811118.1| Flagellar motor component [gamma proteobacterium HdN1]
 gi|301797253|emb|CBL45473.1| Flagellar motor component [gamma proteobacterium HdN1]
          Length = 284

 Score =  248 bits (633), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 103/282 (36%), Positives = 163/282 (57%), Gaps = 1/282 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  IIG+ + +  + GG+    G    + QP+E++I+ GA  G F++AN + VIK  G  
Sbjct: 1   MLKIIGIIVVLGSVAGGYVLSHGKLGAIWQPYELIIICGAAFGAFLIANGMPVIKGVGSG 60

Query: 61  LLEIFGYK-ALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLEN 119
           L  +F  K    +D+Y ++L LLY +    +K      E  I++P  S IF     V  N
Sbjct: 61  LGAVFSGKLHWHKDSYMELLSLLYEVFNKARKSGLISIEEDIENPAGSEIFMRYHHVNSN 120

Query: 120 NELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVG 179
            +L  FICDY+R+I  GN  + E+E+LMD+EI+  ++E  +P HA++ + + LP  GIV 
Sbjct: 121 AKLVDFICDYLRIIASGNLSANELESLMDQEIETAMHEATEPAHAVNRVADGLPGFGIVA 180

Query: 180 AILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYI 239
           A+LGI+  MG+L   P  LG  +G +L GT LGI+ +Y    PL++ ++    +  ++Y 
Sbjct: 181 AVLGIVITMGSLGGPPDELGHHVGAALVGTFLGILFAYGFLAPLSNAMEHDAKESMKIYE 240

Query: 240 IVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
             K  ++A +NG  PQ+A+E+GRKVLP  ERP+   +   + 
Sbjct: 241 CAKVCMLAMVNGIPPQLAVEFGRKVLPGGERPTFSELDSALR 282


>gi|260598379|ref|YP_003210950.1| flagellar motor protein MotA [Cronobacter turicensis z3032]
 gi|260217556|emb|CBA31776.1| Chemotaxis protein motA [Cronobacter turicensis z3032]
          Length = 285

 Score =  248 bits (633), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 100/278 (35%), Positives = 159/278 (57%)

Query: 11  ILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKAL 70
           +  + GG+   GG    L QP E++I+ GAG+G F++ N  K IK +  +L  +F     
Sbjct: 1   MGTVFGGYMMTGGELGALYQPAELIIIGGAGVGAFIVGNNGKAIKGTVKALPLLFRRSKY 60

Query: 71  GQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYM 130
            +  Y D++ LLY LM   ++      E  I++P  S IFTS P +L +N +  FI DY+
Sbjct: 61  TKSMYMDLMALLYRLMTKSRQQGMFSLERDIENPKESEIFTSYPRILADNTMLEFITDYL 120

Query: 131 RMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGN 190
           R+II GN  ++EIE LMDEEI+    E   P ++++ MG+SLPA GIV A++G++ A+ +
Sbjct: 121 RLIISGNMNTFEIEALMDEEIETHESEAEVPANSLALMGDSLPAFGIVAAVMGVVHALAS 180

Query: 191 LSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMN 250
             +    LG  I  ++ GT LGI+L+Y   +PL + ++    +  ++   VK  L++ +N
Sbjct: 181 ADRPAAELGALIAHAMVGTFLGILLAYGFVSPLATVLRQKSAETTKMMQCVKVTLLSSLN 240

Query: 251 GAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
           G  P +A+E+GRK L  SERPS   + + V       +
Sbjct: 241 GYAPPIAVEFGRKTLYSSERPSFTELDEHVRAVKSPNQ 278


>gi|326319082|ref|YP_004236754.1| flagellar motor stator protein MotA [Acidovorax avenae subsp.
           avenae ATCC 19860]
 gi|323375918|gb|ADX48187.1| flagellar motor stator protein MotA [Acidovorax avenae subsp.
           avenae ATCC 19860]
          Length = 286

 Score =  248 bits (633), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 103/283 (36%), Positives = 156/283 (55%), Gaps = 2/283 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  IIG  + + CI G F A GGN  +++   PFEIV + G  LG FV+ N  KV+K + 
Sbjct: 1   MFVIIGYIVCLGCIFGVFIAHGGNISVVLHALPFEIVTILGGALGAFVVNNQPKVLKATL 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
            +L   F      +  Y +++ +LY ++   +K      E  ++ P+ S IF   PTV  
Sbjct: 61  KALPMAFKGSKYTKARYMELMAMLYEILQKARKEGLMAIEKDVEAPHESEIFKKYPTVGH 120

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           ++ +  F  DY+RM++ GN  ++EIE+LMD EI+    E   P  A++ +  +LPA GIV
Sbjct: 121 DHHVIEFTTDYLRMMVSGNLNAHEIESLMDSEIETHHQEAHAPVAALARLAGALPAFGIV 180

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG++  MG++ Q P +LG  IG +L GT LGI+L+Y +  PL   ++       +  
Sbjct: 181 AAVLGVVNTMGSVGQPPSVLGGMIGSALVGTFLGILLAYGVVEPLGGLVEQKLEDAAKEL 240

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
             +K  L+A M G  P  AIE+GRKVL   +RPS   +   V 
Sbjct: 241 QCIKTTLLASMQGYNPATAIEFGRKVLFSGDRPSFAELEGHVK 283


>gi|54295158|ref|YP_127573.1| flagellar motor protein MotA [Legionella pneumophila str. Lens]
 gi|53754990|emb|CAH16478.1| hypothetical protein lpl2238 [Legionella pneumophila str. Lens]
          Length = 301

 Score =  248 bits (633), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 98/287 (34%), Positives = 164/287 (57%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  + +LC+ GGF   GG+   + QP E++I+ GA +G F++ N + V+K    S
Sbjct: 1   MLIIVGYIVILLCVFGGFSLTGGHLAAIFQPVELLIIGGAAIGSFIVGNNITVLKSVLKS 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L   F  +   +    D+L LLY L+   ++      EN ID+P  S IFT+ P ++ N+
Sbjct: 61  LPATFRGQKSAKQASSDLLSLLYHLLSKARQQGLMSLENDIDEPDKSPIFTNYPNLMSNH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FICDY+R+II  N + +++E+LMD EI+    E++ P +AI+ + +++PA GIV A
Sbjct: 121 HLIEFICDYLRLIITSNMQPFQLESLMDMEIESHHEEEMIPANAITKLADAMPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG++  M ++S  P  LG  I  +L GT LGI++ Y    P+ + ++    +   +   
Sbjct: 181 VLGVVHTMESISLPPSELGVLIAHALVGTFLGILIGYGFVGPIATAMEQNANQNQLMLQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
           +K  ++A ++   P +A E+GRKVL  S+RPS   +  E+      +
Sbjct: 241 IKVTILASLHNNPPIIATEFGRKVLFTSQRPSFNQLNDEIKNAKTAQ 287


>gi|160896053|ref|YP_001561635.1| MotA/TolQ/ExbB proton channel [Delftia acidovorans SPH-1]
 gi|160361637|gb|ABX33250.1| MotA/TolQ/ExbB proton channel [Delftia acidovorans SPH-1]
          Length = 286

 Score =  248 bits (633), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 95/283 (33%), Positives = 158/283 (55%), Gaps = 2/283 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  IIG  +   CI G +   GGN  ++++  PFE+V + G  +G F++ N  KV+K + 
Sbjct: 1   MLVIIGYIVAFGCIFGTYVLHGGNVQVILKALPFEMVTIGGGAIGAFIVCNQPKVLKATA 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
            ++  +       +  + +++ LLY ++   +K      E+ ++ P  S IFT  P +L 
Sbjct: 61  KAIPGVMKSSRYTKARFMELMALLYEILQKARKEGLMSIESDVEAPNESPIFTKYPELLA 120

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           ++ +  F+ DY+RM++ GN  S+EIE+LMD EI+    E   P +A++ +  +LPA GI+
Sbjct: 121 DHHVVEFLTDYLRMMVSGNLNSHEIESLMDSEIEAHHAEAHAPVNALTRLAGALPAFGII 180

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG++  MG++ Q P +LG  I  +L GT LGI+L+Y+L  P+   ++       +  
Sbjct: 181 AAVLGVVNTMGSVGQPPSVLGGMIASALVGTFLGILLAYALVEPMAGLVEQRAQDAAKEL 240

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
             +K  L+A M G  P  AIE+GRKVL  +ERP    +   V 
Sbjct: 241 ECIKTTLLASMQGYNPATAIEFGRKVLFSTERPGFLELETHVK 283


>gi|121611335|ref|YP_999142.1| MotA/TolQ/ExbB proton channel [Verminephrobacter eiseniae EF01-2]
 gi|121555975|gb|ABM60124.1| MotA/TolQ/ExbB proton channel [Verminephrobacter eiseniae EF01-2]
          Length = 286

 Score =  248 bits (633), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 99/284 (34%), Positives = 157/284 (55%), Gaps = 2/284 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M   IG  + + CI G +   GGN  ++++  P+E+VI+ G  LG FV+ N  KVIK + 
Sbjct: 1   MYVCIGYLLCLGCIFGAYILHGGNIGVILKALPYELVIIGGGALGAFVVNNQGKVIKATL 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
            ++   F      ++ Y +++ +L+ L+  +++    + E  +DDP  S IF+  PTV  
Sbjct: 61  RAIPSAFPASRYTKERYMELMAMLHELLQKIRREGLLKIEKDVDDPQGSPIFSKYPTVGR 120

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           +  +  F+ DY+RM++ GN  ++EIE LMD EID    E   P  A++ +  +LPA GIV
Sbjct: 121 DPRVIEFMTDYLRMMVSGNLNAHEIEALMDSEIDTYHQESHAPVAALARLAGALPAFGIV 180

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG++  M  + Q P +LG  IG +L GT LGI+L+Y +  P    ++       +  
Sbjct: 181 AAVLGVVNTMSAMGQPPAVLGAMIGSALLGTFLGILLAYGVVEPFGGLLEQRADDAGKEL 240

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQ 282
             +K  L+A M G  P  AIE+GRKVL  S RP    + + V +
Sbjct: 241 QCIKSTLLASMQGYNPATAIEFGRKVLFSSVRPGFLELEKHVKE 284


>gi|323258568|gb|EGA42234.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
          Length = 284

 Score =  247 bits (632), Expect = 9e-64,   Method: Composition-based stats.
 Identities = 98/277 (35%), Positives = 157/277 (56%)

Query: 12  LCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALG 71
             + GG+   GG+   L QP E+VI+ GAG+G F++ N  K IK +  ++  +F      
Sbjct: 1   GTVFGGYVMTGGHLGALYQPAELVIIGGAGIGAFIVGNNGKAIKGTMKAIPLLFRRSKYT 60

Query: 72  QDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMR 131
           +  Y D+L LLY LM   ++      E  I++P  S IF S P +L +  +  FI DY+R
Sbjct: 61  KSMYMDLLALLYRLMAKSRQQGMFSLERDIENPKESEIFASYPRILADTVMLDFIVDYLR 120

Query: 132 MIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNL 191
           +II GN   +EIE LMDEEI+    E   P ++++ +G+SLPA GIV A++G++ A+ + 
Sbjct: 121 LIISGNMNPFEIEALMDEEIETHESEAEVPANSLAMVGDSLPAFGIVAAVMGVVHALASA 180

Query: 192 SQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNG 251
            +    LG  I  ++ GT LGI+L+Y   +PL + ++    +  ++   VK  L++ +NG
Sbjct: 181 DRPAAELGALIAHAMVGTFLGILLAYGFISPLATVLRQKSAETTKMMQCVKITLLSNLNG 240

Query: 252 AIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
             P +A+E+GRK L  SERPS   + + V    +  +
Sbjct: 241 YAPPIAVEFGRKTLYSSERPSFIELEEHVRAVRNPNQ 277


>gi|82776485|ref|YP_402834.1| flagellar motor protein MotA [Shigella dysenteriae Sd197]
 gi|309789306|ref|ZP_07683897.1| chemotaxis protein motA [Shigella dysenteriae 1617]
 gi|81240633|gb|ABB61343.1| proton conductor component of motor [Shigella dysenteriae Sd197]
 gi|308922841|gb|EFP68357.1| chemotaxis protein motA [Shigella dysenteriae 1617]
          Length = 295

 Score =  247 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 101/288 (35%), Positives = 167/288 (57%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++G  + +  + GG+   GG+   L QP E+VI+AGAG+G F++ N  K IK +  +
Sbjct: 1   MLILLGYLVVLGTVFGGYLMTGGSLGALYQPAELVIIAGAGIGSFIVGNNGKAIKGTLKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y D+L LLY LM   ++      E  I++P  S IF S P ++ ++
Sbjct: 61  LPLLFRRSKYTKAMYMDLLALLYRLMAKSRQMGMFSLERDIENPRESEIFASYPRIIADS 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FI DY+R+II G+  ++EIE LMDEEI+    E   P ++++ +G+SLPA GIV A
Sbjct: 121 VMLDFIVDYLRLIISGHMNTFEIEALMDEEIEPHESEAEVPANSLALVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+G+  +    LG  I  ++ GT LGI+L+Y   +PL S ++    +  ++   
Sbjct: 181 VMGVVHALGSADRPAAELGALIAHAMVGTFLGILLAYGFISPLASVLRQKSAETSKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
           VK  L++ +NG  P +A+E+GRK L  SER S   + + V    + ++
Sbjct: 241 VKVTLLSNLNGYAPPIAVEFGRKTLYSSERLSFIELEEHVRAVKNPQQ 288


>gi|110632664|ref|YP_672872.1| flagellar motor protein MotA [Mesorhizobium sp. BNC1]
 gi|110283648|gb|ABG61707.1| flagellar motor protein MotA [Chelativorans sp. BNC1]
          Length = 295

 Score =  247 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 149/295 (50%), Positives = 211/295 (71%), Gaps = 5/295 (1%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++GL +T+ C+IGGF AMGG+  +LIQP+E+VI+ GA LG F++ANP+  +KD+G +
Sbjct: 1   MGILLGLVVTLGCVIGGFMAMGGHLEVLIQPWELVIIGGAALGTFLVANPMSTVKDAGKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            LE F ++   +  Y + L +L+ LM  L+  SR+E E HID+P  S IF + PTVL+N 
Sbjct: 61  CLEAFKHQVPKETEYLETLGVLHSLMRELRSKSRSEVEAHIDNPEESAIFQAFPTVLKNY 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +LT FICDY R+II+GNAR +EIE LMDEEI  I  +KLK YHA+  + + LPA+GIV A
Sbjct: 121 DLTHFICDYCRLIIIGNARPFEIEALMDEEIQTIRRDKLKSYHALQAVADGLPALGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKAMG L QSP++LG  +G +L GT LGI LSY++  P+ +++K  R K++RLY+I
Sbjct: 181 VLGVIKAMGALDQSPEVLGALVGAALVGTFLGIFLSYAVIGPIATKVKIVREKKNRLYVI 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEV-----LQYNHNKKAS 290
           VK+ L+AYMNG++PQVA+E+GRK +   +RPSI+ V Q+            KKA+
Sbjct: 241 VKQTLLAYMNGSLPQVALEFGRKTISAYDRPSIDAVEQKTLGQAPAGAAPEKKAA 295


>gi|307611159|emb|CBX00803.1| hypothetical protein LPW_25071 [Legionella pneumophila 130b]
          Length = 301

 Score =  247 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 99/287 (34%), Positives = 164/287 (57%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  + +LC+ GGF   GG+   + QP E++I+ GA +G F++ N + V+K    S
Sbjct: 1   MLIIVGYIVILLCVFGGFSLTGGHLAAIFQPVELLIIGGAAIGSFIVGNNITVLKSVLKS 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L   F  +   +    D+L LLY L+   ++      EN ID+P  S IFTS P ++ N+
Sbjct: 61  LPATFRGQKSAKQASSDLLSLLYHLLSKARQQGLMSLENDIDEPDKSPIFTSYPNLMSNH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FICDY+R+II  N + +++E+LMD EI+    E++ P +AI+ + +++PA GIV A
Sbjct: 121 HLIEFICDYLRLIITSNMQPFQLESLMDMEIESHHEEEMIPANAITKLADAMPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG++  M ++S  P  LG  I  +L GT LGI++ Y    P+ + ++    +   +   
Sbjct: 181 VLGVVHTMESISLPPSELGVLIAHALVGTFLGILIGYGFVGPIATAMEQNANQNQLMLQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
           +K  ++A ++   P +A E+GRKVL  S+RPS   +  E+      +
Sbjct: 241 IKVTILASLHNNPPIIATEFGRKVLFTSQRPSFNQLNDEIKNAKTAQ 287


>gi|319405394|emb|CBI79013.1| Chemotaxis protein motA [Bartonella sp. AR 15-3]
          Length = 291

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 138/290 (47%), Positives = 198/290 (68%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  IIGL I    I+GG+ AMGG+  +LIQP+E VI+ G+ +G F++ANP   IKD+  +
Sbjct: 1   MGVIIGLVIIFGSILGGYVAMGGHIDVLIQPWEFVIILGSAIGTFIVANPFSAIKDTLKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            +E        Q  +  +L LLY+LM  ++  SR+E ENHID+P  ST+F   P +L++ 
Sbjct: 61  TIEAMKDAVPKQKDFLSLLGLLYVLMREMRSKSRSEMENHIDNPKESTLFQQYPLILKDE 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            LT FICDY R+I++GN R +EIE LMDEEI  I Y+  KPY A+  M ++LPA+GIV A
Sbjct: 121 SLTNFICDYCRLIVMGNTRHFEIEALMDEEIHTISYDSQKPYQAMQTMADALPALGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG++KAMG +S+ P++LG  IG +L GT  GI  +Y +  PL S+IK+ R K+ R+YI+
Sbjct: 181 VLGVVKAMGAISEPPEVLGHLIGAALVGTFAGIFFAYGIFGPLASKIKTVRNKKVRIYIV 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK+ L+AYMNGAIPQ+AIEYGRK +   +RP+I+++ Q  +     +K +
Sbjct: 241 VKQTLLAYMNGAIPQIAIEYGRKTISAKDRPTIDVMEQHAIAGQGTEKEA 290


>gi|148359857|ref|YP_001251064.1| chemotaxis motility protein A [Legionella pneumophila str. Corby]
 gi|296107907|ref|YP_003619608.1| chemotaxis protein MotA [Legionella pneumophila 2300/99 Alcoy]
 gi|148281630|gb|ABQ55718.1| chemotaxis (motility protein A) transmembrane [Legionella
           pneumophila str. Corby]
 gi|295649809|gb|ADG25656.1| chemotaxis protein MotA [Legionella pneumophila 2300/99 Alcoy]
          Length = 301

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 99/287 (34%), Positives = 164/287 (57%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  + +LC+ GGF   GG+   + QP E++I+ GA +G F++ N + V+K    S
Sbjct: 1   MLIIVGYIVILLCVFGGFSLTGGHLAAIFQPVELLIIGGAAIGSFIVGNNITVLKSVLKS 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L   F  +   +    D+L LLY L+   ++      EN ID+P  S IFTS P ++ N+
Sbjct: 61  LPATFRGQKSAKQASSDLLSLLYHLLSKARQQGLMSLENDIDEPDKSPIFTSYPNLMSNH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FICDY+R+II  N + +++E+LMD EI+    E++ P +AI+ + +++PA GIV A
Sbjct: 121 HLIEFICDYLRLIITSNMQPFQLESLMDMEIESHHEEEMIPANAITKLADAMPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG++  M ++S  P  LG  I  +L GT LGI++ Y    P+ + ++    +   +   
Sbjct: 181 VLGVVHTMESISLPPSELGVLIAHALVGTFLGILIGYGFVGPIATAMEQNANQNQLMLQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
           +K  ++A ++   P +A E+GRKVL  S+RPS   +  E+      +
Sbjct: 241 IKVTILASLHNNPPIIATEFGRKVLFTSQRPSFNQLNDEIKNAKTAQ 287


>gi|284007194|emb|CBA72483.1| flagellar motor protein MotA [Arsenophonus nasoniae]
          Length = 289

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 96/278 (34%), Positives = 160/278 (57%)

Query: 9   ITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYK 68
           + I  ++GG+  +GG+   L QP E +I+ GAGLGGF++AN  K IK +   L  +    
Sbjct: 1   MVIGAVLGGYLLVGGHLSALYQPAEFLIIFGAGLGGFIVANNGKAIKSTLRVLPRLLTSS 60

Query: 69  ALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICD 128
              +  Y D++ L + L+   ++      E  I+DP  S IF+  P +L +  L +F+ D
Sbjct: 61  RYNKSIYMDLMALQFRLLTKSRQAGVLSLERDIEDPEQSDIFSQYPKLLSDPHLMSFLTD 120

Query: 129 YMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAM 188
           YMR++I GN  ++EIE LMDEEI    +E   P  ++S +G+SLPA GIV A++G++ A+
Sbjct: 121 YMRLMITGNMNAHEIEALMDEEIATFEHEAEVPAVSLSMLGDSLPAFGIVAAVMGVVHAL 180

Query: 189 GNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAY 248
            +  +    +G  IG ++ GT LGI+L+Y   +PL + ++    +Q ++   +K  L++ 
Sbjct: 181 ASADRPAGEMGILIGNAMVGTFLGILLAYGFISPLANLVRQKSHQQIKMMECIKVTLLSS 240

Query: 249 MNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHN 286
           ++G  PQ+A+E+GRK L L +RP    +   V    + 
Sbjct: 241 ISGYAPQIAVEFGRKTLFLDDRPFFNELEDHVRSMKNP 278


>gi|260222451|emb|CBA32027.1| Chemotaxis protein motA [Curvibacter putative symbiont of Hydra
           magnipapillata]
          Length = 285

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 99/284 (34%), Positives = 159/284 (55%), Gaps = 2/284 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  IIG  + + C+ G F   GGN  +++   P+E++ + GA +G F+  N +KVIK + 
Sbjct: 1   MFVIIGWLVCLGCVFGVFIIHGGNISVILHALPWEMLTIGGATVGAFLANNQMKVIKKTV 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
             L   F      +  Y ++L LL+ ++   +K      E  +++P  S IF   PTV  
Sbjct: 61  AGLGACFKGSKYTKARYMELLALLFDILQKARKEGLMAIEKDVEEPEQSEIFKKYPTVGS 120

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           ++ +  FI DY+RM++ GN  ++EIE++MD EI+   +E+     AI  +   LPA GIV
Sbjct: 121 DHHVIEFITDYLRMMVSGNLNAHEIESIMDSEIETHHHEEHAAVAAIQRIAGGLPAFGIV 180

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG++  MG++ Q P +LG  IG +L GT LGI+L+Y+   PL   ++    +  + +
Sbjct: 181 AAVLGVVNTMGSVGQPPAVLGGMIGSALVGTFLGILLAYAFAEPLAGLLEQKVEEGSKEF 240

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQ 282
             +K  L+A M G  P  AIE+GRKVL  +ERP+   +   V +
Sbjct: 241 QCIKTTLLASMQGYNPSTAIEFGRKVLYSTERPTFGELEAHVKK 284


>gi|52842528|ref|YP_096327.1| flagellar motor protein MotA [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|52629639|gb|AAU28380.1| chemotaxis (motility protein A) transmembrane [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
          Length = 301

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 98/287 (34%), Positives = 163/287 (56%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  + +LC+ GGF   GG+   + QP E++I+ GA +G F++ N + V+K    S
Sbjct: 1   MLIIVGYIVILLCVFGGFSLTGGHLAAIFQPVELLIIGGAAMGSFIVGNNITVLKSVLKS 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L   F  +   +    D+L LLY L+   ++      EN ID+P  S IFT  P ++ N+
Sbjct: 61  LPATFRGQKSAKQASNDLLSLLYHLLSKARQQGLMSLENDIDEPDKSPIFTGYPNLMSNH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FICDY+R+II  N + +++E+LMD EI+    E++ P +AI+ + +++PA GIV A
Sbjct: 121 HLIEFICDYLRLIITSNMQPFQLESLMDMEIESHHEEEMIPANAITKLADAMPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG++  M ++S  P  LG  I  +L GT LGI++ Y    P+ + ++    +   +   
Sbjct: 181 VLGVVHTMESISLPPSELGVLIAHALVGTFLGILIGYGFVGPIATAMEQNANQNQLMLQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
           +K  ++A ++   P +A E+GRKVL  S+RPS   +  E+      +
Sbjct: 241 IKVTILASLHNNPPIIATEFGRKVLFTSQRPSFNQLNDEIKNAKTAQ 287


>gi|54298208|ref|YP_124577.1| flagellar motor protein MotA [Legionella pneumophila str. Paris]
 gi|53751993|emb|CAH13419.1| hypothetical protein lpp2266 [Legionella pneumophila str. Paris]
          Length = 301

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 98/287 (34%), Positives = 164/287 (57%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  + +LC+ GGF   GG+   + QP E++I+ GA +G F++ N + V+K    +
Sbjct: 1   MLIIVGYIVILLCVFGGFSLTGGHLAAIFQPVELLIIGGAAIGSFIVGNNITVLKSVLKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L   F  +   +    D+L LLY L+   ++      EN ID+P  S IFTS P ++ N+
Sbjct: 61  LPATFRGQKSAKQASSDLLSLLYHLLSKARQQGLMSLENDIDEPDKSPIFTSYPNLMSNH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FICDY+R+II  N + +++E+LMD EI+    E++ P +AI+ + +++PA GIV A
Sbjct: 121 HLIEFICDYLRLIITSNMQPFQLESLMDMEIESHHEEEMIPANAITKLADAMPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG++  M ++S  P  LG  I  +L GT LGI++ Y    P+ + ++    +   +   
Sbjct: 181 VLGVVHTMESISLPPSELGVLIAHALVGTFLGILIGYGFVGPIATAMEQNANQNQLMLQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
           +K  ++A ++   P +A E+GRKVL  S+RPS   +  E+      +
Sbjct: 241 IKVTILASLHNNPPIIATEFGRKVLFTSQRPSFNQLNDEIKNAKTAQ 287


>gi|254418967|ref|ZP_05032691.1| transporter, MotA/TolQ/ExbB proton channel family protein
           [Brevundimonas sp. BAL3]
 gi|196185144|gb|EDX80120.1| transporter, MotA/TolQ/ExbB proton channel family protein
           [Brevundimonas sp. BAL3]
          Length = 288

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 88/284 (30%), Positives = 165/284 (58%), Gaps = 2/284 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  IIG+ +    + G +   GG   +++   P E++ + GAG+  F+++N + V+K S 
Sbjct: 1   MFQIIGIVLLFGLVFGSYAISGGKFEVIMHAAPHELMAIGGAGIAAFLISNSMTVVKGSL 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
             L + F      +  Y D+L LL+ L   +K       E+HI+ P  STIF   P VL+
Sbjct: 61  AGLGKAFAGPKWKKQDYKDLLSLLFQLTKTMKSKGVVALESHIEKPKESTIFQKYPKVLK 120

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           ++    FICD +RM+ +     +++E+ M+++++   +E L   HA+ ++ ++LPA+GIV
Sbjct: 121 DHFAVDFICDTLRMMTMNLEDPHQVEDAMEKQLEKHHHEHLDNAHALQNLADALPALGIV 180

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG+IK MG++++ P++LG  IG +L GT +G+ L+Y L  P  +++ S   ++   Y
Sbjct: 181 AAVLGVIKTMGSITEPPEVLGGMIGGALVGTFMGVFLAYGLVGPFAARLTSIINEEAAYY 240

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQ 282
            +++  LIA+++G   Q+++E GR  +P + +PS   + + +  
Sbjct: 241 KMIQSVLIAHLHGNAAQISVEIGRGDIPSASQPSFAEMEEALNN 284


>gi|83311677|ref|YP_421941.1| flagellar motor component [Magnetospirillum magneticum AMB-1]
 gi|82946518|dbj|BAE51382.1| Flagellar motor component [Magnetospirillum magneticum AMB-1]
          Length = 286

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 93/282 (32%), Positives = 167/282 (59%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  IIG+ +T + +IGG+ A GG+  +L QPFE +I+ GA +G  ++ NP  +I     +
Sbjct: 1   MFAIIGIVVTFVSVIGGYAAPGGHLSVLFQPFEWLIIIGAAVGSLLLGNPKTIIIGISKN 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F     G+D Y ++L +LY +    K       E+H++ P  S +F   P    ++
Sbjct: 61  LGLVFKGAHHGKDDYIELLSVLYAVFKLAKTKGDLALESHVEKPDESPLFGKFPKFSSDH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
              TF CDY+R++ +G + ++E+E+++D E++       +  HA++ MG+++PA+GIV A
Sbjct: 121 HTRTFFCDYLRLLTLGTSNAHELESIIDGELEAHHKHYHEIAHAVNLMGDAMPALGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+I  MG++++ P++LG  IG +L GT  G+++SY+   P+   ++      H  ++ 
Sbjct: 181 VLGVIHTMGSITEPPEVLGHLIGAALVGTFSGVLISYAFIAPIARNMQLCFDSDHYYFLA 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQ 282
           +K  L+ +M G  PQV+IE+ RK+LP   RP+ + + + V  
Sbjct: 241 IKAGLLGHMQGYAPQVSIEFARKILPDELRPTFQELEETVTN 282


>gi|238796915|ref|ZP_04640419.1| hypothetical protein ymoll0001_33250 [Yersinia mollaretii ATCC
           43969]
 gi|238719175|gb|EEQ10987.1| hypothetical protein ymoll0001_33250 [Yersinia mollaretii ATCC
           43969]
          Length = 297

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 99/290 (34%), Positives = 169/290 (58%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  IIG  I IL + GGF   GG    L QP E++I+ GAG+G F++ N  K I  +  +
Sbjct: 1   MLVIIGYLIVILTVFGGFSLSGGVLGALYQPTELLIIGGAGIGAFIVGNNGKSINATLKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y D++ ++Y+L+   ++      E  I+DP NS IF++ P +L ++
Sbjct: 61  LPHLFRGSHYTKVLYMDLMAMMYLLLNKGRQNGLMALEQDIEDPKNSAIFSAYPRLLADS 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  F+ DY+R+++ G+  ++EIE LMDEEI+   +E   P  +++ +G+ LPA GIV A
Sbjct: 121 ALMNFVIDYLRLMVSGSMNAFEIEALMDEEIETCEHEHEVPAQSLNEIGDGLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+    +    LG  I  ++ GT LGI+L+Y    PL S ++    +Q ++   
Sbjct: 181 VMGVVNALAAADRPAAELGELIAHAMVGTFLGILLAYGFVLPLASLLRQKSSEQIKILQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           ++  L++ MNG  PQ+A+E+GRK+L  +ERP+   + + V +   +  +S
Sbjct: 241 IRVTLLSSMNGYAPQIAVEFGRKILFSTERPTFIELEEHVREVKSSANSS 290


>gi|83859896|ref|ZP_00953416.1| flagellar motor protein [Oceanicaulis alexandrii HTCC2633]
 gi|83852255|gb|EAP90109.1| flagellar motor protein [Oceanicaulis alexandrii HTCC2633]
          Length = 288

 Score =  246 bits (629), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 91/285 (31%), Positives = 165/285 (57%), Gaps = 2/285 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILI--QPFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  IIG+ +    + GGF   GG+  I++   PFE++++ GA +G F+++N L  I  + 
Sbjct: 1   MFQIIGIVVLFGMVFGGFTLAGGHFDIIVAALPFELMMIGGAAIGAFLISNSLGTITKTA 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
               ++      G+  Y D+L LL+ L   +K       E+HI++P++S+IF++ P +++
Sbjct: 61  GDFAKLISGPKWGKQDYMDLLTLLFQLTKTMKTKGVIALESHIENPHDSSIFSAYPKIMK 120

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           ++    FICD +RM+ +     +++E+ M+++I+   +E   P HA+  M ++LPA+GIV
Sbjct: 121 DHFAIDFICDTLRMMTMNLEDPHQVEDAMEKQIEKHHHEAATPAHALQSMADALPALGIV 180

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LGIIK MG +   P +LG  IG +L GT LG+ L+Y L  P  +++     ++   Y
Sbjct: 181 AAVLGIIKTMGAIDSPPTVLGAKIGSALVGTFLGVFLAYGLVGPFAARLNEIYEEEGAFY 240

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQY 283
            I++  L+A+++G   Q+++E GR  +P S +PS   + +     
Sbjct: 241 KIIQAVLVAHLHGNAAQISVEIGRGNVPSSFQPSFAELEEASSNA 285


>gi|329888438|ref|ZP_08267036.1| chemotaxis protein motA [Brevundimonas diminuta ATCC 11568]
 gi|328846994|gb|EGF96556.1| chemotaxis protein motA [Brevundimonas diminuta ATCC 11568]
          Length = 289

 Score =  246 bits (628), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 94/285 (32%), Positives = 164/285 (57%), Gaps = 2/285 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILI--QPFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  IIG+ +    + G F   GG    ++   P+E++ + GAG+  F+++N L VIK + 
Sbjct: 1   MFQIIGIVMLFAMVFGSFLLHGGKMATILYSLPYELMAIFGAGIAAFLISNSLPVIKATL 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
             L + F      +  Y D+L LL+ L   +K       E+HI+ P  S IF   P VL+
Sbjct: 61  GGLGKCFAGPKWKKQDYKDLLSLLFQLTKTMKSKGVIALESHIEKPAESAIFQKYPKVLK 120

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           ++  T FICD +RM+ +     ++IE+ M+++++   +E L P HA+  + + LPA+GIV
Sbjct: 121 DHFATDFICDTLRMMTMNLEDPHQIEDAMEKQLEKHHHEALAPAHALQTLADGLPALGIV 180

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LGIIK MG++++ P++LG  IG +L GT LG+ L+Y L  P  S++ +   ++   Y
Sbjct: 181 AAVLGIIKTMGSITEPPEVLGGMIGGALVGTFLGVFLAYGLVGPFASRLNAIVEEEGAYY 240

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQY 283
            I++  L+A+++G   Q+++E GR  +P + +PS   + + +   
Sbjct: 241 KIIQSVLVAHLHGNAAQISVEIGRGDIPSTAQPSFTEMEEALAAA 285


>gi|110677677|ref|YP_680684.1| flagellar motor protein MotA [Roseobacter denitrificans OCh 114]
 gi|109453793|gb|ABG29998.1| chemotaxis MotA protein [Roseobacter denitrificans OCh 114]
          Length = 289

 Score =  246 bits (628), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 86/289 (29%), Positives = 155/289 (53%), Gaps = 3/289 (1%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  IIG+      + GG+ A GG   I+ +  PFE+ ++ GA +G F+++N +  IK + 
Sbjct: 1   MIGIIGIITVFAMVFGGYLAAGGKMGIIFKALPFEMTMIGGAAVGAFLISNDMSAIKHTM 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
             L  +F       + Y D+L LL+ L+   +  +    E HI+ P  S+IF+    +L+
Sbjct: 61  RDLGRVFKGPKWSHEDYKDLLCLLFELIRLAR-QNPVAIEEHIEAPEESSIFSKYEKILK 119

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           + E    ICD +R   +     +++E ++++ ++  ++  +   HA+  + + LPA+GIV
Sbjct: 120 DKEAVALICDTLRSASMNYDDPHQVEEVLEKRMEANMHHAMHSSHALQTVADGLPALGIV 179

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LGIIK MG++ Q P++LG  IG +L GT LG+ L+Y    P  +++KS   +    Y
Sbjct: 180 AAVLGIIKTMGSIDQPPEVLGKLIGGALVGTFLGVFLAYGFVGPFAAKVKSVTEEDGHFY 239

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
            ++++ L+A ++     + IE GR+  P   RPS   + + +     N 
Sbjct: 240 QLIREVLVANLHAHATNICIEVGRQNTPSHHRPSFAELEEALKSVKQNA 288


>gi|163732482|ref|ZP_02139927.1| flagellar motor protein MotA [Roseobacter litoralis Och 149]
 gi|161393842|gb|EDQ18166.1| flagellar motor protein MotA [Roseobacter litoralis Och 149]
          Length = 289

 Score =  246 bits (627), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 85/289 (29%), Positives = 154/289 (53%), Gaps = 3/289 (1%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  IIG+      + GG+ A GG   I+ +  PFE+ ++ GA +G F+++N +  IK + 
Sbjct: 1   MIGIIGIITVFAMVFGGYLAAGGKMGIIFKALPFEMTMIGGAAVGAFLISNDMSAIKHTM 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
             L  +F         Y D+L LL+ L+   +  +    E HI+ P  S+IF+    +++
Sbjct: 61  RDLGRVFKGPKWSHSDYKDLLCLLFELIRLAR-QNPVAIEEHIESPEESSIFSKYEKIVK 119

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           + E    ICD +R   +     +++E ++++ ++  ++  +   HA+  + + LPA+GIV
Sbjct: 120 DKEAVALICDTLRSASMNYDDPHQVEEVLEKRMEANMHHAMHSSHALQTVADGLPALGIV 179

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LGIIK MG++ Q P++LG  IG +L GT LG+ L+Y    P  +++KS   +    Y
Sbjct: 180 AAVLGIIKTMGSIDQPPEVLGKLIGGALVGTFLGVFLAYGFVGPFAAKVKSVTEEDGHFY 239

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
            ++++ L+A ++     + IE GR+  P   RPS   + + +     N 
Sbjct: 240 QLIREVLVANLHAHATNICIEVGRQNTPSHHRPSFAELEEALKSVKQNA 288


>gi|83648053|ref|YP_436488.1| flagellar motor protein [Hahella chejuensis KCTC 2396]
 gi|83636096|gb|ABC32063.1| Flagellar motor component [Hahella chejuensis KCTC 2396]
          Length = 283

 Score =  246 bits (627), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 96/282 (34%), Positives = 156/282 (55%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G+ + +  ++GG+    G    L QPFE++I+ GA  G F+++NP KVIK    +
Sbjct: 1   MLLILGVIVVLASVLGGYVLSHGELAALWQPFELIIICGAAFGAFLISNPFKVIKQILHT 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           + ++       +  Y D+L L+Y L    ++      E  +DDP NS IF   P ++  +
Sbjct: 61  IPKMIMGSPFNRVVYMDLLSLMYDLFDKARRSGVMAIEADVDDPLNSEIFNRYPAIVRMD 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +L  FI DY+R++  GN   +E+E LMD E++  + E  KP  A++ + ++LP  GIV A
Sbjct: 121 KLRDFITDYLRIVSTGNMAPHELEGLMDMELETRMQELEKPADAVNRVADALPGFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGI+  M +L   P  LG  +  +L GT LGI+ +Y    P +  + +   ++ + Y  
Sbjct: 181 VLGIVITMKSLGGPPDELGVHVAAALVGTFLGILAAYGFVGPASHAMHNLAAQEIKAYEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQ 282
           VK +++A M G  PQ+AIE+GRK L    RPS + +   V  
Sbjct: 241 VKVSILATMTGLAPQLAIEFGRKALNSDVRPSFQELNDYVRS 282


>gi|149377735|ref|ZP_01895469.1| Flagellar motor component [Marinobacter algicola DG893]
 gi|149357961|gb|EDM46449.1| Flagellar motor component [Marinobacter algicola DG893]
          Length = 283

 Score =  246 bits (627), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 101/282 (35%), Positives = 163/282 (57%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  IIG  I I  ++GG+   GGN  +L QP EI+I+ GA +G F++ANPL  IK+    
Sbjct: 1   MLLIIGAVIVIASVLGGYVLHGGNLLVLWQPTEILIIGGAAVGSFIIANPLHTIKEVAKG 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +L         +  Y D+L L+Y +    +K      E  ID+P +S IF+  P ++++ 
Sbjct: 61  VLNQLTGSPYNKSFYMDLLSLMYEIFDKSRKQGVMAIEEDIDNPESSQIFSRYPAIIKSK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FI DY+R+I  GN  ++E+E +M+ EI+   +E  +P HA++ + ++LP +GIV A
Sbjct: 121 YLLAFITDYLRIISSGNMATHELEGMMENEIESRQHELEEPAHAVNKIADALPGLGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGI+  M  LS+ P+ +G ++  +L GT LGI + Y    P +  ++ T   + + Y  
Sbjct: 181 VLGIVITMNFLSEGPERIGLSVAAALVGTFLGIWMGYGFVGPTSIAMEHTAKYEIKAYEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQ 282
            K A++A ++G  PQ+AIE+GRK LP  +RP  + +   V  
Sbjct: 241 AKSAIVATVSGQAPQMAIEFGRKALPSDKRPGFQELNDHVRS 282


>gi|92114148|ref|YP_574076.1| chemotaxis MotA protein [Chromohalobacter salexigens DSM 3043]
 gi|91797238|gb|ABE59377.1| chemotaxis MotA protein [Chromohalobacter salexigens DSM 3043]
          Length = 293

 Score =  246 bits (627), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 93/288 (32%), Positives = 159/288 (55%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++G  + I  I GG+  +GG+   L QP EI+++ GA +G F+ AN  K IK +  +
Sbjct: 1   MLILLGYLVVIASIGGGYTLVGGHFGALFQPSEILMIVGAAVGAFIAANNGKSIKATLRT 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
             ++       +  Y +++ L Y L+   ++      E  ID P +S IF+  P +  + 
Sbjct: 61  FSKLKRTTKYNKTMYMELMALQYRLLTKARRDGMLAIERDIDAPEDSAIFSDYPKIANDP 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FI DY+R+++ GN   +EI+ LM+ EID   +E   P HA+  +G+ LPA GIV A
Sbjct: 121 LIMAFITDYLRLMVSGNMDPFEIDTLMEHEIDTFQHEAEIPAHALHSVGDGLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+G   Q    +G  I  +L GT LGI+L+Y    P++ +++    +  ++   
Sbjct: 181 VMGVVHALGAADQGAAAMGQMIAQALVGTFLGILLAYGFVLPVSQRLQLQVTEAIKMLQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
           V+  L+A +NG  PQ+A+E+GRK L  +ERPS   + + V     + +
Sbjct: 241 VRVTLMASLNGMAPQLAVEFGRKALFTAERPSFTELEEHVRSEGSSTR 288


>gi|170748395|ref|YP_001754655.1| MotA/TolQ/ExbB proton channel [Methylobacterium radiotolerans JCM
           2831]
 gi|170654917|gb|ACB23972.1| MotA/TolQ/ExbB proton channel [Methylobacterium radiotolerans JCM
           2831]
          Length = 287

 Score =  245 bits (626), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 99/286 (34%), Positives = 154/286 (53%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  I   C+ G + AMGG+  +L QPFE VI+ GA +G FV+ N   V+K     
Sbjct: 1   MRLIVGTLIVFACVFGSYAAMGGHLLVLWQPFEFVIILGAAIGAFVIGNTGPVLKAVPAM 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +       Q +Y ++L + Y L    K+      E HI+DP  ST+F + PT   N+
Sbjct: 61  LGTLVKGPKYNQQSYVELLGMQYSLFRLAKQKGSMALEPHIEDPGESTLFNAFPTFAANH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+CDYMRM+ +G    +EI+ LMDEE++    E+ +   A+  + +  PA+GIV A
Sbjct: 121 HAVEFVCDYMRMVTLGANNVHEIDALMDEELETHHQEQERVVSAMQSLADGTPALGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IK MG + + P++LG  IG +L GT  G+ ++Y    P+   +KS    + + Y+ 
Sbjct: 181 VLGVIKTMGAIKEPPEVLGHLIGGALVGTFFGVFVAYGFFGPMAQSLKSLFEAESKYYLS 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHN 286
           +K  L+A++ G  P +A+E+ RK L    RP+   V          
Sbjct: 241 LKAGLLAHIAGQPPVMAVEFARKALMSDVRPTFNEVEAATAALPAQ 286


>gi|260429107|ref|ZP_05783084.1| lateral flagellar motor protein MotA [Citreicella sp. SE45]
 gi|260419730|gb|EEX12983.1| lateral flagellar motor protein MotA [Citreicella sp. SE45]
          Length = 289

 Score =  245 bits (626), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 85/289 (29%), Positives = 152/289 (52%), Gaps = 3/289 (1%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  IIG+ +    + GG+   GG   I+++  PFE++++ GA LG F++ N   V+K + 
Sbjct: 1   MLGIIGIVVIFAMVFGGYVLAGGKMGIILKALPFEMMMIGGAALGTFLLGNDGGVVKHTL 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
             + ++F         Y D+L LL+ L+   +  S    E H++ P  S+IF+  P +  
Sbjct: 61  KDISKVFKGTKWKPGDYKDLLCLLFELIRLAR-QSPVAIEEHVETPGESSIFSKYPKIQG 119

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           +      ICD MR + +     +++E ++D+ I+ + + +L   HA+    ++LPA+GIV
Sbjct: 120 DKVAIELICDTMRSMSMNYDDPHQVEEVLDKRIEALQHHRLHSSHALQSTADALPALGIV 179

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG+IK M  + Q P++LG  IG +L GT LG+ L+Y    P   ++KS   +    Y
Sbjct: 180 AAVLGVIKTMAAIDQPPEVLGKMIGGALVGTFLGVFLAYGFFGPFAGKVKSVVEEDLHFY 239

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
            ++++ L+A ++     + IE GR+  P   RPS   + + +       
Sbjct: 240 QLIREVLVANLHNHATNICIEVGRQNTPAHFRPSFVDLEEALKDVKQAA 288


>gi|254295278|ref|YP_003061301.1| flagellar motor protein MotA [Hirschia baltica ATCC 49814]
 gi|254043809|gb|ACT60604.1| chemotaxis MotA protein [Hirschia baltica ATCC 49814]
          Length = 288

 Score =  245 bits (626), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 89/285 (31%), Positives = 164/285 (57%), Gaps = 2/285 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  IIGL +    + GGF   GG+  ++I+  PFE++++ GAG+G F+++N +  IK + 
Sbjct: 1   MFQIIGLLVVFGMVFGGFALAGGHFDVIIKAAPFEMMMIGGAGVGSFLISNSMGTIKGAM 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
               +           Y D+L LL++L   +K       E HI++P +S+IF + P +L+
Sbjct: 61  GGFGKALSGPKWKAKDYQDLLTLLFVLTKTMKTKGVVAIEPHIENPKDSSIFQNYPKILK 120

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           ++     ICD +RM+ +     +++E+ ++++I+    E     HA+ ++ ++ PA+GIV
Sbjct: 121 DHFACDLICDTLRMMTMNMDDPHQVEDAIEKQIEKHHSEAHGAAHAVQNLADAFPALGIV 180

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LGIIK MG +SQ P+ LG  IG +L GT LGI ++Y +  P  +++     ++ + Y
Sbjct: 181 AAVLGIIKTMGAISQPPEYLGKLIGSALVGTFLGIFIAYGIVGPFAARMGEVLDEEGQFY 240

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQY 283
            I+K  L+++++G   Q+++E GR  +P S +PS   + + +   
Sbjct: 241 KIIKDVLVSHLHGNAAQISVELGRGSVPTSCQPSFTQMEEALNAA 285


>gi|226327781|ref|ZP_03803299.1| hypothetical protein PROPEN_01654 [Proteus penneri ATCC 35198]
 gi|225203485|gb|EEG85839.1| hypothetical protein PROPEN_01654 [Proteus penneri ATCC 35198]
          Length = 287

 Score =  245 bits (626), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 97/279 (34%), Positives = 163/279 (58%)

Query: 11  ILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKAL 70
           +  +IGG+  +GG+   L QP E +I+ GAG+G F++ N  + I  +   L ++      
Sbjct: 1   MSAVIGGYLLVGGSLGALYQPAEFIIIFGAGIGAFIVGNNGRAIVSTMKILPKLLRSTNY 60

Query: 71  GQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYM 130
            +  Y D++ L++ L+   ++      E  I++P  S IF+  P ++++  + +FI DYM
Sbjct: 61  NKAMYMDLMALMFRLLSKARQNGMLALERDIENPQQSDIFSQYPRIMKDVYMLSFITDYM 120

Query: 131 RMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGN 190
           R+++ GN   YEIE+LMDEEI     E   P   +S MG+SLPA GIV A++G++ A+G 
Sbjct: 121 RLMVTGNMNPYEIESLMDEEIATFEEESEVPATGLSAMGDSLPAFGIVAAVMGVVNALGA 180

Query: 191 LSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMN 250
             +    +G  IG ++ GT LGI+L+Y   +PL S+++    +Q ++   +K  L++ MN
Sbjct: 181 ADRPAGEMGVLIGHAMVGTFLGILLAYGFISPLASRLRQRSSQQMKMMECIKTTLLSSMN 240

Query: 251 GAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKA 289
           G  PQ+A+E+GRK L L++RPS   + + V Q     +A
Sbjct: 241 GYAPQIAVEFGRKTLFLADRPSFIELEEHVRQVRTPMQA 279


>gi|254463720|ref|ZP_05077131.1| chemotaxis protein MotA [Rhodobacterales bacterium Y4I]
 gi|206684628|gb|EDZ45110.1| chemotaxis protein MotA [Rhodobacterales bacterium Y4I]
          Length = 289

 Score =  245 bits (625), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 89/289 (30%), Positives = 159/289 (55%), Gaps = 3/289 (1%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  I+G+ +    + GG+   GG   I+++  PFE++++ GA +G F++AN +  +K + 
Sbjct: 1   MIGIVGIVVIFAMVFGGYLLAGGKMAIILKSLPFEMMMIGGAAVGAFLIANDMGGVKHTL 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
             + ++F       D Y D+L LL+ L+   +  +  E E HI+DP NS++F   P +L 
Sbjct: 61  KDIGKVFKGPKWKPDDYRDLLCLLFALIRIAR-ANPVEVEQHIEDPENSSVFNKYPKILG 119

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           + E    ICD MR   +     +++E ++++ ++  L+  L   HA+  M + LPA+GIV
Sbjct: 120 DKEAVNLICDTMRSASMNYDDPHQVEEVLEKRMEANLHHALHSSHALQTMADGLPALGIV 179

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG+IK MG++ Q P++LG  IG +L GT LG+ LSY L  P   ++K+   +    Y
Sbjct: 180 AAVLGVIKTMGSIDQPPEVLGKLIGGALVGTFLGVFLSYGLVAPFAGKVKAVVEEDAHFY 239

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
            ++++ L+A ++     + IE GR+  P   RP    + + +     + 
Sbjct: 240 QLIREVLVANLHNHAAAICIEVGRQNTPSHFRPGFSELEEALKSVKQDA 288


>gi|114762173|ref|ZP_01441641.1| flagellar motor protein [Pelagibaca bermudensis HTCC2601]
 gi|114545197|gb|EAU48200.1| flagellar motor protein [Roseovarius sp. HTCC2601]
          Length = 289

 Score =  245 bits (625), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 85/289 (29%), Positives = 154/289 (53%), Gaps = 3/289 (1%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  IIG+ +    + GG+   GG   I+++  PFE++++ GA LG F++ N   V+K + 
Sbjct: 1   MMGIIGIVVIFGMVFGGYLLAGGKMSIILKSLPFEMMMIGGAALGTFLIGNDAGVVKHTL 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
             + ++F         Y ++L LL+ L+   +  S    E H++ P  STIF+  P +  
Sbjct: 61  KDVGKVFKGAKWKPADYKELLCLLFELIRLAR-QSPVAIEEHVESPDESTIFSKYPKIQG 119

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           +      ICD MR + +     +++E ++D+ I+ + + ++   HA+  M + LPA+GIV
Sbjct: 120 DKIAIELICDTMRSMSMNYDDPHQVEEVLDKRIEALEHHRMHSSHALQAMADGLPALGIV 179

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG+IK MG++ Q P++LG  IG +L GT LG+ L+Y    P   ++K+   +    Y
Sbjct: 180 AAVLGVIKTMGSIDQPPEVLGKLIGGALVGTFLGVFLAYGFAGPFAVKVKAVVEEDLHFY 239

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
            ++++ L+A ++     + IE GR+  P   RPS   + + +       
Sbjct: 240 QLIREVLVANLHNHATNICIEVGRQNTPAHFRPSFTDLEEALKNVKQAA 288


>gi|206890450|ref|YP_002248654.1| lateral flagellar motor protein MotA [Thermodesulfovibrio
           yellowstonii DSM 11347]
 gi|206742388|gb|ACI21445.1| lateral flagellar motor protein MotA [Thermodesulfovibrio
           yellowstonii DSM 11347]
          Length = 288

 Score =  245 bits (625), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 85/288 (29%), Positives = 161/288 (55%), Gaps = 1/288 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  +IG  + +  I+GG+    GN  +L QP E++I+ GA +G  V+A+P  V++     
Sbjct: 1   MLVVIGGLVVLGSIVGGYLLEKGNLSVLFQPAEVLIIFGAAIGALVIASPPHVLRGVIKG 60

Query: 61  -LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLEN 119
            +  I G K   +  Y D L LL  L   ++K      E  +++P NSTIF+  P  L+N
Sbjct: 61  TITTITGAKGYSKRDYMDTLLLLSELFTKIRKEGLISIEQDVEEPENSTIFSKYPKFLKN 120

Query: 120 NELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVG 179
           +     + D +R ++      YE+E+++D EI+ +   +  P   +  + +SLP +GIV 
Sbjct: 121 HHAMALLTDTLRTVMTTTVSPYELESILDSEIETLHETESGPVRNLLTIADSLPGLGIVA 180

Query: 180 AILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYI 239
           A+LG++  MG + + P+++G ++G +L GT +G+++ Y    PL  +++++   +     
Sbjct: 181 AVLGVVLTMGKMKEPPEVIGHSVGAALVGTFMGVLMCYGFVGPLAKRLEASVNHEKEYLQ 240

Query: 240 IVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
           I+K AL+A+++G+ PQ+A+E+ R+ +P   RP+   + +E+      +
Sbjct: 241 IIKAALVAFVSGSAPQIAVEFARRTIPPHLRPTFHELEEEIRALKSGR 288


>gi|171057688|ref|YP_001790037.1| chemotaxis signal transduction protein CheY [Leptothrix cholodnii
           SP-6]
 gi|170775133|gb|ACB33272.1| chemotaxis signal transduction protein CheY [Leptothrix cholodnii
           SP-6]
          Length = 285

 Score =  245 bits (625), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 101/284 (35%), Positives = 161/284 (56%), Gaps = 2/284 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  +IG  + I CI G +   GGN  ++++  P+E++ + G  LG FV  N +KV+K + 
Sbjct: 1   MFVLIGWGVAIGCIFGVYIIHGGNISVILKALPWEMITIFGGALGAFVANNQMKVLKATM 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
             L   F      +    ++L L+Y ++   +K      E  I+DP++S +F   P V  
Sbjct: 61  KGLGACFKGSKYSKARAMELLALIYEILQKSRKEGLMSIEKDIEDPHSSPLFQKFPVVGN 120

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           ++ +T FI DY+RM++ GN  ++EIE+LMD E++   +E      AI+ +  +LPA GIV
Sbjct: 121 DHHVTEFITDYLRMMVSGNLNAHEIESLMDSELETHHHEAHSAAAAIARLAGALPAFGIV 180

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG++  MG++ Q P +LG  IG +L GT LGI+L+Y    PL   ++    +  +  
Sbjct: 181 AAVLGVVNTMGSVGQPPAVLGGMIGSALVGTFLGILLAYGFAEPLAGLLEQKIDEDGKEL 240

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQ 282
             +K  L+A M G  PQ+AIE+GRKVL  +ERPS   +   V +
Sbjct: 241 QCIKATLLASMQGYAPQIAIEFGRKVLYSTERPSFAELEAHVKK 284


>gi|163738050|ref|ZP_02145466.1| chemotaxis protein MotA [Phaeobacter gallaeciensis BS107]
 gi|163742554|ref|ZP_02149940.1| flagellar motor protein MotA [Phaeobacter gallaeciensis 2.10]
 gi|161384139|gb|EDQ08522.1| flagellar motor protein MotA [Phaeobacter gallaeciensis 2.10]
 gi|161388666|gb|EDQ13019.1| chemotaxis protein MotA [Phaeobacter gallaeciensis BS107]
          Length = 289

 Score =  245 bits (625), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 91/289 (31%), Positives = 158/289 (54%), Gaps = 3/289 (1%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  I+G+ +  + + GG+   GG   I+I+  PFE +++ GAG+G F+++N +  +K + 
Sbjct: 1   MLGIVGIVVIFVMVFGGYLLAGGKFAIIIKALPFEFMMIGGAGVGAFLISNDMGGVKHTL 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
             L ++F       D Y D+L LL+ L+   +  +  E E HI+DP NS++F   P +L 
Sbjct: 61  KDLGKVFKGPKWKPDDYRDLLCLLFSLIRIAR-ANPVEVEQHIEDPENSSVFNRYPKILA 119

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           + E    I D MR   +     +++E ++++ I+  L+  L   HA+  + + LPA+GIV
Sbjct: 120 DKEAVNLISDTMRSASMNYDDPHQVEEVLEKRIEANLHHALHSSHALQSLADGLPALGIV 179

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LGIIK MG++ Q P++LG  IG +L GT LG+ L+Y L  P   ++KS   +    Y
Sbjct: 180 AAVLGIIKTMGSIDQPPEVLGKLIGGALVGTFLGVFLAYGLVGPFAGKVKSVVEEDAHFY 239

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
            ++++ L+A ++     + IE GR+  P   RP    +   +     + 
Sbjct: 240 SLIREVLVANLHNHAAAICIEVGRQNTPSHIRPGFSELEDALKSVKQDA 288


>gi|241763662|ref|ZP_04761712.1| MotA/TolQ/ExbB proton channel [Acidovorax delafieldii 2AN]
 gi|241367137|gb|EER61503.1| MotA/TolQ/ExbB proton channel [Acidovorax delafieldii 2AN]
          Length = 286

 Score =  245 bits (625), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 105/283 (37%), Positives = 158/283 (55%), Gaps = 2/283 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  IIG FIT  C+ G F A GGN  +L++  PFE++ + GA LG F++ N  KV+K + 
Sbjct: 1   MFVIIGYFITFGCVFGVFVAHGGNIKVLLEALPFEMITIGGAALGSFIVTNQTKVLKSTM 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
             L ++F      +  Y +++ +LY ++   +K      E  ++ P  S IF   PTV  
Sbjct: 61  AVLPQVFKGNKYTKARYMELMAMLYDILQKARKEGLMAIEKDVEAPAESEIFKKYPTVGG 120

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           ++ +  F  DY+RM++ GN  S+EIE+LMD EI+    E   P  A++ +  +LPA GIV
Sbjct: 121 DHHVIEFTTDYLRMMVSGNLNSHEIESLMDSEIETHHQEAHAPVAALTRLAGALPAFGIV 180

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG++  MG++ Q P +LG  I  +L GT LGI+L+Y    PL   ++       +  
Sbjct: 181 AAVLGVVNTMGSVGQPPSVLGGMIASALVGTFLGILLAYGAVEPLAGLLEQKAEDAAKEL 240

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
             +K  L+A M G  P  AIE+GRKVL  +ERPS   +   V 
Sbjct: 241 HCIKSTLLASMQGYNPATAIEFGRKVLFSTERPSFSELEGHVK 283


>gi|296447446|ref|ZP_06889371.1| MotA/TolQ/ExbB proton channel [Methylosinus trichosporium OB3b]
 gi|296255066|gb|EFH02168.1| MotA/TolQ/ExbB proton channel [Methylosinus trichosporium OB3b]
          Length = 289

 Score =  244 bits (624), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 148/289 (51%), Positives = 200/289 (69%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   +GL IT+ C+ GGF A+GG+  +L QP+E VI+ G+ LG FV+ANP KVI DSG +
Sbjct: 1   MGFFVGLIITMGCMFGGFAALGGHLVVLWQPWEFVIIMGSSLGTFVIANPTKVIIDSGKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           + +    K      Y DVL LL+ LM  L+   RNE E H+D+P  S IFT+ P VLEN 
Sbjct: 61  IGQAIMGKGPKHRDYLDVLGLLHALMRELRSKPRNEVEAHVDNPAESKIFTAFPKVLENK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           E+T FICDY R+ I+GN R++EIE LMDEEI  I Y++LKPYHA++ +G+ LPA+GIV A
Sbjct: 121 EMTAFICDYCRLFIIGNVRTFEIEALMDEEIAAIRYDRLKPYHALTSVGDGLPALGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKAMG L QSP++LG  IG ++ GT  GI +SY +  PL  +IK  R K+  LY+I
Sbjct: 181 VLGVIKAMGALDQSPELLGGLIGAAMVGTFAGIFVSYGVITPLAFKIKVARTKECHLYVI 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKA 289
           +K+ L+A+MNG +PQVA+E+GRK +P  ERP+I+ V  E L     + A
Sbjct: 241 IKQTLLAFMNGGMPQVAVEHGRKSIPSYERPTIDEVENETLSGGAAEAA 289


>gi|297517350|ref|ZP_06935736.1| flagellar motor protein MotA [Escherichia coli OP50]
          Length = 284

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 100/277 (36%), Positives = 162/277 (58%)

Query: 12  LCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALG 71
             + GG+   GG+   L QP E+VI+AGAG+G F++ N  K IK +  +L  +F      
Sbjct: 1   GTVFGGYLMTGGSLGALYQPAELVIIAGAGIGSFIVGNNGKAIKGTLKALPLLFRRSKYT 60

Query: 72  QDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMR 131
           +  Y D+L LLY LM   ++      E  I++P  S IF S P +L ++ +  FI DY+R
Sbjct: 61  KAMYMDLLALLYRLMAKSRQMGMFSLERDIENPRESEIFASYPRILADSVMLDFIVDYLR 120

Query: 132 MIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNL 191
           +II G+  ++EIE LMDEEI+    E   P ++++ +G+SLPA GIV A++G++ A+G+ 
Sbjct: 121 LIISGHMNTFEIEALMDEEIETHESEAEVPANSLALVGDSLPAFGIVAAVMGVVHALGSA 180

Query: 192 SQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNG 251
            +    LG  I  ++ GT LGI+L+Y   +PL + ++    +  ++   VK  L++ +NG
Sbjct: 181 DRPAAELGALIAHAMVGTFLGILLAYGFISPLATVLRQKSAETSKMMQCVKVTLLSNLNG 240

Query: 252 AIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
             P +A+E+GRK L  SERPS   + + V    + ++
Sbjct: 241 YAPPIAVEFGRKTLYSSERPSFIELEEHVRAVKNPQQ 277


>gi|114706760|ref|ZP_01439660.1| flagellar motor protein [Fulvimarina pelagi HTCC2506]
 gi|114537708|gb|EAU40832.1| flagellar motor protein [Fulvimarina pelagi HTCC2506]
          Length = 287

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 136/287 (47%), Positives = 197/287 (68%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++G+ + + C++GGF AMGG+  +L+QPFE VI+ G+  G F++ANP KVIKD G +
Sbjct: 1   MGILLGMVVVLGCLLGGFVAMGGHLGVLVQPFEYVIICGSSFGTFLVANPPKVIKDCGKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           + E F      Q  Y ++L LL+ +M  ++  SR+E E H+D P  STIF + PT+L++ 
Sbjct: 61  IGEAFKNAVPKQKDYLEILGLLHAMMREMRSKSRSEVEAHVDAPEESTIFQAYPTILKDK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +   FICDY+R+IIVG+ARS+EIE LM+EEI+ I ++ +KP  A+  + + LPA+GIV A
Sbjct: 121 QKVNFICDYVRLIIVGSARSHEIEALMEEEIETITHDAMKPKAALQDVADGLPALGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKAMG L QSP+ILG  I  +L GT  G+  SY +  P+ S++KS R K+ R Y++
Sbjct: 181 VLGVIKAMGALDQSPEILGGLIAAALVGTFAGVFFSYGVMGPIASKVKSVREKKCRTYVV 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
           +K  LIAYMNGA+PQVAIEYGRK +   +RP+I+ V  E +      
Sbjct: 241 IKSTLIAYMNGAMPQVAIEYGRKTISAYDRPTIDQVEAETIGGGATA 287


>gi|297538878|ref|YP_003674647.1| flagellar motor protein MotA [Methylotenera sp. 301]
 gi|297258225|gb|ADI30070.1| flagellar motor protein MotA [Methylotenera sp. 301]
          Length = 286

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 100/285 (35%), Positives = 165/285 (57%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  IIG  + +  I GG+   GG+   L QP E++++ G  LG FV+ N +K +K +G S
Sbjct: 1   MFVIIGYVVILGTIFGGYALGGGHLGGLWQPLELLMIFGGALGAFVVGNDIKALKATGKS 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y D+L +L+ ++  ++K      EN +++P  S +F+  P +L ++
Sbjct: 61  LPTLFKGSKYNKALYMDLLAMLFEILAKIRKDGMMSIENDVENPEASPLFSKYPKLLHDH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FI DY+R++  GN  +++IE LM+ EI+    E   P H I+ +G++LPA GIV A
Sbjct: 121 HLIEFITDYLRLMGSGNMDAFQIETLMESEIETHHMEGHVPAHCIAKLGDALPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  MG+L + P  LG  IG +L GT LGI+L+Y    PL+  ++    +  ++Y  
Sbjct: 181 VMGVVHTMGSLDKPPPELGEMIGHALVGTFLGILLAYGFVGPLSGLLEQKLEESTKMYNA 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           VK  LI+ +NG  P +A+E+GRK+L  +ERP    +   + Q   
Sbjct: 241 VKVTLISSLNGYAPAIAVEFGRKILYSTERPGFAELEAHIKQAKG 285


>gi|182679716|ref|YP_001833862.1| MotA/TolQ/ExbB proton channel [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182635599|gb|ACB96373.1| MotA/TolQ/ExbB proton channel [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 296

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 156/287 (54%), Positives = 211/287 (73%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  +IG  I + C++GGF AMGG+  ++ QP+E VI+ G+ LG F++AN +  IKD+G +
Sbjct: 1   MGFLIGTIIAVGCMLGGFAAMGGHIVVIWQPWEFVIICGSALGTFIVANNVLTIKDTGRA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L E    K+L Q  Y DVL +LY LM  ++  +RNE E H+D+P  STIF + P VL N 
Sbjct: 61  LGEAIMDKSLKQRDYLDVLGVLYTLMREMRGKARNEVEEHVDNPEESTIFQNFPRVLANK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           ELT FICDY R+II+GNAR++EIE LMDEEI+ IL++ LKPYHAI+ + ESLPA+GIV A
Sbjct: 121 ELTNFICDYCRLIIIGNARTHEIEALMDEEIETILHDTLKPYHAITIVAESLPALGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKAMG L QSP++LG  IG +L GT  GI LSY L +PL ++I++TR KQ RLYII
Sbjct: 181 VLGVIKAMGALDQSPELLGGLIGSALVGTFAGIFLSYGLLSPLANKIRATREKQSRLYII 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
           VK+ L+A+MNGA+PQ+A+E+GRK +  ++RPSI+IV  E +     K
Sbjct: 241 VKQTLLAFMNGAMPQIALEHGRKTISSADRPSIDIVENETVTGGTGK 287


>gi|183598598|ref|ZP_02960091.1| hypothetical protein PROSTU_01996 [Providencia stuartii ATCC 25827]
 gi|188020775|gb|EDU58815.1| hypothetical protein PROSTU_01996 [Providencia stuartii ATCC 25827]
          Length = 295

 Score =  244 bits (622), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 95/284 (33%), Positives = 158/284 (55%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  +IG  I    +IGG+  +GG+   L QP E VI+ GAG G FV+ N  K I      
Sbjct: 1   MLILIGYIIVTGTVIGGYLMLGGHLGALYQPAEFVIILGAGFGAFVVGNSGKSIIALCKV 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F   +  +    D++ LL+ L+   ++      E  I++P  S IF+  P VL++ 
Sbjct: 61  LPRVFRRSSYNKAMSMDLMALLFQLLNKSRQEGLLALEKDIENPQESEIFSQYPRVLKDK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+ DY+R+++  N +S+EIE LMDEE++    E   P   ++ +G+S+PA GIV A
Sbjct: 121 TTLMFVVDYLRLMVTSNLQSHEIEALMDEELETFRQESEVPASGLNMVGDSMPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG++ A+G+  +    LG  I  ++ GT LGI+++Y    PL + I+    +Q ++   
Sbjct: 181 VLGVVNALGSADRPAGELGALIAHAMVGTFLGILVAYGFILPLAALIRLRTNEQLKMLEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYN 284
           +K   ++ + G  PQ+A+E+GRKVL  ++RPS   +  +V +  
Sbjct: 241 IKVTFLSALQGYAPQIAVEFGRKVLYSADRPSFMELEDKVREVK 284


>gi|319403953|emb|CBI77541.1| Chemotaxis protein motA [Bartonella rochalimae ATCC BAA-1498]
          Length = 291

 Score =  244 bits (622), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 132/290 (45%), Positives = 200/290 (68%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  IIGL I   CI+GG+ AMGG+  +L+QP+E VI+ G+ +G F+++NP+  IKD+  +
Sbjct: 1   MGVIIGLIIIFGCILGGYVAMGGHLDVLVQPWEFVIILGSAIGTFIVSNPIPAIKDTLQA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            +E        Q  +  +L LLY+LM  ++  S++E E H+D+P  S +F   P +L++ 
Sbjct: 61  TIEAMKDAVPKQKDFLSLLGLLYVLMREMRSKSKSEMEAHVDNPKESALFQQYPLILKDE 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            LT FICDY R+I++GN R +EIE LMDEEI  I Y+  KPY A+ +M ++LPA+GIV A
Sbjct: 121 SLTNFICDYCRLIVMGNTRPFEIEALMDEEIHTISYDSQKPYQAMQNMADALPALGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG++KAMG +S+ P++LG  IG +L GT  GI  +Y +  PL S+IK+ R K+ R+YI+
Sbjct: 181 VLGVVKAMGAISEPPEVLGHLIGAALVGTFAGIFFAYGIFGPLASKIKTVRNKKVRIYIV 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK+ L+AYMNGA+PQ+A+EYGRK +   +RP+I+I+ Q  +    ++K +
Sbjct: 241 VKQTLLAYMNGAMPQIALEYGRKTISAKDRPTIDIMEQHAIASQGSEKEA 290


>gi|238782804|ref|ZP_04626833.1| hypothetical protein yberc0001_34320 [Yersinia bercovieri ATCC
           43970]
 gi|238716227|gb|EEQ08210.1| hypothetical protein yberc0001_34320 [Yersinia bercovieri ATCC
           43970]
          Length = 298

 Score =  244 bits (622), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 101/283 (35%), Positives = 165/283 (58%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
             IIG  + IL + GGF   GG    L QP E++I+ GAG+G F++ N  K IK +  + 
Sbjct: 4   LVIIGYLVVILTVFGGFSLAGGELAALYQPTELLIIGGAGVGAFIVGNNGKSIKATFKAF 63

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
             +    +  +  Y D+L +LY+L+   ++      E+ I+DP NS IF++ P +L +  
Sbjct: 64  PHLLKGSSYTKVLYMDLLAMLYLLLTKSRQNGIMTLESDIEDPQNSAIFSAYPRLLADPM 123

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
           L TFI DY+RM++ G+  S+EIE LMDEEI+   +E   P H+++ +G++LPA GIV A+
Sbjct: 124 LMTFIIDYLRMMVSGSMNSFEIEALMDEEIETCEHEHEVPAHSLNAVGDALPAFGIVAAV 183

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           +G++ A+    +    LG  I  ++ GT LGI+L+Y    PL S ++    ++ ++   +
Sbjct: 184 MGVVNALAAADRPAAELGELIAHAMVGTFLGILLAYGFVLPLASLLRQKSSEEIKMLQCI 243

Query: 242 KKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYN 284
           +  L++ MNG  PQ+A+E+GRK L   ERP+   +   V +  
Sbjct: 244 RVTLLSSMNGYAPQIAVEFGRKTLFSPERPTFLELEDHVREAK 286


>gi|282599769|ref|ZP_05971808.2| chemotaxis MotA protein [Providencia rustigianii DSM 4541]
 gi|282567759|gb|EFB73294.1| chemotaxis MotA protein [Providencia rustigianii DSM 4541]
          Length = 300

 Score =  244 bits (622), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 99/283 (34%), Positives = 156/283 (55%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
             +IG  I    +IGG+  +GG+   L QP E VI+ GAGLG FV+ N  K I      L
Sbjct: 7   LILIGYIIVTAAVIGGYVMVGGHLGALYQPAEFVIILGAGLGAFVVGNSGKSIVALCKVL 66

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
             +F   A  +    D++ LL+ L+   ++      E  I++P  S IFT  P +L++  
Sbjct: 67  PRLFRRSAYNKAMSMDLMALLFQLLNKSRQQGLLALEKDIENPQESEIFTQYPRILKDPT 126

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
              FI DY+R+++  N +S+EIE LMDEE++    E   P   ++ +GES+PA GIV A+
Sbjct: 127 AMMFIVDYLRLMVTSNLQSHEIEALMDEELETFRQENEVPATGLNMVGESMPAFGIVAAV 186

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           LG++ A+G   +    LG  I  ++ GT LGI+++Y    PL S ++    +Q +L   +
Sbjct: 187 LGVVNALGAADRPAGELGALIAHAMVGTFLGILVAYGFILPLASLVRQRSTEQLKLMECI 246

Query: 242 KKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYN 284
           K   ++ + G  PQ+A+E+GRKVL   +RPS   +  +V +  
Sbjct: 247 KVTFLSSLQGYAPQIAVEFGRKVLFSVDRPSFIELEDKVREVK 289


>gi|126730125|ref|ZP_01745937.1| flagellar motor protein MotA [Sagittula stellata E-37]
 gi|126709505|gb|EBA08559.1| flagellar motor protein MotA [Sagittula stellata E-37]
          Length = 289

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 85/289 (29%), Positives = 155/289 (53%), Gaps = 3/289 (1%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  IIG+ +    + GG+ A GG   I+++  PFE +++ GA +G F++ N    +K + 
Sbjct: 1   MLGIIGIVVLFAMVFGGYLAAGGKMGIILKALPFEFMMIGGAAVGAFLIGNDGGTVKHAL 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
             + ++F       + Y D+L LL+ L+   +  +    E HI+ P  STIF   P +L 
Sbjct: 61  KDIGKVFKGAKWKHEDYRDLLCLLFELIRLAR-QNPVAIEEHIESPSESTIFGKYPKILG 119

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           +      ICD MR + +     +++E ++D+ ++ + +  +   HA+  M ++LPA+GIV
Sbjct: 120 DKYAIELICDTMRSVSMNYDDPHQVEEVLDKRLEGMEHHAMHSSHALQSMADALPALGIV 179

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG+IK M ++ Q P++LG  IG +L GT LG+ L+Y L  P   ++K+   +    Y
Sbjct: 180 AAVLGVIKTMASIDQPPEVLGKLIGGALVGTFLGVFLAYGLVGPFAGKVKAVAEEDMHFY 239

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
            ++++ L+A ++     + IE GR+  P   RP+ E + + +       
Sbjct: 240 HLIREVLVANLHNHATNICIEVGRQNTPGHFRPTFEDLEEALKSVKQEA 288


>gi|254511948|ref|ZP_05124015.1| chemotaxis protein MotA [Rhodobacteraceae bacterium KLH11]
 gi|221535659|gb|EEE38647.1| chemotaxis protein MotA [Rhodobacteraceae bacterium KLH11]
          Length = 289

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 82/289 (28%), Positives = 160/289 (55%), Gaps = 3/289 (1%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  +IG+ +    + GG+ A GG   I+++  P+E++++ GA +G F+++N +  +K + 
Sbjct: 1   MIGLIGIAVIFAMVFGGYLAAGGKMAIIMKSLPYEMMMIGGAAVGAFMISNDMGGVKHTA 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
             + ++F       + Y D+L LL+ L+   +  +  E E HI++P NS++F++ P +  
Sbjct: 61  KDIGKVFKGPKWKPEDYRDLLCLLFSLIRIAR-ANPVEVEQHIEEPENSSLFSAYPKIQA 119

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           + E    ICD MR   +     +++E ++++ ++   +  +   HA+  + + LPA+GIV
Sbjct: 120 DKEAVDLICDTMRSAAMNYDDPHQVEEVLEKRMEANFHHAMHSSHALQTVADGLPALGIV 179

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG+IK MG++ Q P++LG  IG +L GT LG+ L+Y L  P   ++K+   + +  Y
Sbjct: 180 AAVLGVIKTMGSIDQPPEVLGKLIGGALVGTFLGVFLAYGLVGPFAGKLKTVVEEDNHFY 239

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
            ++K+ L+A ++     + IE GR+  P   RP    +   + +     
Sbjct: 240 QLIKEVLVANLHNHNAAMCIEVGRQNTPTHNRPGFSELEDALKELKQAA 288


>gi|311695401|gb|ADP98274.1| flagellar motor protein MotA [marine bacterium HP15]
          Length = 283

 Score =  243 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 98/282 (34%), Positives = 163/282 (57%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  I +  ++ G+   GGN  +L QP E++I+ GA LG F++ANP+  +K+    
Sbjct: 1   MLLIVGSIIVLASVLTGYVLHGGNLMVLWQPTEVLIIFGAALGSFIIANPVHTLKEVFGK 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            +++       +  Y D+L LLY +    +K      E  ID+P  S IF+  P V+++ 
Sbjct: 61  GVQLLTGSPYKKAFYMDLLSLLYEIFDKSRKQGVMAIEEDIDNPEASQIFSRYPAVMKSK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           EL  FI DY+R+I  GN  ++E+E +M+ EID   +E  +P HA++ + ++LP +GIV A
Sbjct: 121 ELLAFITDYLRIISSGNMATHELEGMMENEIDSRQHELEEPAHAVNKIADALPGLGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGI+  M  L++ P+ +G ++  +L GT LGI + Y    P +  ++     + + Y  
Sbjct: 181 VLGIVITMNFLTEGPEKIGLSVAAALVGTFLGIFMGYGFVGPASIAMEHAAKYELKAYEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQ 282
           VK A++A ++G  PQ+AIE+GRK LP  +RP  + +   V  
Sbjct: 241 VKSAIVATVSGQAPQMAIEFGRKALPTDKRPGFQELNDHVRS 282


>gi|77464894|ref|YP_354398.1| flagellar motor protein MotA [Rhodobacter sphaeroides 2.4.1]
 gi|126463736|ref|YP_001044850.1| flagellar motor protein MotA [Rhodobacter sphaeroides ATCC 17029]
 gi|221640815|ref|YP_002527077.1| flagellar motor protein MotA [Rhodobacter sphaeroides KD131]
 gi|332559793|ref|ZP_08414115.1| MotA2 [Rhodobacter sphaeroides WS8N]
 gi|77389312|gb|ABA80497.1| Flagellar motor protein MotA [Rhodobacter sphaeroides 2.4.1]
 gi|126105400|gb|ABN78078.1| flagellar motor protein [Rhodobacter sphaeroides ATCC 17029]
 gi|221161596|gb|ACM02576.1| Flagellar motor protein precursor [Rhodobacter sphaeroides KD131]
 gi|332277505|gb|EGJ22820.1| MotA2 [Rhodobacter sphaeroides WS8N]
          Length = 289

 Score =  243 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 85/289 (29%), Positives = 157/289 (54%), Gaps = 3/289 (1%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  I+G+ +  + + GG+   GG   ++++  PFE++++ GA +G F++AN L  +K + 
Sbjct: 1   MFGIVGILVIFVMVFGGYMLAGGKLGVILKALPFEMIMIGGAAVGSFLLANDLATVKHTL 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
             L ++F         Y D+L LL+ L+   K       E HI++P  S++F+  P +  
Sbjct: 61  KDLGKVFKGPKWKPGDYRDLLCLLFELVRIAKVNPV-GLEEHIENPEESSVFSRYPKIQH 119

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           +++    ICD +R   +      ++E ++D+ ++   +  L   HA+  M ++LPA+GIV
Sbjct: 120 DHDAIELICDTLRAASMNYDDPNQVEEVLDKRVEKAQHHALHSSHALQSMADALPALGIV 179

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG+IK MG++ Q P+ILG  IG +L GT LG+ L+Y +  P  +++K+   +    Y
Sbjct: 180 AAVLGVIKTMGSIDQPPEILGKMIGGALVGTFLGVFLAYGIVGPFATRVKAVVEEDGHFY 239

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
            ++++ LIA ++     + IE GR+  P   RPS   + + +       
Sbjct: 240 NLIREVLIANLHNHPANMCIEVGRQNTPHHVRPSFTDLEEAIRALKQEA 288


>gi|83593177|ref|YP_426929.1| motA, chemotaxis (motility protein A [Rhodospirillum rubrum ATCC
           11170]
 gi|83576091|gb|ABC22642.1| motA, chemotaxis (motility protein A [Rhodospirillum rubrum ATCC
           11170]
          Length = 285

 Score =  243 bits (620), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 95/270 (35%), Positives = 154/270 (57%)

Query: 13  CIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQ 72
            +IGG+ A GG+  +L QPFE +I+ GA LG F++ NP  V+  +  SL  +       +
Sbjct: 13  SVIGGYAAPGGHLAVLWQPFEFIIILGASLGAFLIGNPKTVLTGTLKSLGPMMKGPKHNK 72

Query: 73  DTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRM 132
            +Y ++L LLY L    K       E+HI+ P +S IF   P   +++    F+CDY+R+
Sbjct: 73  ASYLELLSLLYTLFRLAKTKGDLALESHIEKPEDSPIFQKFPAFSKDHHNVEFLCDYLRL 132

Query: 133 IIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLS 192
           + +G   ++E+E +++ EI+    E      A+ +M + +PA+GIV A+LG+I  MG+++
Sbjct: 133 LTLGTNNAHEVETIIEAEIESHHVEAHNIPSAMVNMADGMPALGIVAAVLGVIHTMGSIT 192

Query: 193 QSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGA 252
           + P++LG  IG +L GT +G++LSY    P    I++    Q +    +K  ++A+M G 
Sbjct: 193 EPPEVLGHLIGAALVGTFMGVLLSYGFFAPFGRAIEAVFNNQTQYLHCMKSGILAHMQGY 252

Query: 253 IPQVAIEYGRKVLPLSERPSIEIVAQEVLQ 282
            PQV+IE+ RK LP S RPS   V   V  
Sbjct: 253 APQVSIEFARKTLPPSVRPSFAEVEDTVTN 282


>gi|319764524|ref|YP_004128461.1| mota/tolq/exbb proton channel [Alicycliphilus denitrificans BC]
 gi|330826740|ref|YP_004390043.1| flagellar motor stator protein MotA [Alicycliphilus denitrificans
           K601]
 gi|317119085|gb|ADV01574.1| MotA/TolQ/ExbB proton channel [Alicycliphilus denitrificans BC]
 gi|329312112|gb|AEB86527.1| flagellar motor stator protein MotA [Alicycliphilus denitrificans
           K601]
          Length = 286

 Score =  242 bits (619), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 101/283 (35%), Positives = 156/283 (55%), Gaps = 2/283 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  I+G  +T  C+ G F A GGN  ++++  PFE++ + GA  G FV+ N  KV+K + 
Sbjct: 1   MFVILGYLVTFGCVFGVFIAHGGNIKVVLEALPFEMITIGGAAAGAFVVNNQPKVLKATM 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
             L ++       +  Y ++L +LY ++   +K      E  ++ P +S IF   PTV  
Sbjct: 61  AMLPQVLKGNKYTKARYMELLAMLYEILQKARKEGLMAIEADVESPQDSEIFKKFPTVGT 120

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           ++ +  F  DY+RM++ GN  ++EIE LMD EID    E   P  A++ +  +LPA GIV
Sbjct: 121 DHHVLEFTTDYLRMMVSGNLNAHEIEALMDSEIDTHHQEAHAPVAALTRLAGALPAFGIV 180

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG++  MG++ Q P +LG  I  +L GT LGI+L+Y L  PL   ++       + +
Sbjct: 181 AAVLGVVNTMGSVGQPPAVLGGMIASALVGTFLGILLAYGLVEPLAGLLEQKAEDAGKEF 240

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
             +K  L+A M G  P  AIE+GRKVL   +RPS   +   V 
Sbjct: 241 ACIKSTLLASMQGYNPSTAIEFGRKVLFSGDRPSFSELESHVK 283


>gi|254497975|ref|ZP_05110738.1| flagellar motor protein MotA [Legionella drancourtii LLAP12]
 gi|254352752|gb|EET11524.1| flagellar motor protein MotA [Legionella drancourtii LLAP12]
          Length = 300

 Score =  242 bits (619), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 96/290 (33%), Positives = 168/290 (57%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  IIG  + +LC+ GGF   GG+   + QP E++I+ GA +G  ++ N L V+K  G +
Sbjct: 1   MLIIIGYIVVLLCVFGGFALGGGHLAAIFQPVELLIIGGAAVGSLIVGNSLSVLKALGRA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           + ++F  +   + TY  +L LLY L+   ++      E+ I++P +S IFT+ P+++  +
Sbjct: 61  IPKVFRSEKTSKATYISLLGLLYNLLNKARQQGMMSIESDIEEPESSPIFTNYPSLMSEH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FICDY R+II  N + +++E LMD EI+    E+L P + I+ + +++PA GIV A
Sbjct: 121 HIIEFICDYFRLIITSNMQPFQLEALMDMEIESHHEEELIPANTITKVADAMPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG++  M ++S  P  LG  I  +L GT LGI++ Y    P+ + ++    +   +   
Sbjct: 181 VLGVVHTMESISLPPAELGILIAHALVGTFLGILIGYGFIGPIATAMEQRANQTQLMLQS 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           +K  ++A ++   P +A+E+GRKVL  ++RPS   +  E+      + AS
Sbjct: 241 IKATILASLHNNPPLIAVEFGRKVLFSAQRPSFTQLNDEIKNVKQAEPAS 290


>gi|291326362|ref|ZP_06124226.2| chemotaxis MotA protein [Providencia rettgeri DSM 1131]
 gi|291314724|gb|EFE55177.1| chemotaxis MotA protein [Providencia rettgeri DSM 1131]
          Length = 300

 Score =  242 bits (619), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 96/288 (33%), Positives = 162/288 (56%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
             +IG  I  + +IGG+  +GG+   L QP E VI+ GAGLG FV+ N  K I      L
Sbjct: 7   LILIGYIIVTVAVIGGYIMVGGHLGALYQPAEFVIILGAGLGAFVVGNSGKSIVALCKVL 66

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
            ++F   +  +    D++ LL+ L+   ++      E  ID+P  S IF+  P +L++  
Sbjct: 67  PKLFRRSSYNKTMSMDLMALLFQLLNKSRQQGLLALEKDIDNPSESEIFSQYPRILKDES 126

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
              FI DY+R+++  N +S+EIE LMDEE++    E   P   ++ +G+S+PA GIV A+
Sbjct: 127 TMMFIVDYLRLMVSSNLQSHEIEALMDEELETFRQENEVPASGLNMVGDSMPAFGIVAAV 186

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           LG++ A+G+  +    LG  I  ++ GT LGI+++Y    PL + I+    +Q ++   +
Sbjct: 187 LGVVNALGSADRPAGELGALIAHAMVGTFLGILVAYGFILPLAALIRLRSSEQLKMMECI 246

Query: 242 KKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKA 289
           K   ++ + G  PQ+A+E+GRKVL  ++RPS   +  +V +     ++
Sbjct: 247 KVTFLSALQGYAPQIAVEFGRKVLFSADRPSFVELEDKVREVKVGARS 294


>gi|307546934|ref|YP_003899413.1| flagellar motor protein MotA [Halomonas elongata DSM 2581]
 gi|307218958|emb|CBV44228.1| flagellar motor protein MotA [Halomonas elongata DSM 2581]
          Length = 290

 Score =  242 bits (618), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 91/290 (31%), Positives = 161/290 (55%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   IG  I +L + GGF   GG+   L QP E++++ GAG+G FV +N  K +K S   
Sbjct: 1   MLIPIGYLIVLLSVFGGFVLAGGSLGPLFQPTELLMIGGAGIGAFVASNNGKALKASFRI 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  +   K   +  Y D++ L Y ++  +++      E  ID+P  S +F   P +L + 
Sbjct: 61  IPRLRRSKKYDKAMYLDLMALQYKILTKIRRDGMLGIERDIDNPQESPLFNEHPRLLADP 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            + TF+ DY+R+++ G+    E++ LM  EI+    E   P  AI  +G+++PA GIV A
Sbjct: 121 MIMTFLTDYLRLMVSGSMDPMELDELMLHEIEAFEQEAHIPIDAIGRIGDAMPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++KA+  ++  P+ +G  I  +L GT LGI++ Y    PL S+I+    +  ++   
Sbjct: 181 VMGVVKALSTVAAGPEQMGQMIAHALVGTFLGILIGYGFIIPLASRIERQAKEAEKMLHC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           ++  L+A ++G  PQ+A+E+GRK L  ++RPS   + + + Q      ++
Sbjct: 241 IRVTLLANLHGYAPQLAVEFGRKALHTADRPSFTEMEEYMRQAKPVAGSA 290


>gi|85859044|ref|YP_461246.1| chemotaxis protein [Syntrophus aciditrophicus SB]
 gi|85722135|gb|ABC77078.1| chemotaxis protein [Syntrophus aciditrophicus SB]
          Length = 303

 Score =  242 bits (618), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 91/285 (31%), Positives = 164/285 (57%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  IIG+ I    +IGG+    GN  +L QP E +I+ GA +GGF++++P KV+K    S
Sbjct: 19  MLAIIGIVIVFTTVIGGYLLEHGNLAVLFQPAEFLIIFGAAIGGFLISSPSKVVKAVIKS 78

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  IF  K   +  Y + L LL  + Y +++      E+ +D P  S +F+  P++L N 
Sbjct: 79  ISRIFRGKTFDKKDYTEALMLLNGIFYKIRQQGLVSIESDVDSPQESPLFSQYPSILNNT 138

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
                I D +R ++      +E++ L+D E+D+   E ++P  +++ + ++LP +GIV A
Sbjct: 139 HAIDLITDTLRTVMTTTIAPHELDALIDHELDVYYEEMMQPAKSVNFVADALPGLGIVAA 198

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG++  MG +S+ P++LG  IG +L GT +G++  Y    P+   I+    +      +
Sbjct: 199 VLGVVLTMGKISEPPEVLGKCIGAALVGTFIGVLTCYGFVGPMGKNIEHQAGENILYLTV 258

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           +K AL+A++ G+ P+VA+E+GR+V+P ++RPS   + + + Q   
Sbjct: 259 LKVALLAFIGGSAPKVAVEFGRRVIPANDRPSFIEIEEALRQSKG 303


>gi|328545469|ref|YP_004305578.1| Chemotaxis transmembrane protein [polymorphum gilvum SL003B-26A1]
 gi|326415210|gb|ADZ72273.1| Chemotaxis transmembrane protein [Polymorphum gilvum SL003B-26A1]
          Length = 300

 Score =  242 bits (618), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 143/286 (50%), Positives = 196/286 (68%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M+ I+GL I  + +IGGF A+GG   +L QP+E+VI+ G  LG F +ANP+K I D+  S
Sbjct: 1   MTIILGLIIAAVSLIGGFAALGGKVAVLWQPWELVIIIGVALGTFFVANPMKAIVDTLRS 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
             E        +  Y DVL LLY LM  L+   RNE E HI++P  S IF S PTV  N+
Sbjct: 61  TREAVFNAVPKKRDYLDVLALLYALMRELRAKGRNEVEPHIENPQESEIFRSFPTVYRNS 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L TF+CDY R+I+VGNAR++EIE LMDEE+  I  ++LKPY+A+S + E+LPAIGIV A
Sbjct: 121 GLLTFVCDYFRLILVGNARAHEIEALMDEELQTIHRDQLKPYYALSALAEALPAIGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKAMG + QSP+ILG+ IG +L GT +GI LSY+L  P+  ++K  R  + R YII
Sbjct: 181 VLGVIKAMGAIDQSPQILGSLIGAALVGTFVGIFLSYALVAPVAHKVKGVREHRLRPYII 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHN 286
           VK++L+A+MNGA PQ+A+E+GRK +   +RP+I+ V  E +     
Sbjct: 241 VKQSLLAFMNGAPPQIALEHGRKTISAYDRPTIDEVENETMNSGGG 286


>gi|254473335|ref|ZP_05086732.1| chemotaxis MotA protein [Pseudovibrio sp. JE062]
 gi|211957451|gb|EEA92654.1| chemotaxis MotA protein [Pseudovibrio sp. JE062]
          Length = 294

 Score =  242 bits (617), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 140/290 (48%), Positives = 193/290 (66%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M+ ++GL I I  IIGG+ AMGG   +L QPFE++IV GA  G FV+AN  K IKD+G  
Sbjct: 1   MNILVGLVIVIGSIIGGYVAMGGYMKVLWQPFELLIVGGAAFGTFVVANTFKTIKDTGRG 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           + E        +  + D L +LY LM  L+   RN+ E  ID+P  S +F   P VL N 
Sbjct: 61  IHEALMNAKPKKRDHLDTLSVLYGLMRTLRAKGRNDVEQIIDNPAESELFQRFPRVLANV 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            LT+FICDY R+II+GN R +EIE LMDEE+  +  E++KPY A+S   E+LPA+GIV A
Sbjct: 121 SLTSFICDYFRLIIIGNVRPHEIEALMDEELHTLGREEMKPYQALSIAAETLPALGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGI+KAMG + Q P+ILG+ IG +L GT LGI LSY + +P+  +IKS R +++RLYI 
Sbjct: 181 VLGIVKAMGAIDQEPEILGSLIGAALVGTFLGIFLSYGIVSPIAVKIKSIREQRYRLYIE 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK+ L+A+MNGA PQ+A+E+GRK +   +RP+I+ V  E +       A+
Sbjct: 241 VKQTLLAFMNGAAPQIALEHGRKTIGADDRPTIDEVEAETMNAGPVTSAA 290


>gi|312115255|ref|YP_004012851.1| flagellar motor protein MotA [Rhodomicrobium vannielii ATCC 17100]
 gi|311220384|gb|ADP71752.1| flagellar motor protein MotA [Rhodomicrobium vannielii ATCC 17100]
          Length = 289

 Score =  242 bits (617), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 129/290 (44%), Positives = 191/290 (65%), Gaps = 1/290 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M+  +GLF+T+ C++ G+  MGG+  ++ QP E +I+ GA +G F++ANP+KVIKD+G  
Sbjct: 1   MTIALGLFVTLGCMLAGYVWMGGHVAVIWQPAEYLIICGAAIGTFIVANPMKVIKDTGKG 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +++        +  Y  VL  LY LM   K   ++E E HIDDP  S+IF + P VL   
Sbjct: 61  IVDALKNSEPKESDYLAVLGFLYALMREFKNKPKSEVEKHIDDPSKSSIFANYPEVLAKP 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +LT FICDY R+ I+GNAR  EIE LMDEEI  I ++ LKPYHA+  + E+ PA+GIV A
Sbjct: 121 DLTQFICDYARLHIMGNARPAEIEALMDEEIQTIRHDGLKPYHALHAVSEAFPALGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKAM  L + P++LG  I  ++ GT  GI LSY++  P+ +++K+ R KQ  LY++
Sbjct: 181 VLGVIKAMAALDKPPEVLGELIASAMVGTFAGIFLSYAVVAPIATKLKTVREKQLHLYML 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK+  +A+MNGA+  VA+E+GRK++   ERP+I  V + +       KA+
Sbjct: 241 VKQTFLAFMNGAMASVAVEHGRKMISAHERPTINRVEESL-TGTPEAKAA 289


>gi|149203115|ref|ZP_01880086.1| flagellar motor protein MotA [Roseovarius sp. TM1035]
 gi|149143661|gb|EDM31697.1| flagellar motor protein MotA [Roseovarius sp. TM1035]
          Length = 289

 Score =  242 bits (617), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 87/289 (30%), Positives = 156/289 (53%), Gaps = 3/289 (1%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  IIG+ +  + + GG+ A GG   ++++  PFE +++ GA +G F+++N    IK + 
Sbjct: 1   MVGIIGIVVIFVMVFGGYVAAGGKLGLILKALPFEFMMIGGAAVGAFLISNDAPAIKHTL 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
             + ++F         Y D+L LL+ L+   ++      E HI+ P +S IF+  P +L 
Sbjct: 61  GDIAKVFKGPKWKPQDYRDLLCLLFELIRLGRQNPI-AVEEHIESPNDSAIFSKYPKILA 119

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           + E    I D +R   +     +++E ++++ I+  L+  L   HA+  M + LPA+GIV
Sbjct: 120 DAEAVALISDTLRSASMNYDDPHQVEEVLEKRIEANLHHALHSSHALQTMADGLPALGIV 179

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG+IK M ++ Q P+ILG  IG +L GT LG+ LSY L  P  +++K    +    Y
Sbjct: 180 AAVLGVIKTMASIDQPPEILGKMIGGALVGTFLGVFLSYGLVGPFAAKVKDVVEEDGHFY 239

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
            ++++ L+A ++     + IE GR+  P  +RPS   + + +     + 
Sbjct: 240 QLIREVLVANLHNHATNICIEVGRQNTPNHKRPSFNELEEALKSLKQDA 288


>gi|126738568|ref|ZP_01754273.1| flagellar motor protein MotA [Roseobacter sp. SK209-2-6]
 gi|126720367|gb|EBA17073.1| flagellar motor protein MotA [Roseobacter sp. SK209-2-6]
          Length = 289

 Score =  242 bits (617), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 87/289 (30%), Positives = 159/289 (55%), Gaps = 3/289 (1%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  I+G+ I  + + GG+   GG   I+++  PFE++++ GA +G F++ N    +K + 
Sbjct: 1   MIGIVGILIIFVMVFGGYLLAGGKMAIILKSLPFEMMMIGGAAVGAFLIGNDASGVKHTL 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
             + ++F       D Y D+L LL+ L+   +  +  E E HI+DP NS++F   P +L 
Sbjct: 61  KDVGKVFKGPKWKSDDYRDLLCLLFSLIRIAR-ANPVEVEQHIEDPENSSVFNKYPKILG 119

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           ++E    ICD MR   +     +++E ++++ ++  L+  +   HA+  M + LPA+GIV
Sbjct: 120 DSEAVNLICDTMRSASMNYDDPHQVEEVLEKRMEANLHHAMHSSHALQTMADGLPALGIV 179

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG+IK MG++ Q P++LG  IG +L GT LG+ L+Y L  P   ++K+   +    Y
Sbjct: 180 AAVLGVIKTMGSIDQPPEVLGKMIGGALVGTFLGVFLAYGLVGPFAGKVKTITEEDAHFY 239

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
            ++++ L+A ++     + IE GR+  P   RP    + + +     + 
Sbjct: 240 QLIREVLVANLHNHAAAICIEVGRQNTPSHIRPGFSELEEALRSVKQDA 288


>gi|319406969|emb|CBI80606.1| Chemotaxis protein motA [Bartonella sp. 1-1C]
          Length = 291

 Score =  241 bits (616), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 132/290 (45%), Positives = 200/290 (68%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  IIGL I   CI+GG+ AMGG+  +L+QP+E VI+ G+ +G F+++NP+  IKD+  +
Sbjct: 1   MGVIIGLIIIFGCILGGYVAMGGHLDVLVQPWEFVIILGSAIGTFIVSNPIPAIKDTLQA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            +E        Q  +  +L LLY+LM  ++  S++E E H+D+P  S +F   P +L++ 
Sbjct: 61  TIEAMKDAVPKQKDFLSLLGLLYVLMREMRSKSKSEMEAHVDNPKESALFQQYPLILKDE 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            LT FICDY R+I++GN R +EIE LMDEEI  I Y+  KPY A+ +M ++LPA+GIV A
Sbjct: 121 SLTNFICDYCRLIVMGNTRHFEIEALMDEEIHTISYDSQKPYQAMQNMADALPALGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG++KAMG +S+ P++LG  IG +L GT  GI  +Y +  PL S+IK+ R K+ R+YI+
Sbjct: 181 VLGVVKAMGAISEPPEVLGHLIGAALVGTFAGIFFAYGIFGPLASKIKTVRNKKARIYIV 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK+ L+AYMNGA+PQ+A+EYGRK +   +RP+I+I+ Q  +    ++K +
Sbjct: 241 VKQTLLAYMNGAMPQIALEYGRKTISAKDRPTIDIMEQHAIASQGSEKEA 290


>gi|226225702|ref|YP_002759808.1| chemotaxis MotA protein [Gemmatimonas aurantiaca T-27]
 gi|226088893|dbj|BAH37338.1| chemotaxis MotA protein [Gemmatimonas aurantiaca T-27]
          Length = 285

 Score =  241 bits (615), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 79/285 (27%), Positives = 150/285 (52%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  IIGL +    +IGG+    G   +L Q  E +I+ GAGLG  ++ANP  V+K     
Sbjct: 1   MFVIIGLVVVFGSVIGGYVMHHGQIAVLFQINEFIIIGGAGLGTLIIANPPAVLKACVAQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            L +      G   Y ++L++LY +    +K      E HI+ P +S IF   P+   N+
Sbjct: 61  TLGLLKPNPYGASAYAELLQVLYEVFQKARKDGLVGLEAHIEAPESSDIFQKYPSFTNNH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
              + +CD +++++ G    + +  ++D +++   +E +   HAI+ +G+++P  GIV A
Sbjct: 121 HAVSLLCDTLKVLLTGTVEDHNLAEILDVDLEKHHHEGMLAPHAITTVGDAMPGFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+I  MG++  +   +G  +  +L GT +GI+L+Y +  P+   +++    +H   + 
Sbjct: 181 VLGVIITMGSIGGAASEIGEKVAAALVGTFVGILLAYGVFGPVAKAMENRLHAEHDYMLC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           ++ AL+++  G  P  A+E+ R+ +   ERPS   + +   +   
Sbjct: 241 IRTALLSFARGDAPMTAVEFSRRNIEPHERPSFTELEELTRKKAA 285


>gi|187478166|ref|YP_786190.1| flagellar motor protein MotA [Bordetella avium 197N]
 gi|115422752|emb|CAJ49280.1| chemotaxis protein [Bordetella avium 197N]
          Length = 291

 Score =  240 bits (613), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 106/287 (36%), Positives = 169/287 (58%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  +IG  + I+ ++G F  +GG+   L QPFE+ ++AGA LG F+  N  K +     +
Sbjct: 1   MLVVIGYAVVIVAVVGSFIGLGGHLGALYQPFELTLIAGAALGAFLAGNSRKSLVLVRQA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +   F      +D Y +++ LLY+L+   ++      E+HI+DP +S IF   P ++++ 
Sbjct: 61  IPRAFKSAPYSKDLYMELMALLYVLLNKARREGLMAIESHIEDPSSSPIFNEYPRIMKDP 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +L  FI DY+R++I GN  S+EIE LMDEEI+   +E   P HA+  + + LPA GIV A
Sbjct: 121 KLMEFITDYLRIMISGNMSSFEIETLMDEEIETFRHEHEVPTHALQQVADGLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKA+  + Q P +LG  I  ++ GT LG++L+Y    PL S+++    +  ++   
Sbjct: 181 VLGVIKALAAVDQPPAVLGDLISKAMVGTFLGVLLAYGFVAPLASRVERRTTESVKVLEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
           +K  L+A MNG  PQ+A+E+GRKVL  + RPS   + + V Q     
Sbjct: 241 IKVTLLASMNGYPPQLAVEFGRKVLFSAVRPSFGELEEHVRQAKTTA 287


>gi|85058001|ref|YP_453703.1| flagellar motor protein MotA [Sodalis glossinidius str.
           'morsitans']
 gi|84778521|dbj|BAE73298.1| chemotaxis protein MotA [Sodalis glossinidius str. 'morsitans']
          Length = 298

 Score =  240 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 98/286 (34%), Positives = 156/286 (54%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  I  + I GGF    G    L QP E +I+ GAGLG F++ N  K I  +  S
Sbjct: 1   MLVIVGYIIVFMSIFGGFLLAEGQLGALFQPAEFMIIVGAGLGTFIVGNNGKAIFATLKS 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
              +F      +  Y DV+ L+Y L+   ++      E  IDDP+NS IF   P++L + 
Sbjct: 61  FPRLFHSSRYNKAMYMDVMALMYRLLSKSRQSGLITLEKEIDDPHNSVIFAHYPSLLADK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  F+ DY+R+++ GN   YEIE LM+EEI+    E   P  ++  +G++LPA GI+ A
Sbjct: 121 LVIDFLIDYLRLMVSGNLNVYEIEALMNEEIETYEQENDIPVSSLLQVGDALPAFGIIAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+    +    LG  I  ++ GTLLGI+L+Y    PL + +K    +  ++   
Sbjct: 181 VMGVVNALAAADRPAGELGALIANAMVGTLLGILLAYGCVMPLGALLKQKGDEHIKMLQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHN 286
           ++  L++ +NG  P +AIE+GRK L  SERPS + +   + +    
Sbjct: 241 IRVTLLSSLNGYAPPIAIEFGRKTLYSSERPSFDELEAHLRRIKKA 286


>gi|212709469|ref|ZP_03317597.1| hypothetical protein PROVALCAL_00511 [Providencia alcalifaciens DSM
           30120]
 gi|212687807|gb|EEB47335.1| hypothetical protein PROVALCAL_00511 [Providencia alcalifaciens DSM
           30120]
          Length = 300

 Score =  240 bits (612), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 96/288 (33%), Positives = 156/288 (54%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
             +IG  I    +IGG+  +GG+   L QP E VI+ GAGLG FV+ N  K I      L
Sbjct: 7   LILIGYIIVTAAVIGGYVMVGGHLGALYQPAEFVIILGAGLGAFVVGNSGKAIVALCKVL 66

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
             +F   +  +    D++ LL+ L+   ++      E  I++P  S IF   P +L++  
Sbjct: 67  PGLFRRSSYNKAMSMDLMALLFQLLNKSRQQGLLALEKDIENPQESEIFALYPRILKDKT 126

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
              FI DY+R+++  N +++EIE LMDEE++    E   P   ++ +GES+PA GIV A+
Sbjct: 127 AMMFIVDYLRLMVTSNLQAHEIEALMDEELETFRQENEVPASGLNMVGESMPAFGIVAAV 186

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           LG++ A+    +    LG  I  ++ GT LGI+++Y    PL S I+    +Q ++   +
Sbjct: 187 LGVVNALAAADRPAGELGALIAHAMVGTFLGILVAYGFILPLASLIRQRSSEQLKMMECI 246

Query: 242 KKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKA 289
           K   ++ + G  PQ+A+E+GRKVL   +RPS   +  +V +     +A
Sbjct: 247 KVTFLSSLQGYAPQIAVEFGRKVLFSVDRPSFMELEDKVREVKIGNRA 294


>gi|170741397|ref|YP_001770052.1| chemotaxis MotA protein [Methylobacterium sp. 4-46]
 gi|168195671|gb|ACA17618.1| chemotaxis MotA protein [Methylobacterium sp. 4-46]
          Length = 290

 Score =  239 bits (611), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 146/290 (50%), Positives = 200/290 (68%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  +IGL I +  +IGGF A GG+  ++ QP+E VI+ G  +G FV+ANP+K + DSG  
Sbjct: 1   MGVLIGLVIALGAMIGGFLAEGGHLAVIWQPWEFVIIGGMAIGTFVIANPMKTVVDSGKG 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           LLE    +   +  Y  +L LL+ LM  LK   RNE E H+DDP NS+IF + P +L+N 
Sbjct: 61  LLEAVTDRVPKRKDYLSLLGLLHALMRELKAKPRNEVEPHLDDPANSSIFKNYPDILKNL 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           ELT FICDY R+I++GNAR +EIE LMDEEI     + LKPY +IS + E+LPA+GIV A
Sbjct: 121 ELTMFICDYARLILIGNARPHEIEALMDEEIGTHKRDALKPYASISTVAEALPALGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGI+ AMG L Q P +LG  IG +L GTL GI LSY +  PL S++K  R KQ R+Y+I
Sbjct: 181 VLGIVNAMGALDQPPHVLGHLIGAALIGTLGGITLSYGILAPLASKVKMVRDKQTRVYVI 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK++LIAYMNGA+PQ+A+E+GRK + L++RP+I+ V    +     ++A+
Sbjct: 241 VKQSLIAYMNGALPQIAVEHGRKGISLADRPTIDEVETATVGGGQQREAA 290


>gi|304321131|ref|YP_003854774.1| Flagellar motor protein MotA [Parvularcula bermudensis HTCC2503]
 gi|303300033|gb|ADM09632.1| Flagellar motor protein MotA [Parvularcula bermudensis HTCC2503]
          Length = 285

 Score =  239 bits (610), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 85/286 (29%), Positives = 166/286 (58%), Gaps = 3/286 (1%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  I+GL +T++ + GG+   GG   I++   P+E++++ GA +G F+ AN    IK +G
Sbjct: 1   MLAIVGLVVTLVMVFGGYLFAGGKLGIILHSLPYEMMMIGGAAVGAFLAANDFTRIKHAG 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
             L+  F      +  Y ++L L++ L+   +  S  + E HI++P  S IF   P + +
Sbjct: 61  GDLVAAFAGAKWKKQDYQELLCLMHELIVVFR-ESPVDVEKHIEEPGESEIFGRYPRIAK 119

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           +      ICD +R +++     +++E L+++++D    E +   HA+  + ++LPA+GIV
Sbjct: 120 DKGAVELICDTIRSMLLNFDDVHQVEELLEKQLDQKKEESMHGAHAVEQVADALPALGIV 179

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG+IK M ++ + P++LG  IG +L GT LG+ LSY++  P  +++K+ R ++H+ Y
Sbjct: 180 AAVLGVIKTMASIDKPPEVLGKMIGGALVGTFLGVFLSYAVVGPFAARMKAVREEEHQFY 239

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYN 284
            ++++ L++ ++   P + +E GR+ +P   RPS   + + +    
Sbjct: 240 ELIREVLVSSLHKHAPNICVEVGRRHVPSVMRPSFNELEEALKGAA 285


>gi|94970508|ref|YP_592556.1| chemotaxis protein [Candidatus Koribacter versatilis Ellin345]
 gi|94552558|gb|ABF42482.1| chemotaxis protein [Candidatus Koribacter versatilis Ellin345]
          Length = 301

 Score =  239 bits (609), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 91/282 (32%), Positives = 159/282 (56%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  IIG+ +   C+IGGF    G   +L+QP E++I+ GA  G  ++ANP++++K     
Sbjct: 1   MFAIIGIVVVFGCVIGGFLMEKGQIMVLLQPAELLIIGGAAAGTILVANPMRIVKKIVSG 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           LL +       Q  Y D LK++Y L+   ++      E+ I++P  S IFT   +   ++
Sbjct: 61  LLGVLKGSKYNQTAYVDSLKMMYELLNKARRQGLVALESDIEEPDKSPIFTKYKSFTSDH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  F+CD MRM + G    ++++ ++D ++++   E  +P  +++ + +SLP +GIV A
Sbjct: 121 HVRDFVCDTMRMSVTGGVDPFDVDQMIDTDMEVHHAEITEPVASLTTVADSLPGLGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG++  MG L   P+ +G  +  +L GT LGI+L Y +  PL S +  T  ++H  Y +
Sbjct: 181 VLGVVITMGALGGPPEEIGHKVAAALVGTFLGILLCYGMVGPLASNMAKTADEEHAYYGV 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQ 282
           ++  +IA+M G  P +AIE GR+ +P   RPS   V +   +
Sbjct: 241 LRVVMIAFMKGISPLLAIEMGRRAIPGYVRPSFADVEKACRE 282


>gi|32490781|ref|NP_871035.1| flagellar motor protein MotA [Wigglesworthia glossinidia
           endosymbiont of Glossina brevipalpis]
 gi|25165987|dbj|BAC24178.1| motA [Wigglesworthia glossinidia endosymbiont of Glossina
           brevipalpis]
          Length = 296

 Score =  239 bits (609), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 97/286 (33%), Positives = 160/286 (55%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  +  + + GGF    G    L QP E++I+ GAGLG F++ N  K I  +  +
Sbjct: 1   MLIIVGYCVVFISVFGGFLLAEGQIGALFQPVELLIILGAGLGAFIVGNNGKAIFATIKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
             ++F      ++ Y DV+ L+Y L+   ++      E  ID P  S IF+S P ++E++
Sbjct: 61  FPKLFHSSKYNKNMYMDVMTLMYRLLSKSRQSGLISLEKDIDFPKKSKIFSSYPALIEDD 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FI DY R+++ GN  SYEIE LM+EEI+    E   P  ++  +G++LPA GIV A
Sbjct: 121 LIIDFIVDYFRLMVSGNLNSYEIEALMNEEIETCEQEHEVPITSLLQVGDALPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+    +    LG  I  ++ GT LGI+L+Y    PL + +K    +  ++   
Sbjct: 181 VMGVVNALAAADRPAAELGELIAHAMVGTFLGILLAYGCVMPLGALLKQKSDEHIKMLQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHN 286
           +K  L++ +NG  PQ+AIE+GRK+L   ERPS   + + + +   +
Sbjct: 241 IKITLLSSINGYAPQIAIEFGRKILYSPERPSFNELEEHIRKVKKS 286


>gi|121596102|ref|YP_987998.1| MotA/TolQ/ExbB proton channel [Acidovorax sp. JS42]
 gi|120608182|gb|ABM43922.1| MotA/TolQ/ExbB proton channel [Acidovorax sp. JS42]
          Length = 286

 Score =  239 bits (609), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 98/283 (34%), Positives = 154/283 (54%), Gaps = 2/283 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILI--QPFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  ++G  IT  C+ G F A GGN  +L+   PFE++ + GA LG F++ N  KV+K + 
Sbjct: 1   MLVLLGYIITFGCVFGVFVAHGGNVQVLLTALPFEMITIGGAALGSFIVTNQPKVLKATM 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
            +L ++F      +  Y +++ +LY ++   +K      E  ++ P  S +F   PTV  
Sbjct: 61  ATLPQVFKGNKYTKARYMELMAMLYEILQKARKEGLMSIEQDVESPKESELFKKFPTVGS 120

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           +  +  F  DY+RM++ GN  ++EIE LMD EI+    E   P  A++ +  +LPA GIV
Sbjct: 121 DPHVVEFTTDYLRMMVSGNLNAHEIEALMDSEIETHHAEAHAPVAALTRLAGALPAFGIV 180

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG++  MG++ Q P +LG  I  +L GT LGI+L+Y    PL   ++       + Y
Sbjct: 181 AAVLGVVNTMGSVGQPPAVLGGMIASALVGTFLGILLAYGAVEPLAGLLEQKAADAAKEY 240

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
             +K  L+A M G  P  +IE+GRKVL   +RP    +   V 
Sbjct: 241 ECIKSTLLASMQGYNPATSIEFGRKVLFSGDRPGFAELEAHVK 283


>gi|260574391|ref|ZP_05842395.1| flagellar motor protein MotA [Rhodobacter sp. SW2]
 gi|259023287|gb|EEW26579.1| flagellar motor protein MotA [Rhodobacter sp. SW2]
          Length = 289

 Score =  239 bits (609), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 83/289 (28%), Positives = 159/289 (55%), Gaps = 3/289 (1%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILI--QPFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  I+GL +  + + GG+   GG+  +++   PFE++I+ GA +G F++AN L  +K + 
Sbjct: 1   MIGIVGLLVIFIMVFGGYMLAGGHIMVVLAALPFEMIIIGGAAVGTFLLANDLATVKHTL 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
             + ++F         Y D+L LL+ L+   +  +    E HI++P  S++F   P + +
Sbjct: 61  KDIGKVFKGPKWKPADYRDLLCLLFELIRIAR-ANPVGLEEHIENPAESSVFGRYPKIQK 119

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           ++E    ICD +R   +     +++E ++D+ ++      L   HA+  + ++LPA+GIV
Sbjct: 120 DHESVELICDTLRAASMNYDDPHQVEEVLDKRMETSHTHALHTSHALQSIADALPALGIV 179

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG+IK MG + Q P ILG  IG +L GT LG+ L+Y +  P ++++++   +    Y
Sbjct: 180 AAVLGVIKTMGAIDQPPAILGKMIGSALVGTFLGVFLAYGIVGPFSTRVQAVVEEDAHFY 239

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
           +++++ L+A ++     + IE GR+  P   RPS   + + +     + 
Sbjct: 240 MLIREVLVANLHNHPANICIEVGRQNTPHHMRPSFADLEEALRSLKQDA 288


>gi|146278782|ref|YP_001168941.1| flagellar motor protein MotA [Rhodobacter sphaeroides ATCC 17025]
 gi|145557023|gb|ABP71636.1| MotA/TolQ/ExbB proton channel [Rhodobacter sphaeroides ATCC 17025]
          Length = 289

 Score =  238 bits (607), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 83/289 (28%), Positives = 156/289 (53%), Gaps = 3/289 (1%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  I+G+ +  + + GG+   GG   I+++  PFE++++ GA +G F+++N L  +K + 
Sbjct: 1   MFGIVGVIVLFVMVFGGYMMAGGKIGIILKALPFEMIMIGGAAVGSFLLSNDLFAVKQTL 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
             + ++F         Y D+L LL+ L+   K       E HI++P  S +F+  P +  
Sbjct: 61  KDVGKVFKGPRWKPADYRDLLCLLFELVRIAKVNPV-GLEEHIENPEASPVFSRYPKIQH 119

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           +++    ICD +R   +     +++E ++D+ ++   +  L   HA+  M ++LPA+GIV
Sbjct: 120 DHDAIELICDTLRAASMNYDDPHQVEEVLDKRVEKAQHHALHSSHALQSMADALPALGIV 179

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG+IK M ++ Q P+ILG  IG +L GT LG+ L+Y L  P  +++++   +    Y
Sbjct: 180 AAVLGVIKTMSSIDQPPEILGKMIGGALVGTFLGVFLAYGLVGPFATRVRAVIEEDGHFY 239

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
            ++++ LIA ++     + IE GR+  P   RPS   + + +       
Sbjct: 240 NLIREVLIANLHNHPANMCIEVGRQNTPHHVRPSFTDLEEAIRALKQEA 288


>gi|260221394|emb|CBA29912.1| Chemotaxis protein motA [Curvibacter putative symbiont of Hydra
           magnipapillata]
          Length = 285

 Score =  238 bits (607), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 98/284 (34%), Positives = 156/284 (54%), Gaps = 2/284 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  I+G  I I C+ G F   GGN  ++++  PFE++ + GA +G FV  N +KVIK + 
Sbjct: 1   MFVIVGWLICIACVFGVFIIHGGNISVVLKALPFELITIGGATVGAFVANNQMKVIKATI 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
             L   F      +D Y +++ LL+ L+   +K      E  +++P  S IF   P V  
Sbjct: 61  KGLGSCFKGSKYTKDRYMELMALLFDLLQKARKEGLMAIEKDVEEPEQSEIFKKHPNVGS 120

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           ++ +  F+ DY+RM++ GN  ++EIEN+MD  I+    E      AI  +   LPA GIV
Sbjct: 121 DHHVVEFVTDYLRMMVSGNLNAHEIENIMDGAIEAHHVEAHAAVAAIQRIAGGLPAFGIV 180

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG++  MG++ Q P +LG  IG +L GT LGI+L+Y+   PL   ++    +  +  
Sbjct: 181 AAVLGVVNTMGSVGQPPAVLGGMIGSALVGTFLGILLAYAFAEPLAGLLEQKVEEGGKEL 240

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQ 282
             +K  L+A M G  P  A+E+GR++L  +ERP+   +   V +
Sbjct: 241 QCIKTILLASMQGYNPSTAVEFGRQILFSTERPTFSELEAHVKK 284


>gi|222112257|ref|YP_002554521.1| mota/tolq/exbb proton channel [Acidovorax ebreus TPSY]
 gi|221731701|gb|ACM34521.1| MotA/TolQ/ExbB proton channel [Acidovorax ebreus TPSY]
          Length = 286

 Score =  237 bits (606), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 99/283 (34%), Positives = 154/283 (54%), Gaps = 2/283 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILI--QPFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  I+G  IT  C+ G F A GGN  +L+   PFE++ + GA LG F++ N  KV+K + 
Sbjct: 1   MLVILGYIITFGCVFGVFVAHGGNVQVLLTALPFEMITIGGAALGSFIVTNQPKVLKATM 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
            +L ++F      +  Y +++ +LY ++   +K      E  ++ P  S +F   PTV  
Sbjct: 61  ATLPQVFKGNKYTKARYMELMAMLYEILQKARKEGLMSIEQDVESPKESELFKKFPTVGS 120

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           +  +  F  DY+RM++ GN  ++EIE LMD EI+    E   P  A++ +  +LPA GIV
Sbjct: 121 DPHVIEFTTDYLRMMVSGNLNAHEIEALMDSEIETHHAEAHAPVAALTRLAGALPAFGIV 180

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG++  MG++ Q P +LG  I  +L GT LGI+L+Y    PL   ++       + Y
Sbjct: 181 AAVLGVVNTMGSVGQPPAVLGGMIASALVGTFLGILLAYGAVEPLAGLLEQKAADAAKEY 240

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
             +K  L+A M G  P  +IE+GRKVL   +RP    +   V 
Sbjct: 241 ECIKSTLLASMQGYNPATSIEFGRKVLFSGDRPGFVELEAHVK 283


>gi|255261774|ref|ZP_05341116.1| chemotaxis protein MotA [Thalassiobium sp. R2A62]
 gi|255104109|gb|EET46783.1| chemotaxis protein MotA [Thalassiobium sp. R2A62]
          Length = 289

 Score =  237 bits (606), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 87/289 (30%), Positives = 153/289 (52%), Gaps = 3/289 (1%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  ++G+ I  + + GG+   GG   I+++  PFE++++ GA  G FV++N    IK + 
Sbjct: 1   MIGLVGIVIIFVMVFGGYILAGGKMGIILKSLPFEMIMIGGAAAGAFVLSNDKASIKHTL 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
             L ++F       D Y D+L LL+ L+   +  +    E HI+ P  S IF     +L+
Sbjct: 61  KDLQKVFKGPKWKPDDYRDLLCLLFELIRIARADAI-ALEVHIEAPEKSKIFAKYENILQ 119

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           + E  + ICD +R   +     +++E ++D  I+  L  K+   HA+  + + LPA+GIV
Sbjct: 120 DQEAVSLICDTLRTGSMNYDDPHQVEEVLDNRIEESLSRKMHSTHALQTIADGLPALGIV 179

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG+IK M ++ Q P++LG  IG +L GT LG+ L+Y    P  +++K+   +    Y
Sbjct: 180 AAVLGVIKTMASIDQPPEVLGKMIGGALVGTFLGVFLAYGFVGPFATKVKAVIEEDAHFY 239

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
            ++++ LIA ++     + IE GR+  P   RPS   +   + +     
Sbjct: 240 QLIREVLIANLHKHATNICIEVGRQNTPNHVRPSYSELEDALKETKKVA 288


>gi|217976216|ref|YP_002360363.1| MotA/TolQ/ExbB proton channel [Methylocella silvestris BL2]
 gi|217501592|gb|ACK49001.1| MotA/TolQ/ExbB proton channel [Methylocella silvestris BL2]
          Length = 323

 Score =  237 bits (605), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 140/293 (47%), Positives = 205/293 (69%), Gaps = 3/293 (1%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++ +IG  +T+ C++GGF AMGG+  ++ QP+E VI+ G  LG F++AN L  IKD+G +
Sbjct: 31  LAFLIGTIVTLGCMLGGFAAMGGHLSVIFQPWEFVIILGVSLGTFIIANSLATIKDTGAA 90

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +++    +   +  Y DVL +LY LM  L+  +R+E E H+D+P  S IF + P VL + 
Sbjct: 91  IVDAVLDRGPTERDYLDVLGVLYTLMRELRGKARSEVEQHVDNPAESAIFKNFPKVLADV 150

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            LT+FICDY R+II+GNAR++EIE LMDEEI  + ++KLKPYHA+  + + LPAIGIV A
Sbjct: 151 NLTSFICDYCRLIIIGNARTHEIEALMDEEIHTLTHDKLKPYHALQSVADGLPAIGIVAA 210

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG++KAMG L QSP+ILG  IG +L GT  GI +SY + +PL  +IK  R  + RLYII
Sbjct: 211 VLGVVKAMGALDQSPEILGGLIGAALIGTFAGIFVSYGVVSPLAHKIKVARAVRCRLYII 270

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH---NKKAS 290
           VK+ L+A+MNGA+PQ+A+E+GRK +   +RPSI++V  E +        ++A+
Sbjct: 271 VKQTLLAFMNGAMPQIALEHGRKTIASHDRPSIDMVENETVSGASKPNQQQAA 323


>gi|332531609|ref|ZP_08407506.1| MotA/TolQ/ExbB proton channel [Hylemonella gracilis ATCC 19624]
 gi|332038972|gb|EGI75401.1| MotA/TolQ/ExbB proton channel [Hylemonella gracilis ATCC 19624]
          Length = 285

 Score =  237 bits (605), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 100/284 (35%), Positives = 155/284 (54%), Gaps = 2/284 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  IIG  + +L I G F   GGN  IL++  PFE+  + G  LG FV  N  KV++ + 
Sbjct: 1   MIVIIGYAVAMLAIFGTFVLHGGNVGILLEALPFEMATIFGGALGAFVAGNQPKVLRATM 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
             +  +       ++ Y D++ LLY ++   +K      E  +++P+ S +F + P V  
Sbjct: 61  AQVPTVLKGSKYTKERYMDLMALLYDILQKARKEGLMAIEKDVEEPHESPLFQAHPIVGN 120

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           ++ +  F  DY+RM++ GN  ++EIE LMD EID    E   P  A+  +  +LPA GIV
Sbjct: 121 DHHVVEFTTDYLRMMVSGNLNAHEIETLMDSEIDTHHQEAHAPAMAVLRLAGALPAFGIV 180

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG++  MG++ Q P ILG  I  +L GT LGI+L+Y++  PL + ++       +  
Sbjct: 181 AAVLGVVNTMGSVGQPPAILGGMIASALVGTFLGIMLAYAIFEPLGTLLEQKAADGTKEL 240

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQ 282
             +K  L+A M G  P  AIE+GRKVL  +ERP    +   V +
Sbjct: 241 QCIKSTLLASMQGYNPATAIEFGRKVLFSTERPGFLELEAHVRK 284


>gi|311279212|ref|YP_003941443.1| flagellar motor protein MotA [Enterobacter cloacae SCF1]
 gi|308748407|gb|ADO48159.1| flagellar motor protein MotA [Enterobacter cloacae SCF1]
          Length = 296

 Score =  237 bits (605), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 101/286 (35%), Positives = 165/286 (57%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++G  + +  + GG+   GG+   L QP E++I+ GAG+G F++ N  K IK +  +
Sbjct: 1   MLILLGYLVVLGTVFGGYALTGGHLGALYQPAELIIIGGAGIGAFIVGNNGKAIKGTMKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y D+L LLY LM   ++      E  I++P  S IF S P +L + 
Sbjct: 61  LPLLFRRSKYTKSMYMDLLALLYRLMAKSRQQGMFSLERDIENPTESEIFASYPRILADK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FI DY+R+II GN  ++EIE LMDEEI+    E   P ++++ +G+SLPA GIV A
Sbjct: 121 VMLDFIVDYLRLIISGNMNTFEIEALMDEEIETHESEAEVPANSLAMVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+G+  +    LG+ I  ++ GT LGI+L+Y   +PL + ++    +  ++   
Sbjct: 181 VMGVVHALGSADRPAAELGSLIAHAMVGTFLGILLAYGFISPLATVLRQKSAETTKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHN 286
           VK  L++ +NG  P +A+E+GRK L  SERPS   + + V    + 
Sbjct: 241 VKITLLSNLNGYAPPIAVEFGRKTLYSSERPSFIELEEHVRAVRNP 286


>gi|226944521|ref|YP_002799594.1| Fagellar motor protein [Azotobacter vinelandii DJ]
 gi|226719448|gb|ACO78619.1| Fagellar motor protein [Azotobacter vinelandii DJ]
          Length = 291

 Score =  237 bits (605), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 92/286 (32%), Positives = 160/286 (55%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   +GL + +L + GG+   GG+   L QP E++I+ GA LG F+ AN  K+IK +  +
Sbjct: 1   MLIALGLIVVMLSVFGGYALSGGSLGPLYQPLELLIIGGAALGAFIAANNGKIIKATLGA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
              +    +  +  Y +++ LLY L+   ++      E  I++P  S +F   P V+++ 
Sbjct: 61  FSRLRRTNSYDKALYLELMSLLYNLLSKARREGMLAIEKEIENPAESALFGECPKVVQDP 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            + TF+ DY+R++I GN  ++E++ LM  EI+   +E   P  A++ + ++LPA GIV A
Sbjct: 121 MIVTFLTDYLRLMISGNMAAHELDELMVHEIEEFEHEAHLPVDALTKVSDALPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++KA+      P  +G  I  +L GT LGI+L+Y +  P  S+I     +  ++   
Sbjct: 181 VMGVVKALSMADAGPDEMGLMIAHALVGTFLGILLAYGVVAPAASRIDRQVGEAVKMLQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHN 286
           ++  L+A +NG  PQ+A+E+GRK L  +ERPS   + + V      
Sbjct: 241 MRVTLLASLNGYAPQLAVEFGRKALHSAERPSAGELEEHVRNGKGA 286


>gi|254488786|ref|ZP_05101991.1| chemotaxis MotA protein [Roseobacter sp. GAI101]
 gi|214045655|gb|EEB86293.1| chemotaxis MotA protein [Roseobacter sp. GAI101]
          Length = 289

 Score =  237 bits (605), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 86/289 (29%), Positives = 154/289 (53%), Gaps = 3/289 (1%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  I+G+    + + GG+ A GG   I+++  PFE  ++ GA  G F+++N L  +K + 
Sbjct: 1   MIGIVGIITIFVMVFGGYLAAGGKMGIILKSLPFEFTMIGGAAAGAFLISNDLPAVKHTL 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
             + ++F       + Y D+L LL+ L+   ++    E E HI++P  STIF+  P +L 
Sbjct: 61  KDVGKVFKGPKWKHEDYRDLLCLLFELVRLARQNPI-EIEPHIENPMESTIFSKYPKILT 119

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           + E    ICD MR   +     +++E ++++ ++  L   L   HA+  + + LPA+GIV
Sbjct: 120 DAEAIAMICDTMRSASMNYDDPHQVEEVLEKRMEANLEHSLHSSHALQTIADGLPALGIV 179

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG+IK M ++ Q P+ILG  IG +L GT LG+ L+Y L  P  +++     +    Y
Sbjct: 180 AAVLGVIKTMASIDQPPEILGKLIGGALVGTFLGVFLAYGLVGPFAAKVADVTKEDGHFY 239

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
            ++++ L+A ++     + IE GR+  P   RP+   + + +       
Sbjct: 240 NLIREVLVANLHNHATNICIEVGRQNTPSHCRPTFSELEEAIKALKQGA 288


>gi|194364217|ref|YP_002026827.1| flagellar motor protein MotA [Stenotrophomonas maltophilia R551-3]
 gi|194347021|gb|ACF50144.1| flagellar motor protein MotA [Stenotrophomonas maltophilia R551-3]
          Length = 284

 Score =  237 bits (605), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 90/284 (31%), Positives = 155/284 (54%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  + I+ ++GG+    G    L QP+E+VI+ GA LG F++  P K +K +  +
Sbjct: 1   MLIIVGFLVVIISVLGGYLGAHGRLGALWQPYELVIIGGAALGAFLVGTPAKTVKQTLQA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           ++ +F      Q  Y DVL L+Y L+   ++      E+H++ P  S +F + P V  ++
Sbjct: 61  MVGVFKGPRYKQQDYIDVLSLVYELLNKARREGFMALEDHVERPAESALFGNYPKVQADH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FI D +R++I  N   +E+E L++ E++    E + P   ++ + + LP  GIV A
Sbjct: 121 HLIDFITDCLRLMIGSNIEPHELEPLLELELEKHHAEAMAPSQVLTKVADGLPGFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGI+  MG++      +G  +  +L GT LGI+L Y    P+ S +++   +  R+Y  
Sbjct: 181 VLGIVITMGSIGGDIVEVGGHVAGALVGTFLGILLGYGFVGPMASAMEARAEQDSRIYES 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYN 284
           VK AL+A + G  P++A+E+ RK LP + RP+     Q +    
Sbjct: 241 VKTALLACLRGYNPKIALEFARKTLPSNVRPAFSDFEQHLKTVK 284


>gi|89056675|ref|YP_512126.1| flagellar motor protein MotA [Jannaschia sp. CCS1]
 gi|88866224|gb|ABD57101.1| chemotaxis protein MotA [Jannaschia sp. CCS1]
          Length = 288

 Score =  237 bits (604), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 86/289 (29%), Positives = 162/289 (56%), Gaps = 3/289 (1%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  I+G+ + ++ + GG+   GG   I+++  PFE +++ GA LG F+++N    IK + 
Sbjct: 1   MLGIVGIAVVLVMVFGGYALAGGKFGIILKALPFESMMIMGAALGAFLISNDKGSIKATI 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
            +L+++F         Y D+L LLY L+   ++ +    E HI++P  S IF   P +L+
Sbjct: 61  SALIKVFKGPTWKDSDYRDLLCLLYELIRLQRQNAV-AVEEHIENPEGSEIFGRYPKILK 119

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           ++E    ICD MR   +     +++E ++D+ ++  ++ ++   HA+  + + LPA+GIV
Sbjct: 120 DHEAVELICDTMRSAAMNYNDPHQVEEVLDKRLEQNVHHQMHGSHAMQTVADGLPALGIV 179

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG+IK M ++ Q P++LG  IG +L GT LG+ L+Y    P  +++K+   + H+ Y
Sbjct: 180 AAVLGVIKTMASIDQPPEVLGGLIGGALVGTFLGVFLAYGFVGPFAAKMKTAIEEDHQFY 239

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
           +++++ LIA ++     + IE GR+  P   RP    + + +       
Sbjct: 240 LMIREVLIANLHSHATNICIEVGRQNAPHHVRPDFNDLEEALRGLKQAA 288


>gi|295095517|emb|CBK84607.1| Flagellar motor component [Enterobacter cloacae subsp. cloacae NCTC
           9394]
          Length = 277

 Score =  236 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 97/270 (35%), Positives = 154/270 (57%)

Query: 19  YAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDTYCDV 78
              GG+   L QP E+VI+ GAG+G F++ N  K IK +  ++  +F      +  Y D+
Sbjct: 1   MMTGGHLGALYQPAELVIIGGAGVGAFIVGNNGKSIKGTLKAIPLLFRRSKYTKSMYMDL 60

Query: 79  LKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMIIVGNA 138
           L LLY LM   ++      E  I++P  S IF S P +L +  +  FI DY+R+II GN 
Sbjct: 61  LALLYRLMAKSRQQGMFSLERDIENPKESEIFASYPRILADAMMLDFIVDYLRLIISGNM 120

Query: 139 RSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQSPKIL 198
            ++EIE LMDEEI+    E   P ++++ +G+SLPA GIV A++G++ A+ +  +    L
Sbjct: 121 NTFEIEALMDEEIETHESESEVPANSLALVGDSLPAFGIVAAVMGVVHALASADRPAAEL 180

Query: 199 GTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIPQVAI 258
           G  I  ++ GT LGI+L+Y   +PL S ++    +  ++   VK  L++ +NG  P +A+
Sbjct: 181 GALIAHAMVGTFLGILLAYGFISPLASVLRQKSAETTKMMQCVKITLLSNLNGYAPPIAV 240

Query: 259 EYGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
           E+GRK L  SERPS   + + V    +  +
Sbjct: 241 EFGRKTLYSSERPSFIELEEHVRAVKNPNQ 270


>gi|285019702|ref|YP_003377413.1| flagellar motor protein [Xanthomonas albilineans GPE PC73]
 gi|283474920|emb|CBA17419.1| probable flagellar motor protein [Xanthomonas albilineans]
          Length = 284

 Score =  236 bits (603), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 91/284 (32%), Positives = 164/284 (57%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  + ++ + GG+    G    L QP+E++I+ G+ LG F+++ P K++K++   
Sbjct: 1   MLIIVGFIVVLVSVAGGYVLSHGKLGALWQPYELMIIGGSALGAFLVSTPGKIVKETISG 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           ++ +F       D Y   L L+Y L+   ++      E+H+++P +S IF + P VL ++
Sbjct: 61  IIGVFKGPQYKADDYRGTLTLIYELLNKARRDGFMALEDHVENPASSAIFGNYPKVLADH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FI D +R++I  N   +E+E L++ E++   +E L P HA+S + + LP  GIV A
Sbjct: 121 HLLDFITDCLRLMIGSNIEPHELEPLLELELEKHHHEALAPAHALSKVSDGLPGFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGI+  MG++    + +G  +G +L GT LGI+++Y   +PL++ +++   +  R+Y  
Sbjct: 181 VLGIVITMGSIGGPIEEIGHHVGAALVGTFLGILMAYGFVSPLSAAMEARAEQDGRIYES 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYN 284
           VK AL+A + G  P++A+E+ RK LP + RPS       +    
Sbjct: 241 VKTALLACLRGYNPKIALEFARKTLPTNVRPSFADFESHLKTIK 284


>gi|288549779|ref|ZP_05968140.2| chemotaxis MotA protein [Enterobacter cancerogenus ATCC 35316]
 gi|288317371|gb|EFC56309.1| chemotaxis MotA protein [Enterobacter cancerogenus ATCC 35316]
          Length = 277

 Score =  236 bits (602), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 96/270 (35%), Positives = 154/270 (57%)

Query: 19  YAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDTYCDV 78
              GG+   L QP E++I+ GAG+G F++ N  K IK +  ++  +F      +  Y D+
Sbjct: 1   MMTGGHLGALYQPAELIIIGGAGVGAFIVGNNGKSIKGTLKAIPLLFRRSKYTKSMYMDL 60

Query: 79  LKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMIIVGNA 138
           L LLY LM   ++      E  I++P  S IF S P +L +  +  FI DY+R+II GN 
Sbjct: 61  LALLYRLMAKSRQQGMFSLERDIENPKESEIFASYPRILADAMMLDFIVDYLRLIISGNM 120

Query: 139 RSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQSPKIL 198
            ++EIE LMDEEI+    E   P ++++ +G+SLPA GIV A++G++ A+ +  +    L
Sbjct: 121 NTFEIEALMDEEIETHESESEVPANSLALVGDSLPAFGIVAAVMGVVHALASADRPAAEL 180

Query: 199 GTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIPQVAI 258
           G  I  ++ GT LGI+L+Y   +PL S ++    +  ++   VK  L++ +NG  P +A+
Sbjct: 181 GALIAHAMVGTFLGILLAYGFISPLASVLRQKSAETTKMMQCVKITLLSNLNGYAPPIAV 240

Query: 259 EYGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
           E+GRK L  SERPS   + + V    +  +
Sbjct: 241 EFGRKTLYSSERPSFIELEEHVRAVKNPNQ 270


>gi|94500540|ref|ZP_01307071.1| Flagellar motor component [Oceanobacter sp. RED65]
 gi|94427330|gb|EAT12309.1| Flagellar motor component [Oceanobacter sp. RED65]
          Length = 283

 Score =  236 bits (602), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 90/281 (32%), Positives = 156/281 (55%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   IG+ + I  +I G+    G    L QP+E +I+ G+G+G  +++NP  V KD    
Sbjct: 1   MLFFIGMAVVICSVIFGYLGAHGVLLALWQPYEFIIILGSGIGAHIVSNPGGVHKDVFKM 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L ++       +  + D L L+Y ++   +K      E  +++P +S IF+  P + +N+
Sbjct: 61  LPQVITGGKANKAMHMDCLSLIYDILNKSRKEGMMSIEADVENPQSSGIFSKYPAIQQNH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FI DY R+I  GN +++E++ LMD EID  ++E  +P  AI  + +++P  GIV A
Sbjct: 121 HLADFIADYFRLIAAGNMQAHELDALMDMEIDTRMHELSQPGSAIQKIADAMPGFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGI+  MG +    + +G  I  +L GT  G++  Y    P+ S+++    ++ +LY  
Sbjct: 181 VLGIVITMGAIDGPMEEIGKHIAAALVGTFSGVLFGYGFFGPIASKMEHIAHEEIKLYES 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
            K  ++A +NG  PQ+A+E+GRKVL   +RP+   +  +V 
Sbjct: 241 AKATIVASVNGLPPQLAVEFGRKVLFAHDRPTFSELESKVR 281


>gi|157145318|ref|YP_001452637.1| flagellar motor protein MotA [Citrobacter koseri ATCC BAA-895]
 gi|157082523|gb|ABV12201.1| hypothetical protein CKO_01058 [Citrobacter koseri ATCC BAA-895]
          Length = 278

 Score =  236 bits (602), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 99/270 (36%), Positives = 153/270 (56%)

Query: 19  YAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDTYCDV 78
              GG+   L QP E VI+ GAG+G F++ N  K IK +  +L  +F      +  Y D+
Sbjct: 1   MMTGGHLGALYQPAEFVIIGGAGIGAFIVGNNGKAIKGTLKALPLLFRRSKYTKAMYMDL 60

Query: 79  LKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMIIVGNA 138
           L LLY LM   ++      E  I++P  S IF S P +L +  +  FI DY+R+II GN 
Sbjct: 61  LALLYRLMAKSRQQGMFSLERDIENPKESEIFASYPRILADAVMLDFIVDYLRLIISGNM 120

Query: 139 RSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQSPKIL 198
            ++EIE LMDEEI+    E   P ++++ MG+SLPA GIV A++G++ A+ +  +    L
Sbjct: 121 NTFEIEALMDEEIETHESEAEVPANSLALMGDSLPAFGIVAAVMGVVHALASADRPAAEL 180

Query: 199 GTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIPQVAI 258
           G  I  ++ GT LGI+L+Y   +PL S ++    +  ++   VK  L++ +NG  P +A+
Sbjct: 181 GALIAHAMVGTFLGILLAYGFISPLASVLRQKSAETTKMMQCVKITLLSNLNGYAPPIAV 240

Query: 259 EYGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
           E+GRK L  SERPS   + + V    +  +
Sbjct: 241 EFGRKTLYSSERPSFIELEEHVRAVRNPNQ 270


>gi|294679002|ref|YP_003579617.1| chemotaxis protein MotA [Rhodobacter capsulatus SB 1003]
 gi|294477822|gb|ADE87210.1| chemotaxis protein MotA [Rhodobacter capsulatus SB 1003]
          Length = 289

 Score =  236 bits (602), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 83/279 (29%), Positives = 152/279 (54%), Gaps = 3/279 (1%)

Query: 11  ILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYK 68
              + GG+ A GG   I+++  PFE++++ GA +G FV++N L  IK +   + ++F   
Sbjct: 11  FAMVFGGYVAAGGKMGIILKALPFEMIMIGGAAVGAFVLSNDLPSIKHTVKDIGKVFKGA 70

Query: 69  ALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICD 128
                 Y D+L LL+ L+   +  +    E HI+ P NS+IF   P +L ++E    ICD
Sbjct: 71  KWKPSDYRDLLCLLFELIRLAR-QNPVAIEEHIEAPENSSIFGKYPKILHDHEAVEMICD 129

Query: 129 YMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAM 188
            MR   +     +++E +++++++   +  +   HA+  + +++PA+GIV A+LG+IK M
Sbjct: 130 TMRSASMNYDDPHQVEEVLEKQLEANYHHAMHSSHAMQSIADAMPALGIVAAVLGVIKTM 189

Query: 189 GNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAY 248
            ++ Q P+ILG  IG +L GT LG+ L+Y    P  ++IK+   +    Y ++++ L+A 
Sbjct: 190 ASIDQPPEILGKMIGGALVGTFLGVFLAYGFIGPFATRIKAVVDEDAHFYKLIREVLVAN 249

Query: 249 MNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
           ++     + IE GR+  P   RPS   + + +       
Sbjct: 250 LHNHATNICIEVGRQNTPHHIRPSFSELEEALKAVKSEA 288


>gi|116694192|ref|YP_728403.1| flagellar motor component [Ralstonia eutropha H16]
 gi|113528691|emb|CAJ95038.1| flagellar motor component [Ralstonia eutropha H16]
          Length = 268

 Score =  236 bits (601), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 97/266 (36%), Positives = 153/266 (57%)

Query: 20  AMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDTYCDVL 79
             GG+   L QP E VI+ GA  G F+  N  K IK +  +L  +F      ++ Y DV+
Sbjct: 1   MTGGHMGALYQPAEFVIIGGAAFGAFIATNTAKAIKATIKALPGLFKSSKYKKELYLDVM 60

Query: 80  KLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMIIVGNAR 139
            LLY+L+   ++      E  I DP  S++F+  P +L +  +  F+ DY+RM++ GN  
Sbjct: 61  SLLYVLLSKARREGILFLEKEIADPAASSVFSQYPRILSDPVVMEFLTDYLRMMVNGNMN 120

Query: 140 SYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQSPKILG 199
           ++EIE LMD EI+   +E   P HA+S +G++LPA GIV A++G++ A+G+    P  LG
Sbjct: 121 AFEIEALMDHEIETFRHEAEIPAHALSRVGDALPAFGIVAAVMGVVHALGSADLPPAELG 180

Query: 200 TAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIPQVAIE 259
             I  ++ GT LGI+L+Y   +PL ++I+    +  ++Y  +K  L+A +NG  P VA+E
Sbjct: 181 ALIAHAMVGTFLGILLAYGFVSPLAARIELQVSENVKVYECIKVVLLASLNGYAPLVAVE 240

Query: 260 YGRKVLPLSERPSIEIVAQEVLQYNH 285
           +GRKVL  + RPS   +   V +   
Sbjct: 241 FGRKVLYSTVRPSFLELDDHVREVKS 266


>gi|239817127|ref|YP_002946037.1| chemotaxis MotA protein [Variovorax paradoxus S110]
 gi|239803704|gb|ACS20771.1| chemotaxis MotA protein [Variovorax paradoxus S110]
          Length = 286

 Score =  236 bits (601), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 100/274 (36%), Positives = 159/274 (58%)

Query: 13  CIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQ 72
            + GG+  MGG+  +L QP E++++ GA LG F+  N  K IK +   L  +       +
Sbjct: 13  AVFGGYALMGGHFGVLFQPVELLMIGGAALGAFLAGNNGKTIKATLKELPLLLRSSKHNR 72

Query: 73  DTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRM 132
             Y D+L LLY L+   +K    + E+ ++DP  S IF   P +L +  +  F+CDY+R+
Sbjct: 73  QLYLDLLALLYELLAKARKEGMMKLESDVEDPAQSEIFRRYPEILADAGVMEFLCDYLRL 132

Query: 133 IIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLS 192
           +I GN  ++EIE LMD EI+ I +E   P H++S + ++LPA+GIV A++G++ A+G+  
Sbjct: 133 VISGNTDAFEIEALMDHEIETIKHEAEMPVHSLSRVSDALPALGIVAAVMGVVHALGSAD 192

Query: 193 QSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGA 252
             P  +G  I  ++ GT LG++L+Y   +PL S I     +  +LY   K  L+A +NG 
Sbjct: 193 LPPSEMGALIAHAMVGTFLGVLLAYGFVSPLASLIDQKVSEGMKLYQCTKVTLLASLNGY 252

Query: 253 IPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHN 286
            PQ+A+E+GRKVL  +ERPS   +   V +    
Sbjct: 253 APQLAVEFGRKVLFSTERPSFTELDSHVREVKAR 286


>gi|197106584|ref|YP_002131961.1| chemotaxis MotA protein [Phenylobacterium zucineum HLK1]
 gi|196480004|gb|ACG79532.1| chemotaxis MotA protein [Phenylobacterium zucineum HLK1]
          Length = 289

 Score =  236 bits (601), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 90/289 (31%), Positives = 171/289 (59%), Gaps = 2/289 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  IIG+ +    + G +   GGN  +++   P E++ + GAG+  F++AN L VIK + 
Sbjct: 1   MFQIIGIVLLFALVFGSYIISGGNMGVILHALPHEMMAIGGAGVASFLIANSLPVIKATV 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
            +  ++FG        Y D+L LL++L   +K       E+HI++P  STIFT  P +++
Sbjct: 61  GNFGKVFGGPKWKAADYRDLLSLLFLLTKTMKSKGVIALESHIENPTESTIFTRFPKIMK 120

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           ++    FICD +RM+ +     +++E+ M+++++   +E  +P HA+  + ++LPA+GIV
Sbjct: 121 DHFAIDFICDTLRMMTMNLEDPHQVEDAMEKQLEKHHHEAQQPSHALQTLADALPALGIV 180

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG+IK MG++++ P++LG  IG +L GT LG+ L+Y L  P+ ++++    ++   Y
Sbjct: 181 AAVLGVIKTMGSITEPPEVLGGMIGSALVGTFLGVFLAYGLVGPMATRMREVIDEEGSFY 240

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
            I++  L+A+++G   Q+++E GR  +P   +PS   + + +    +  
Sbjct: 241 RIIQSVLVAHLHGNAAQISVEIGRGSVPSGAQPSFIELEEALSNIPNEA 289


>gi|146312114|ref|YP_001177188.1| flagellar motor protein MotA [Enterobacter sp. 638]
 gi|145318990|gb|ABP61137.1| proton conductor component of motor, torque generator [Enterobacter
           sp. 638]
          Length = 295

 Score =  236 bits (601), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 101/288 (35%), Positives = 164/288 (56%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++G  + +  + GG+   GG+   L QP E++I+ GAG+G F++ N  K IK +  +
Sbjct: 1   MLIVLGYLVVLGTVFGGYMMTGGHLGALYQPAELIIIGGAGIGAFIVGNNGKSIKGTLKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y D+L LLY LM   ++      E  I++P  S IF S P +L + 
Sbjct: 61  LPLLFRRSKYTKSMYMDLLALLYRLMAKSRQQGMFSLERDIENPKESEIFASYPRILADA 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FI DY+R+II GN  ++EIE LMDEEI+    E   P  A++ +G+SLPA GIV A
Sbjct: 121 MMLDFIVDYLRLIISGNMNTFEIEALMDEEIETHESESEVPAAALAMVGDSLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+ +  +    LG  I  ++ GT +GI+L+Y   +PL+S ++    +  ++   
Sbjct: 181 VMGVVHALASADRPAAELGALIAHAMVGTFVGILLAYGFISPLSSVLRQKSAETTKMMQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
           VK  L++ +NG  P +A+E+GRK L  SERPS   + + V    +  +
Sbjct: 241 VKITLLSNLNGYAPPIAVEFGRKTLYSSERPSFIELEEHVRAVKNPNQ 288


>gi|254505141|ref|ZP_05117292.1| hypothetical protein SADFL11_5181 [Labrenzia alexandrii DFL-11]
 gi|222441212|gb|EEE47891.1| hypothetical protein SADFL11_5181 [Labrenzia alexandrii DFL-11]
          Length = 297

 Score =  235 bits (600), Expect = 5e-60,   Method: Composition-based stats.
 Identities = 136/275 (49%), Positives = 193/275 (70%)

Query: 13  CIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQ 72
            +IGGF AMGG   +L QP+E+VI+ G  +G F++ANP+KVI  + V++ +        +
Sbjct: 13  SLIGGFAAMGGKVLVLWQPWELVIILGVAIGAFIVANPVKVILGTTVAVSDALRNAVPSK 72

Query: 73  DTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRM 132
             Y DVL LLY LM  L+   RN  E HI+DP  S IF   P+VL +  +TTFICDY R+
Sbjct: 73  RDYLDVLALLYGLMRELRAKGRNAVEPHIEDPSTSPIFQKYPSVLRDANMTTFICDYFRL 132

Query: 133 IIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLS 192
           IIVGNAR++EIE L+DEEI  I  +++KPYHA+S + ++LPAIGI+ A+LG+IKAMG + 
Sbjct: 133 IIVGNARAHEIEALVDEEIQTIHRDQMKPYHAMSSVADALPAIGIIAAVLGVIKAMGAID 192

Query: 193 QSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGA 252
           QSP++LG+ IG +L GT +GI+ SYSL  PL ++IKS R  + R YI+VK+ L+A+MNGA
Sbjct: 193 QSPQLLGSLIGAALVGTFIGILFSYSLFGPLAAKIKSVRETRLRNYIVVKQTLLAFMNGA 252

Query: 253 IPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
            PQ+A+E+GRK +   +RP+I+ V  E ++    +
Sbjct: 253 DPQIALEHGRKTISGYDRPTIDEVENETMRAGGAE 287


>gi|239905382|ref|YP_002952121.1| chemotaxis protein MotA [Desulfovibrio magneticus RS-1]
 gi|239795246|dbj|BAH74235.1| chemotaxis protein MotA [Desulfovibrio magneticus RS-1]
          Length = 284

 Score =  235 bits (599), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 86/281 (30%), Positives = 156/281 (55%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  IIG+ + I C+ GGF   GG+  +L QP E++I+ GA LG F +A+P  +   +   
Sbjct: 1   MFAIIGIVVVIACVFGGFMLEGGHMGVLWQPIELLIIGGAALGSFFIASPKSIAIGTFKH 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           ++ +F  K      Y D+L LL+ L+   ++      E H+  P  S      P + +N 
Sbjct: 61  VMHVFTGKEPSAGDYQDLLTLLFELINIARRDGIVALEPHVSKPEQSATLNKYPAIAKNK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +L  FICD ++ ++     ++  ++LM  +I  + +  +    A++ + +SLP +GIV A
Sbjct: 121 QLAHFICDNIKCLLSEGIDAHRYDDLMRTDIATMHHHAMIAPGAVTKVADSLPGLGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGI+  MG +++ P++LG +IG +L GT LGI++SY    P+ + ++     Q  +  +
Sbjct: 181 VLGIVLTMGKINEPPEVLGHSIGAALVGTFLGILMSYGFVGPMANNLEYQAKAQQHMLHV 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
           VK+ L A+ +G  P +++E GR+ +P   RPS++ +   + 
Sbjct: 241 VKEVLAAFNSGFSPLLSVEMGRRAIPEDVRPSMDDMEGALR 281


>gi|94312619|ref|YP_585828.1| chemotaxis protein MotA [Cupriavidus metallidurans CH34]
 gi|93356471|gb|ABF10559.1| chemotaxis MotA protein, proton conductor component of flagella
           motor [Cupriavidus metallidurans CH34]
          Length = 299

 Score =  235 bits (599), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 93/267 (34%), Positives = 156/267 (58%)

Query: 19  YAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDTYCDV 78
              GG+   L QP E++I+ GA +G F+ +N  K IK +  ++  +       ++ Y DV
Sbjct: 31  ALTGGHMGALYQPAELIIIGGAAVGAFISSNSGKAIKATMKAMPSLLKGSKYKKELYLDV 90

Query: 79  LKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMIIVGNA 138
           + LLY+L+   ++      E  I DP +S++F+  P +L + ++  F+ DY+RM++ GN 
Sbjct: 91  MALLYVLLSKARREGILFLEKEIADPASSSVFSQYPRILADAKMMEFLTDYLRMMVNGNM 150

Query: 139 RSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQSPKIL 198
            ++EIE LMD EI+ + +E   P HA+S +G+ LPA GIV A++G++ A+ +    P  L
Sbjct: 151 NAFEIEALMDHEIETVRHEAEIPAHALSRVGDGLPAFGIVAAVMGVVHALASADLPPAEL 210

Query: 199 GTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIPQVAI 258
           G  I  ++ GT LGI+L+Y   +PL S+++    +  ++Y  +K  L+A +NG  P VA+
Sbjct: 211 GALIANAMVGTFLGILLAYGFVSPLASRVEHQVSESIKMYECIKVTLLASLNGYAPLVAV 270

Query: 259 EYGRKVLPLSERPSIEIVAQEVLQYNH 285
           E+GRKVL  + RPS   +   V +   
Sbjct: 271 EFGRKVLYSTVRPSFLELDDHVREVKS 297


>gi|259417201|ref|ZP_05741120.1| chemotaxis protein MotA [Silicibacter sp. TrichCH4B]
 gi|259346107|gb|EEW57921.1| chemotaxis protein MotA [Silicibacter sp. TrichCH4B]
          Length = 289

 Score =  235 bits (599), Expect = 7e-60,   Method: Composition-based stats.
 Identities = 87/279 (31%), Positives = 152/279 (54%), Gaps = 3/279 (1%)

Query: 11  ILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYK 68
              + GG+   GG   I+I+  PFE++++ GA +G F+++N +  +K +   + ++F   
Sbjct: 11  FAMVFGGYLLAGGKLGIIIKSLPFEMMMIGGAAVGAFLISNDMGGVKHTLKDMGKVFKGP 70

Query: 69  ALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICD 128
               D Y D+L LL+ L+   +  +  E E HI+DP NST+F   P +L + E    I D
Sbjct: 71  KWKPDDYKDLLCLLFALIRIAR-ANPVEVEQHIEDPENSTVFGKYPKILADKEAINLISD 129

Query: 129 YMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAM 188
            MR   +     +++E ++++ I+  L+  L   HA+  M + LPA+GIV A+LG+IK M
Sbjct: 130 TMRSASMNYDDPHQVEEVLEKRIEANLHHALHSSHALQTMADGLPALGIVAAVLGVIKTM 189

Query: 189 GNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAY 248
            ++ Q P++LG  IG +L GT LG+ LSY L  P   ++KS   +    Y ++++ L+A 
Sbjct: 190 ASIDQPPEVLGKMIGGALVGTFLGVFLSYGLVAPFAGKVKSVVEEDAHFYQLIREVLVAN 249

Query: 249 MNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
           ++     + IE GR+  P   RP    + + + +   + 
Sbjct: 250 LHNHAAAICIEVGRQNTPSHIRPGFSELEEALNEVKQDA 288


>gi|170748129|ref|YP_001754389.1| MotA/TolQ/ExbB proton channel [Methylobacterium radiotolerans JCM
           2831]
 gi|170654651|gb|ACB23706.1| MotA/TolQ/ExbB proton channel [Methylobacterium radiotolerans JCM
           2831]
          Length = 295

 Score =  235 bits (599), Expect = 7e-60,   Method: Composition-based stats.
 Identities = 132/288 (45%), Positives = 192/288 (66%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  IIGL I    + GGF+A+GG+  ++ QPFE +IV GA +G F++ANP  V+ D+G +
Sbjct: 1   MGVIIGLLIAAASVGGGFWALGGHLTVVWQPFEFIIVGGAAIGAFIVANPAGVVLDTGSA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L +    +   ++ Y ++L LL+ L   ++   RNE E H++ P  S IF + P    + 
Sbjct: 61  LRDAVFARVPRREDYLELLGLLFALTREVRSKPRNEVEGHLERPGESEIFKAYPRAARDP 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            LT FICDY+R+II+GNAR Y++E LM+EEI     +KLK Y+A+    + LPA+GIV A
Sbjct: 121 ALTLFICDYVRLIIIGNARPYDVEALMEEEIATHRRDKLKVYNALMITADGLPALGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ILGI+KAMG L QSP +LG+ IG +L GT  GI +SY++  P+ ++IK+TR  Q RLYII
Sbjct: 181 ILGIVKAMGALDQSPALLGSLIGSALVGTFTGIFVSYTVVAPVANKIKATRESQARLYII 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
           VK+ L+AYMNGA+PQ+A+EYGRK +  + RP+I+ V    +  +   +
Sbjct: 241 VKQTLLAYMNGALPQIAVEYGRKAITSANRPTIDEVEDATMTASPRGE 288


>gi|330501612|ref|YP_004378481.1| flagellar motor protein MotA [Pseudomonas mendocina NK-01]
 gi|328915898|gb|AEB56729.1| flagellar motor protein MotA [Pseudomonas mendocina NK-01]
          Length = 283

 Score =  234 bits (598), Expect = 8e-60,   Method: Composition-based stats.
 Identities = 100/282 (35%), Positives = 157/282 (55%), Gaps = 2/282 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M+ IIG+ +   C+ GGF   GG    L+ PFE++I+ GA LG F+ ANP  +       
Sbjct: 1   MAKIIGIIVVFGCVFGGFMLSGGKLMALVHPFEVMIIGGAALGAFLQANPGSMFMTVFKK 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            L +F         Y +VLKLLY ++   ++      E  ++DP  S IF+  P VL++ 
Sbjct: 61  SLSMF-GSRFTHAYYLEVLKLLYEILNKSRREGMMAIEADVEDPNASPIFSKYPGVLKDA 119

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +T FICDY+R++  GN   +E+E L D E+  +  E   P HA++ + + +PA+GIV A
Sbjct: 120 RMTAFICDYLRIMSSGNMAPHELEGLFDMELASLKEEVEHPAHAVAKVADGMPAMGIVAA 179

Query: 181 ILGIIKAMGNLSQ-SPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYI 239
           +LGI+  M  L++     +G  +G +L GT LGI+ SY    PL+  ++    ++  LY 
Sbjct: 180 VLGIVITMSILAEADNAQIGEKVGTALVGTFLGILASYGFFGPLSGALEHDAKEELNLYE 239

Query: 240 IVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
            +K  L+A  +G  P +A+E+GRKVL  + RPS   + Q + 
Sbjct: 240 AIKATLVASASGMPPTLAVEFGRKVLYPAHRPSFSELEQAMR 281


>gi|188579890|ref|YP_001923335.1| chemotaxis MotA protein [Methylobacterium populi BJ001]
 gi|179343388|gb|ACB78800.1| chemotaxis MotA protein [Methylobacterium populi BJ001]
          Length = 291

 Score =  234 bits (598), Expect = 8e-60,   Method: Composition-based stats.
 Identities = 144/290 (49%), Positives = 195/290 (67%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++GL I I C++GGF AMGG+  ++ QP+E VI+ G   G FV+ANPLKV+ DSG +
Sbjct: 1   MGILVGLVIAIGCMLGGFVAMGGHLIVIWQPWEFVIIGGMAAGTFVIANPLKVVMDSGKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            +E F  K   +  +  +L LL+ LM  LK   RNE E H DDP NS IF + P V ++ 
Sbjct: 61  TMEAFTNKGPKRQDFLSLLGLLHALMRELKTKPRNEVETHFDDPANSEIFKNYPDVTKDQ 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +L  FICDY R+I++GNARS+EIE LM+EEI      +LKPY AI+ + E+LPA+GIV A
Sbjct: 121 DLLLFICDYCRLILIGNARSHEIEALMEEEIGTHKKYRLKPYAAINTVAEALPALGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGI+KAMG L QSP+ILG  IG +L GT  G+  SY +  PL  ++K  R KQ   Y I
Sbjct: 181 VLGIVKAMGALDQSPQILGGLIGAALVGTFFGVFASYGVLAPLAIKVKGVREKQCAPYTI 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK++LIAYMNGA+PQVAIE+GRK +  ++RP+I+ V    +     + A+
Sbjct: 241 VKQSLIAYMNGALPQVAIEHGRKGIAGADRPTIDEVESATVPGARAEPAA 290


>gi|300024615|ref|YP_003757226.1| flagellar motor protein MotA [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299526436|gb|ADJ24905.1| flagellar motor protein MotA [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 306

 Score =  234 bits (598), Expect = 8e-60,   Method: Composition-based stats.
 Identities = 143/293 (48%), Positives = 204/293 (69%), Gaps = 4/293 (1%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
           + +IGLFIT+ C++GGF AMGG+  ++ QP+E VI+ GA LG FV+ANP+K IKD G + 
Sbjct: 14  TILIGLFITLACMLGGFTAMGGHVMVIWQPWEYVIICGAALGTFVVANPMKTIKDCGTAT 73

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
            + F       D + ++L LL+ +M  L+  SR E E  ID P +S +F   P+V  N+E
Sbjct: 74  TQAFRNDVPTMDEHIELLSLLFFMMRELRDKSRAEMEMIIDAPQDSEVFKRSPSVTANDE 133

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
           LTTFICDY R+II+GNAR++EIE+LMDEEI+   ++KLK YHA+  +G+ LPA+GI+ A+
Sbjct: 134 LTTFICDYFRLIIMGNARTHEIESLMDEEIETARHDKLKAYHALVAVGDGLPALGIIAAV 193

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           LG++KAMG + QSP+ILG  I  +L GT  GI  SY++  PL +++K  R K+ R Y+IV
Sbjct: 194 LGVVKAMGAIDQSPEILGHLIASALVGTFAGIFFSYAVVGPLATKVKIVREKRLRSYVIV 253

Query: 242 KKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH----NKKAS 290
           K++L+A+MNGA+PQVAIE+GRK +   ERP+I  V    +        +KKA+
Sbjct: 254 KQSLLAFMNGAMPQVAIEHGRKAISAYERPTINEVEAATISGGARPGESKKAA 306


>gi|163850085|ref|YP_001638128.1| chemotaxis MotA protein [Methylobacterium extorquens PA1]
 gi|218528688|ref|YP_002419504.1| chemotaxis MotA protein [Methylobacterium chloromethanicum CM4]
 gi|240137218|ref|YP_002961687.1| Chemotaxis protein MotA (Motility protein A) [Methylobacterium
           extorquens AM1]
 gi|254559230|ref|YP_003066325.1| chemotaxis protein MotA [Methylobacterium extorquens DM4]
 gi|163661690|gb|ABY29057.1| chemotaxis MotA protein [Methylobacterium extorquens PA1]
 gi|218520991|gb|ACK81576.1| chemotaxis MotA protein [Methylobacterium chloromethanicum CM4]
 gi|240007184|gb|ACS38410.1| Chemotaxis protein MotA (Motility protein A) [Methylobacterium
           extorquens AM1]
 gi|254266508|emb|CAX22272.1| Chemotaxis protein MotA (Motility protein A) [Methylobacterium
           extorquens DM4]
          Length = 291

 Score =  234 bits (598), Expect = 8e-60,   Method: Composition-based stats.
 Identities = 144/290 (49%), Positives = 197/290 (67%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++GL I I C++GGF AMGG+  ++ QP+E VI+ G   G FV+ANP+K + DSG +
Sbjct: 1   MGILVGLVIAIGCMLGGFVAMGGHLIVIWQPWEFVIIFGMAAGTFVIANPMKTVVDSGKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            +E F  K   +  +  +L LL+ LM +LK   RNE E H DDP NS IF + P V ++ 
Sbjct: 61  TMEAFTNKGPKRQDFLSLLGLLHALMRDLKTKPRNEVETHFDDPANSEIFKNYPEVTKDQ 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +L  FICDY R+I++GNARS+EIE LM+EEI      KLKPY AI+ + E+LPA+GIV A
Sbjct: 121 DLVLFICDYCRLILIGNARSHEIEALMEEEIGTHKKYKLKPYAAINTVAEALPALGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGI+KAMG L QSP+ILG  IG +L GT +G+  SY +  PL  +IK  R KQ  +Y I
Sbjct: 181 VLGIVKAMGALDQSPQILGGLIGAALVGTFIGVFASYGMLAPLAVKIKGVREKQCSVYTI 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK++LIAYMNGA+PQVAIE+GRK +  ++RP+I+ V    +     + A+
Sbjct: 241 VKQSLIAYMNGALPQVAIEHGRKGIAGADRPTIDEVESATVPGARAEPAA 290


>gi|99082791|ref|YP_614945.1| flagellar motor protein MotA [Ruegeria sp. TM1040]
 gi|99039071|gb|ABF65683.1| Chemotaxis motA protein (Motility protein A) [Ruegeria sp. TM1040]
          Length = 289

 Score =  234 bits (597), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 85/279 (30%), Positives = 150/279 (53%), Gaps = 3/279 (1%)

Query: 11  ILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYK 68
              + GG+   GG   I+++  PFE++++ GA +G F+++N +  +K +   + ++F   
Sbjct: 11  FAMVFGGYLLAGGKLGIILKSLPFEMMMIGGAAVGAFLISNDMGGVKHTLKDMGKVFKGP 70

Query: 69  ALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICD 128
               D Y D+L LL+ L+   +  +  E E HI+DP NS +F   P +L + E    I D
Sbjct: 71  KWKPDDYKDLLCLLFALIRIAR-ANPVEVEQHIEDPENSAVFGKYPKILADKEAINLISD 129

Query: 129 YMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAM 188
            MR   +     +++E ++++ I+  L+  L   HA+  M + LPA+GIV A+LG+IK M
Sbjct: 130 TMRSASMNYDDPHQVEEVLEKRIEANLHHALHSSHALQTMADGLPALGIVAAVLGVIKTM 189

Query: 189 GNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAY 248
            ++ Q P++LG  IG +L GT LG+ LSY L  P   ++KS   +    Y ++++ L+A 
Sbjct: 190 ASIDQPPEVLGKMIGGALVGTFLGVFLSYGLVAPFAGKVKSVVEEDAHFYQLIREVLVAN 249

Query: 249 MNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
           ++     + IE GR+  P   RP    + + + +     
Sbjct: 250 LHNHAAAICIEVGRQNTPSHIRPGFSELEEALNEVKQGA 288


>gi|332095071|gb|EGJ00105.1| chemotaxis protein motA [Shigella dysenteriae 155-74]
          Length = 276

 Score =  234 bits (597), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 99/269 (36%), Positives = 158/269 (58%)

Query: 20  AMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDTYCDVL 79
             GG+   L QP E+VI+AGAG+G F++ N  K IK +  +L  +F      +  Y D+L
Sbjct: 1   MTGGSLGALYQPAELVIIAGAGIGSFIVGNNGKAIKGTLKALPLLFRRSKYTKAMYMDLL 60

Query: 80  KLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMIIVGNAR 139
            LLY LM   ++      E  I++P  S IF S P +L ++ +  FI DY+R+II G+  
Sbjct: 61  ALLYRLMAKSRQMGMFSLERDIENPRESEIFASYPRILADSVMLDFIVDYLRLIISGHMN 120

Query: 140 SYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQSPKILG 199
           ++EIE LMDEEI+    E   P ++++ +G+SLPA GIV A++G++ A+G+  +    LG
Sbjct: 121 TFEIEALMDEEIETHESEAEVPANSLALVGDSLPAFGIVAAVMGVVHALGSADRPAAELG 180

Query: 200 TAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIPQVAIE 259
             I  ++ GT LGI+L+Y   +PL S ++    +  ++   VK  L++ +NG  P +A+E
Sbjct: 181 ALIAHAMVGTFLGILLAYGFISPLASVLRQKSAETSKMMQCVKVTLLSNLNGYAPPIAVE 240

Query: 260 YGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
           +GRK L  SERPS   + + V    + ++
Sbjct: 241 FGRKTLYSSERPSFIELEEHVRAVKNPQQ 269


>gi|322433006|ref|YP_004210255.1| chemotaxis protein [Acidobacterium sp. MP5ACTX9]
 gi|321165233|gb|ADW70937.1| chemotaxis protein [Acidobacterium sp. MP5ACTX9]
          Length = 290

 Score =  234 bits (597), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 88/290 (30%), Positives = 155/290 (53%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M +IIG+ +    +IGGF    G   +L+QP E+V + GA LG  ++ANP+ ++K     
Sbjct: 1   MISIIGIIVVFGAVIGGFMMEKGQLAVLVQPAELVTIGGAALGTLLVANPMHILKGIASG 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L+ + G     +  Y D LK+++ L    +K      E  ++    S IFT+ P  ++++
Sbjct: 61  LMGVIGGSPFTKQRYLDTLKMMFDLFSKARKDGMVAIEADVEGADKSPIFTAYPKFMKDH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+CD MRM I G    ++++ +M+ ++D   +    P  A++ + ++LP +GIV A
Sbjct: 121 HAVDFVCDTMRMAITGGVLPFDVDQMMELDMDTHHHSSSLPTTALNTVADALPGLGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGI+  MG L   P+ +G  +  +L GT LGI+L Y +  PL S +     ++H  Y I
Sbjct: 181 VLGIVITMGALGGPPEEIGHKVAAALVGTFLGILLCYGVLGPLASFMGKMNEEEHAYYHI 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           ++  ++A++ G  P +A+E  R+ +P   RPS   V +     +    A+
Sbjct: 241 LRVVMLAFIKGTSPILAVELARRAIPAHLRPSFSEVEKACRNKSAAPAAA 290


>gi|313672699|ref|YP_004050810.1| lateral flagellar motor protein mota [Calditerrivibrio
           nitroreducens DSM 19672]
 gi|312939455|gb|ADR18647.1| lateral flagellar motor protein MotA [Calditerrivibrio
           nitroreducens DSM 19672]
          Length = 284

 Score =  234 bits (596), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 98/284 (34%), Positives = 167/284 (58%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M+ IIG  +    ++GG+   GGN ++LIQP E +I+AGA  G  ++ +P  ++K     
Sbjct: 1   MTAIIGYIVVFGAVLGGYLMSGGNLHMLIQPSEFIIIAGAATGALIVGSPTALLKLIAGG 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +      K   +  Y D+L LLY L    +K      E+ +++   S IF + P+VL+N+
Sbjct: 61  MKSFLSGKTPSKKEYEDLLMLLYELFIKARKNGLLSLESDVENAKESPIFNNYPSVLKNH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FI D +++I+ G  + +E+ENLMD +I+    E+  P HAI  M + LPA GIV A
Sbjct: 121 HLLHFISDNLKVILTGVMQPHELENLMDVDIETAHKEEHLPAHAIQKMADGLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  MG +S+ P++LG  IG +L GT LG++L+Y +  P+ S +++  +    ++ +
Sbjct: 181 VMGVVITMGLISEPPEVLGHHIGAALVGTFLGVLLAYGIVGPIASALENIVIFNSFVFRV 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYN 284
           VK+AL+ ++N   P+ AIE  R+ +P S RPS E + +++    
Sbjct: 241 VKEALVFFVNTPDPKAAIELARRAIPPSARPSFEELEEKLKNIK 284


>gi|104783885|ref|YP_610383.1| flagellar motor protein MotA [Pseudomonas entomophila L48]
 gi|95112872|emb|CAK17600.1| Putative flagellar motor MotA protein [Pseudomonas entomophila L48]
          Length = 283

 Score =  234 bits (596), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 94/282 (33%), Positives = 151/282 (53%), Gaps = 2/282 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M+ IIG+ +    ++GG+    G    LIQPFE++I+ GA  G F+ ANP  +       
Sbjct: 1   MAKIIGIIVVFASVLGGYVLSHGKIAALIQPFEVLIIGGAAFGAFLQANPGHMTMHVIKK 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            L++F         Y +VL L+Y ++   ++      E  I+DP  S IF   P V+ + 
Sbjct: 61  SLKMF-GTRFTHTFYLEVLGLVYEILNKSRREGMMAIEGDIEDPAASPIFAKYPAVMGDE 119

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +T FICDY+R++  GN   +E+E L D E+  +  E   P HA++ + + +P  GIV A
Sbjct: 120 RMTAFICDYLRIMSTGNMAPHELEGLFDMELLSMKEELEHPSHAVTGIADGMPGFGIVAA 179

Query: 181 ILGIIKAMGNLSQ-SPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYI 239
           +LGI+  M +L     K +G  +G +L GT  GI+ +Y    PL + ++    ++  +Y 
Sbjct: 180 VLGIVVTMASLGDGDQKSIGLHVGAALVGTFFGILAAYGFFGPLANALRHDAKEELNVYE 239

Query: 240 IVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
            +K +L+A  +G  P +A+E+GRKVL    RPS   + Q V 
Sbjct: 240 AIKASLVASASGMPPSLAVEFGRKVLYPGHRPSFAELEQAVR 281


>gi|326795805|ref|YP_004313625.1| flagellar motor stator protein MotA [Marinomonas mediterranea
           MMB-1]
 gi|326546569|gb|ADZ91789.1| flagellar motor stator protein MotA [Marinomonas mediterranea
           MMB-1]
          Length = 284

 Score =  234 bits (596), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 98/284 (34%), Positives = 161/284 (56%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++G+ + I+ ++ G+ A  GN   L QPFE++I+ GA LG F++AN L +       
Sbjct: 1   MFALLGILVVIVSVVTGYLASHGNIIALWQPFEVLIICGAALGAFMIANSLTLQIRVFKM 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           + +IF      ++ Y  +L  LY L    +       EN I+ P+ S +F   P VL + 
Sbjct: 61  IPQIFLGSRHKKEFYKQLLGALYSLFQKSRLEGFLAIENDIELPFESNVFQRFPDVLNDE 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  F+ D  R+  +    S+E+E L+DEEI+ I  E  KP HA++ + E+LP  GIV A
Sbjct: 121 HLIYFLTDNFRIYTLTGLPSHELEALIDEEIEQISEELEKPAHAVNRVAEALPGFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGI+  MG++  S + +GT +  +L GT LGI  +Y    P ++ +++    + + Y+ 
Sbjct: 181 VLGIVITMGSIGGSMEEIGTHVAAALVGTFLGIFFAYGFVGPASAHLEALGQHELKAYMC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYN 284
           VK A+I+ ++G  P VA+E GRK+LP   RPS   +++++ QY 
Sbjct: 241 VKAAVISIVSGHPPAVAVETGRKLLPPEMRPSFLELSEDIKQYR 284


>gi|197362084|ref|YP_002141721.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|205352374|ref|YP_002226175.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|207856556|ref|YP_002243207.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|197093561|emb|CAR59023.1| motility protein A [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
 gi|205272155|emb|CAR37010.1| motility protein A [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|206708359|emb|CAR32663.1| motility protein A [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|261247093|emb|CBG24914.1| motility protein A [Salmonella enterica subsp. enterica serovar
           Typhimurium str. D23580]
 gi|301158443|emb|CBW17952.1| motility protein A [Salmonella enterica subsp. enterica serovar
           Typhimurium str. SL1344]
          Length = 276

 Score =  234 bits (596), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 96/269 (35%), Positives = 154/269 (57%)

Query: 20  AMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDTYCDVL 79
             GG+   L QP E+VI+ GAG+G F++ N  K IK +  ++  +F      +  Y D+L
Sbjct: 1   MTGGHLGALYQPAELVIIGGAGIGAFIVGNNGKAIKGTMKAIPLLFRRSKYTKSMYMDLL 60

Query: 80  KLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMIIVGNAR 139
            LLY LM   ++      E  I++P  S IF S P +L +  +  FI DY+R+II GN  
Sbjct: 61  ALLYRLMAKSRQQGMFSLERDIENPKESEIFASYPRILADAVMLDFIVDYLRLIISGNMN 120

Query: 140 SYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQSPKILG 199
           ++EIE LMDEEI+    E   P ++++ +G+SLPA GIV A++G++ A+ +  +    LG
Sbjct: 121 TFEIEALMDEEIETHESEAEVPANSLAMVGDSLPAFGIVAAVMGVVHALASADRPAAELG 180

Query: 200 TAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIPQVAIE 259
             I  ++ GT LGI+L+Y   +PL + ++    +  ++   VK  L++ +NG  P +A+E
Sbjct: 181 ALIAHAMVGTFLGILLAYGFISPLATVLRQKSAETTKMMQCVKITLLSNLNGYAPPIAVE 240

Query: 260 YGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
           +GRK L  SERPS   + + V    +  +
Sbjct: 241 FGRKTLYSSERPSFIELEEHVRAVRNPNQ 269


>gi|70734059|ref|YP_257699.1| flagellar motor protein MotA [Pseudomonas fluorescens Pf-5]
 gi|68348358|gb|AAY95964.1| motility protein, MotA family [Pseudomonas fluorescens Pf-5]
          Length = 309

 Score =  233 bits (595), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 92/282 (32%), Positives = 149/282 (52%), Gaps = 2/282 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M+ IIG+ +    ++GG+    G    LIQPFE++I+ GA  G F+ ANP  +       
Sbjct: 27  MAKIIGIIVVFASVLGGYVLSHGKIAALIQPFEVLIIGGAAFGAFLQANPGYMTMHVVKK 86

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            L +F         Y +VL L+Y ++   ++      E  I+D   S IF   P VL++ 
Sbjct: 87  SLGMFS-SRFTHTFYLEVLGLIYEILNKSRREGMMAIEGDIEDAAASPIFAKYPAVLKDE 145

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +T F+CDY+R++  GN   +E+E L D E+  +  +   P HA++ + + +P  GIV A
Sbjct: 146 RMTAFVCDYLRIMSSGNMAPHELEGLFDMELFSLKEDLEHPSHAVNGIADGMPGFGIVAA 205

Query: 181 ILGIIKAMGNLSQ-SPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYI 239
           +LGI+  M +L     K +G  +G +L GT  GI+ +Y    PL   +     ++  +Y 
Sbjct: 206 VLGIVVTMASLGDGDQKSIGLHVGAALVGTFFGILAAYGFFGPLAHSLAHDAKEELNVYE 265

Query: 240 IVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
            +K +L+A  +G  P +A+E+GRKVL  + RPS   + Q V 
Sbjct: 266 AIKASLVASASGMPPSLAVEFGRKVLYPAHRPSFAELEQAVR 307


>gi|83944200|ref|ZP_00956656.1| Flagellar motor protein MotA [Sulfitobacter sp. EE-36]
 gi|83955099|ref|ZP_00963755.1| Flagellar motor protein MotA [Sulfitobacter sp. NAS-14.1]
 gi|83840428|gb|EAP79601.1| Flagellar motor protein MotA [Sulfitobacter sp. NAS-14.1]
 gi|83845067|gb|EAP82948.1| Flagellar motor protein MotA [Sulfitobacter sp. EE-36]
          Length = 289

 Score =  233 bits (595), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 83/289 (28%), Positives = 154/289 (53%), Gaps = 2/289 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M+ I+G  + +  + GG+   GG+  I+    PFE +++ GA LG F+ AN    I  +G
Sbjct: 1   MTIILGFVVVMGMVFGGYMLSGGDMGIITHALPFEGMMIGGAALGSFIAANSFANIAGAG 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
            +L++ F         Y D+L L+Y L    ++      + HI++P  S+IF+  P + +
Sbjct: 61  RALVKAFKGPKWNSGDYVDLLNLMYTLARKYQQNGMLALDEHIENPQESSIFSQYPKLQK 120

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           ++     I D  RM+ +     Y+ E++++ ++    +E L   H ++ + ++LPAIGIV
Sbjct: 121 DHFAIDLITDSFRMLAMQFDDPYQAEDVINRKLKKHHHEALVAPHGLTTVSDALPAIGIV 180

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG+IK M ++ + P +LG  IG +L GT LG+ L+Y   +P+ +++++   +    Y
Sbjct: 181 AAVLGVIKTMSSIDKPPAVLGAMIGGALVGTFLGVFLAYLFVSPVANRLQAIEEQDGIYY 240

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
            +++   IA ++G  P +  E GR  +P S +PS   + +   Q     
Sbjct: 241 AVIRDIFIAILHGHSPAICTEIGRGNIPTSLQPSFYEMEEARKQMPEAA 289


>gi|325291947|ref|YP_004277811.1| flagellar motor protein MotA [Agrobacterium sp. H13-3]
 gi|45479282|gb|AAS66684.1| MotA [Agrobacterium sp. H13-3]
 gi|325059800|gb|ADY63491.1| flagellar motor protein MotA [Agrobacterium sp. H13-3]
          Length = 290

 Score =  233 bits (594), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 180/290 (62%), Positives = 232/290 (80%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M+ +IGL IT  CIIGG+ AMGG+  +L+QPFE++I+ GAGLGGF+MANP+KV+KDSG +
Sbjct: 1   MNIVIGLIITFGCIIGGYMAMGGHLDVLVQPFELLIIGGAGLGGFIMANPMKVVKDSGKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L E F +    +  Y DVL +LY LM +L+  SRNE E HID+P  S+IF S P+VL+N 
Sbjct: 61  LGEAFKHSVPKERNYLDVLGVLYSLMRDLRTKSRNEIEAHIDNPEESSIFQSAPSVLKNK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           ELT+FICDY+R+II+GNARS+EIE LMDEEI+ IL++KLKPYHAI+ MG+S PAIGIV A
Sbjct: 121 ELTSFICDYVRLIIIGNARSHEIEALMDEEIETILHDKLKPYHAITTMGDSFPAIGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKAMG +++SP++LG  IG +L GT+LGIILSYS+CNPL SQ+K  R KQHRLYII
Sbjct: 181 VLGVIKAMGKINESPEVLGGLIGAALVGTMLGIILSYSICNPLASQVKIVRTKQHRLYII 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK+ LIAYMNG++PQVA+EYGRK +   ERPSI+ V QE++      KA+
Sbjct: 241 VKQTLIAYMNGSVPQVALEYGRKTISNYERPSIDAVEQEMMNPGGENKAA 290


>gi|167644833|ref|YP_001682496.1| flagellar motor protein MotA [Caulobacter sp. K31]
 gi|167347263|gb|ABZ69998.1| MotA/TolQ/ExbB proton channel [Caulobacter sp. K31]
          Length = 289

 Score =  232 bits (593), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 91/288 (31%), Positives = 167/288 (57%), Gaps = 2/288 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  IIG+ +    + G F   GG   ++I+  P E++ + GAG+  F+++N + VIK +G
Sbjct: 1   MFQIIGIVLLFGLVFGSFIMSGGKMDVIIEAAPHELMCILGAGIASFLISNSMTVIKATG 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
               +IF         Y D+L LL++L   +K       E+HI+ P +STIF   P + +
Sbjct: 61  GGFGKIFKGPKWKTSDYRDLLSLLFLLTKTMKSKGVIALESHIEKPNDSTIFQRYPKITK 120

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           ++    FICD +RM+ +     +++E+ M+++++   +E L P HA+  + ++LPA+GIV
Sbjct: 121 DHFAVDFICDTLRMMTMNLEDPHQVEDAMEKQLEKHHHEGLAPAHALQSLADALPALGIV 180

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG+IK MG++++ P +LG  IG +L GT LG+ L+Y L  P ++++ +   ++   Y
Sbjct: 181 AAVLGVIKTMGSITEPPAVLGAMIGGALVGTFLGVFLAYGLVGPFSTRLTAVVDEEGAFY 240

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHN 286
            I++  L+A+++G   Q+++E GR  +P   +PS   + + + Q    
Sbjct: 241 RIIQAVLVAHLHGNAAQISVEIGRGNVPTPSQPSFLELEEALQQIPAE 288


>gi|332527141|ref|ZP_08403218.1| chemotaxis signal transduction protein CheY [Rubrivivax
           benzoatilyticus JA2]
 gi|332111569|gb|EGJ11551.1| chemotaxis signal transduction protein CheY [Rubrivivax
           benzoatilyticus JA2]
          Length = 286

 Score =  232 bits (593), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 104/283 (36%), Positives = 162/283 (57%), Gaps = 2/283 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  IIG  I ++C+ G F   GGN  ++++  PFE+  + GA  G F+  N  KV+K + 
Sbjct: 1   MFVIIGWVIVLVCVFGVFIVHGGNIGVILKALPFEMATIGGAAAGAFLANNQPKVLKATL 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
             L + F      +  Y D++ LLY ++   +K      E  ++DP+NS +F    TV  
Sbjct: 61  RGLGKCFKGSKYTKARYMDLMALLYDILQKARKEGLMSIEKDVEDPHNSPLFQKYATVGN 120

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           ++ ++ F+ DY+RM++ GN  ++EIE+LMD EI+   +E+     AI  +  +LPA GIV
Sbjct: 121 DHHVSEFVTDYLRMMVSGNLNAHEIESLMDSEIETHHHEEHAAVAAIQRLAGALPAFGIV 180

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG++  MG++ Q P +LG  IG +L GT LGI+L+Y+   PL   ++    +  +  
Sbjct: 181 AAVLGVVNTMGSVGQPPAVLGGMIGSALVGTFLGILLAYAFAEPLAGLLEQKVDEATKEL 240

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
             +K  L+A M G  PQVAIE+GRKVL  +ERPS   +   V 
Sbjct: 241 QCIKTTLLASMQGYAPQVAIEFGRKVLYSTERPSFSELESHVK 283


>gi|146305659|ref|YP_001186124.1| flagellar motor protein MotA [Pseudomonas mendocina ymp]
 gi|145573860|gb|ABP83392.1| Flagellar motor component-like protein [Pseudomonas mendocina ymp]
          Length = 283

 Score =  232 bits (593), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 101/282 (35%), Positives = 157/282 (55%), Gaps = 2/282 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  IIG+ +   C+ GGF   GG    L+ PFE++I+ GA LGGF+ ANP  +       
Sbjct: 1   MVKIIGIVVVFACVFGGFVLSGGQLMALVHPFEVLIIGGAALGGFLQANPGSMFMTVFKK 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            L +F         Y +VLKLLY ++   ++      E  ++DP  S IF+  P VL++ 
Sbjct: 61  SLSMF-GTRFTHTYYLEVLKLLYEILNKSRREGMMAIEADVEDPNASPIFSKYPGVLKDA 119

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +T FICDY+R++  GN   +E+E L D E+  +  E   P HA++ + + LPA+GIV A
Sbjct: 120 RMTAFICDYLRIMSSGNMAPHELEGLFDMELASLKEEVEHPAHAVAKIADGLPAMGIVAA 179

Query: 181 ILGIIKAMGNLSQ-SPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYI 239
           +LGI+  M  L++     +G  +  +L GT LGI+ SY    PL++ ++    ++  LY 
Sbjct: 180 VLGIVITMSILAEADNAQIGEKVATALVGTFLGILASYGFFGPLSNALEHDAKEELNLYE 239

Query: 240 IVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
            +K  L+A  +G  P +A+E+GRKVL  + RPS   + Q + 
Sbjct: 240 AIKATLVASASGMPPSLAVEFGRKVLFPAHRPSFSELEQAMR 281


>gi|296534173|ref|ZP_06896664.1| chemotaxis protein MotA [Roseomonas cervicalis ATCC 49957]
 gi|296265500|gb|EFH11634.1| chemotaxis protein MotA [Roseomonas cervicalis ATCC 49957]
          Length = 289

 Score =  232 bits (592), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 95/289 (32%), Positives = 167/289 (57%), Gaps = 2/289 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  + G  + ++C+ GG+   GG+   ++   PFE++I+ GA +G F+MAN +  +K + 
Sbjct: 1   MIVLAGFGVVLVCVFGGYLIAGGSLGPILHALPFEMLIIGGAAVGSFLMANSMAAVKHTL 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
            +L ++       +  Y D+  +LY L+   +       E HI+ P  S IFT  P VL 
Sbjct: 61  GALKKVLKGARYTRQDYLDLCAVLYRLLRVAQMKGAVGLEPHIERPNESEIFTLFPKVLA 120

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           ++   + ICDY+RMI +     +++E++M  E+  I  E+L P HA+  M ++LPA+GIV
Sbjct: 121 DHHALSLICDYLRMIGMNADDPHQVEDVMLRELKKIREEELHPAHALQTMADALPALGIV 180

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG+IK MG++ + P +LG  IG +L GT LG++L+Y L  PL +++++   ++ +  
Sbjct: 181 AAVLGVIKTMGSIDKPPAVLGAMIGGALVGTFLGVLLAYGLVGPLATRLRAIVDEEAKYL 240

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
            +V+  LIA++ G  P VA+E GRK +P    P+ +++   + +     
Sbjct: 241 EVVRAVLIAHLQGNAPSVAVEIGRKAVPSDLMPTFQVLETAMQEQRAGA 289


>gi|303249272|ref|ZP_07335505.1| chemotaxis protein MotA [Desulfovibrio fructosovorans JJ]
 gi|302489311|gb|EFL49267.1| chemotaxis protein MotA [Desulfovibrio fructosovorans JJ]
          Length = 284

 Score =  232 bits (592), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 87/281 (30%), Positives = 160/281 (56%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  IIG+ + + C+IGGF   GG+  +L+QP E++I+ GA LG F+++ P  V+  +   
Sbjct: 1   MFVIIGIVVVLGCVIGGFLLEGGHLGVLMQPIELLIIGGAALGSFLISAPKSVVIGTFKH 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +L +F  K      Y D+L LL+ LM   ++      E H+  P  S+     P + +N 
Sbjct: 61  ILHVFSGKEASSSDYQDLLTLLFELMNIARRDGIVALEPHVSQPEQSSTINRYPNIAKNK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +L  FICD ++ ++     ++  ++LM  +I  + +  +    A++ + +SLP +GIV A
Sbjct: 121 QLAYFICDNIKALLSEGIDAHRYDDLMRTDIATLHHHAMIAPSAVTRVADSLPGLGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGI+  MG +++ P++LG +IG +L GT LGI++ Y    P+ S ++     Q ++ ++
Sbjct: 181 VLGIVLTMGKINEPPEVLGHSIGAALVGTFLGILMCYGFVGPMASNLEYQAKAQQQMLLV 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
            K+ L A+ +G  P +++E GR+ +P   RP++E +   + 
Sbjct: 241 AKEVLAAFNSGFSPMLSVEMGRRAIPDDVRPTMEDMEGALR 281


>gi|163744359|ref|ZP_02151719.1| flagellar motor protein [Oceanibulbus indolifex HEL-45]
 gi|161381177|gb|EDQ05586.1| flagellar motor protein [Oceanibulbus indolifex HEL-45]
          Length = 288

 Score =  232 bits (592), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 87/279 (31%), Positives = 154/279 (55%), Gaps = 2/279 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M+ ++GL +    + GGF   GGN  I++   P+E +++ GA LG FV+AN   V+K S 
Sbjct: 1   MTLLLGLVMVFGLVFGGFMLSGGNMDIVLHALPYEGMMIGGASLGAFVIANSFSVVKSSL 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
             ++ +          Y D+L L++ L    K       + HI++P  S IF   P +++
Sbjct: 61  GGVVRVIKGPRWKAADYNDLLALMFELARLYKTKGIVAMDEHIENPEASPIFQRYPKLMK 120

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           ++ +T  I D  RM+ +     +++E++M+ +I    +E L    AI  M + LPAIGIV
Sbjct: 121 DHFVTDLIADSFRMMSMQFDDRFQMEDVMNRKIKKHHHESLVSASAIQSMADGLPAIGIV 180

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG+IK M ++ + P+ILG  IG +L GT LG+ L+Y +  P+  +++    +   +Y
Sbjct: 181 AAVLGVIKTMSSIDKPPEILGAMIGGALVGTFLGVFLAYCMVQPIAGRLEQIEEEDSAMY 240

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVA 277
            +++  ++A + G  P + IE GR  +P +++P+   V 
Sbjct: 241 TVIRDVIVAIVAGHPPSICIELGRGNIPTTKQPNFSAVE 279


>gi|27381993|ref|NP_773522.1| flagellar motor protein MotA [Bradyrhizobium japonicum USDA 110]
 gi|27355163|dbj|BAC52147.1| chemotaxis protein [Bradyrhizobium japonicum USDA 110]
          Length = 349

 Score =  232 bits (592), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 145/289 (50%), Positives = 203/289 (70%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           + + +G+FIT+  ++GGF AMGG+  +L+QP+E VI+ G  +G F++ANP K + D+GV+
Sbjct: 52  LLSFVGIFITVAALLGGFAAMGGHLAVLMQPWEFVIIMGTAVGTFIVANPWKTVVDTGVA 111

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            ++       GQ  Y D+L  L+ LM  L+   RNE E HIDDP +S IF + P+VL + 
Sbjct: 112 CMQAITGAVPGQRYYLDLLGALHALMRELRGKGRNEVEAHIDDPASSEIFKAFPSVLGDP 171

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FICDY+R+II+GNAR++EIE LMDEEI  I+  KL PYH++  + E+LPA+GIV A
Sbjct: 172 SLLQFICDYVRLIIMGNARTHEIEALMDEEIHTIVKGKLAPYHSLVTVSEALPALGIVAA 231

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKAMG L QSPK+LG  IG +L GT  GI LSY + +P   +IK TR K+ R YII
Sbjct: 232 VLGVIKAMGALDQSPKLLGGFIGAALVGTFAGIFLSYGIISPFAIKIKMTREKKCRPYII 291

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKA 289
           VK+ L+A+MNGA+PQ+A+E+GRK++  SERPSI++V  E +       A
Sbjct: 292 VKQTLLAFMNGAMPQIAVEHGRKMISSSERPSIDVVENETIAGPKAVVA 340


>gi|73539428|ref|YP_299795.1| chemotaxis MotA protein [Ralstonia eutropha JMP134]
 gi|72122765|gb|AAZ64951.1| chemotaxis MotA protein [Ralstonia eutropha JMP134]
          Length = 287

 Score =  232 bits (592), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 99/285 (34%), Positives = 164/285 (57%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++G  + +  ++GG+   GG+   L QP E+VI+ GA  G F+  N  K +K +  +
Sbjct: 1   MLVVLGYIVVVAAVLGGYAMTGGHMGALYQPAELVIIGGAAAGAFIATNTTKALKATLKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      ++ Y DV+ LLY+L+   ++      E  I DP  S++F+  P +L + 
Sbjct: 61  LPGLFKSSKYKKELYLDVMSLLYVLLSKARREGILFLEKEIADPAASSVFSQYPRILSDP 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  F+ DY+RM++ GN  ++EIE LMD EI+   +E   P HA+S +G++LPA GIV A
Sbjct: 121 VVMEFLTDYLRMMVNGNMNAFEIEALMDHEIETFRHEAEIPAHALSRVGDALPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++ A+ +    P  LG  I  ++ GT LGI+L+Y   +PL ++I+    +  ++Y  
Sbjct: 181 VMGVVHALASADLPPAELGALIAHAMVGTFLGILLAYGFVSPLAARIELQVSENVKVYEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           +K  L+A +NG  P VA+E+GRKVL  + RPS   +   V +   
Sbjct: 241 IKVVLLASLNGYAPLVAVEFGRKVLYSTVRPSFLELDDHVREVKS 285


>gi|293604984|ref|ZP_06687381.1| chemotaxis MotA protein [Achromobacter piechaudii ATCC 43553]
 gi|292816812|gb|EFF75896.1| chemotaxis MotA protein [Achromobacter piechaudii ATCC 43553]
          Length = 263

 Score =  232 bits (591), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 101/263 (38%), Positives = 158/263 (60%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  +IG  + I+ ++G F A+GG+   L QPFE+ ++ GA  G F+  N  K +     +
Sbjct: 1   MLIVIGFLVVIVSVVGSFIALGGHLGALYQPFELTLIFGAAFGAFLAGNSKKSLMLVKKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L +        +D Y +++ LLY+L+   ++      E+HI+DP +S IF   P + ++ 
Sbjct: 61  LPDALKSSRYSKDVYMELMALLYVLLNKARREGLMAIESHIEDPASSPIFGEYPRIAKDA 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +L  FI DY+R++I GN  S+EIE LMDEEI+   +E+  P HA+  M + LPA GIV A
Sbjct: 121 KLMEFITDYLRIMISGNMSSFEIETLMDEEIETYRHEREVPAHALQQMADGLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKA+  + Q P ILG  I  ++ GT LGI+L+Y    PL S+++    +  ++   
Sbjct: 181 VLGVIKALAAVDQPPAILGDLISKAMVGTFLGILLAYGFVGPLASRVERRNDEAMKVLEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRK 263
           +K  L+A MNG  PQ+A+E+GRK
Sbjct: 241 IKTTLLASMNGYPPQLAVEFGRK 263


>gi|327394203|dbj|BAK11625.1| chemotaxis protein MotA [Pantoea ananatis AJ13355]
          Length = 260

 Score =  231 bits (590), Expect = 8e-59,   Method: Composition-based stats.
 Identities = 89/253 (35%), Positives = 147/253 (58%)

Query: 36  IVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRN 95
           ++AGAG+G F++ N  K IK +  +L  +F      +  Y D++ LLY LM   ++    
Sbjct: 1   MIAGAGVGAFLVGNNGKSIKKTLKALPLLFRGSKYNKAVYMDLMALLYRLMAKSRQQGML 60

Query: 96  ETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIIL 155
             E  I+DP  S IF + P +L + +L  FI DY+R+++ GN  ++EIE LMDEEI+   
Sbjct: 61  SLERDIEDPAQSEIFANYPRILADKQLVDFITDYLRLMVSGNMNAFEIEALMDEEIETYE 120

Query: 156 YEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIIL 215
           +E   P  +I+ +G+ LPA GIV A++G++ A+ +  +    LG  +  ++ GT LGI+L
Sbjct: 121 HECEVPAQSIAAVGDGLPAFGIVAAVMGVVHALASADRPAAELGALVAHAMVGTFLGILL 180

Query: 216 SYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEI 275
           +Y   +PL S ++    +  ++   VK  L++ +NG  PQ+A+E+GRK L  +ERPS   
Sbjct: 181 AYGFISPLASVLRQKCAETTKMMQCVKVTLLSSLNGYAPQIAVEFGRKTLYSAERPSFSE 240

Query: 276 VAQEVLQYNHNKK 288
           + + V    +  K
Sbjct: 241 LEEHVRNAKNPAK 253


>gi|170723855|ref|YP_001751543.1| flagellar motor protein MotA [Pseudomonas putida W619]
 gi|169761858|gb|ACA75174.1| flagellar motor MotA protein [Pseudomonas putida W619]
          Length = 283

 Score =  231 bits (588), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 94/282 (33%), Positives = 150/282 (53%), Gaps = 2/282 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M+ IIG+ +    ++GG+    G    LIQPFE++I+ GA  G F+ ANP  +       
Sbjct: 1   MAKIIGIIVVFASVLGGYVLSHGKIAALIQPFEVLIIGGAAFGAFMQANPGYMTMHVIKK 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            L++F         Y +VL L+Y ++   ++      E+ I+D   S IF   P VL + 
Sbjct: 61  SLKMF-GTRFTHTFYLEVLGLVYEILNKSRREGMMAIESDIEDAAASPIFAKYPAVLGDE 119

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +T FICDY+R++  GN   +E+E L D E+  +  E   P HA++ + + +P  GIV A
Sbjct: 120 RMTAFICDYLRIMSTGNMAPHELEGLFDMELLSMKEELEHPSHAVNGIADGMPGFGIVAA 179

Query: 181 ILGIIKAMGNLSQ-SPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYI 239
           +LGI+  M +L +     +G  +G +L GT  GI+ +Y    PL   ++    ++  LY 
Sbjct: 180 VLGIVVTMASLGEGDQASIGLHVGAALVGTFFGILAAYGFFGPLAKCLEHDAKEELNLYE 239

Query: 240 IVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
            +K +L+A  +G  P +A+E+GRKVL    RPS   + Q V 
Sbjct: 240 SIKASLVASASGMPPSLAVEFGRKVLYPKHRPSFAELEQAVR 281


>gi|163758007|ref|ZP_02165095.1| flagellar motor protein MotA [Hoeflea phototrophica DFL-43]
 gi|162284296|gb|EDQ34579.1| flagellar motor protein MotA [Hoeflea phototrophica DFL-43]
          Length = 290

 Score =  231 bits (588), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 155/290 (53%), Positives = 213/290 (73%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M+ IIG  IT+ C++GG+ AMGG   +L QPFE+VI+ GAG+GGF+M+NP KVIKD+  +
Sbjct: 1   MNMIIGFVITLGCVLGGYMAMGGKLGVLNQPFELVIIGGAGIGGFIMSNPTKVIKDTMKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L E F  K   +  Y D L +LY LM +L+  SRNE E HID+P  S +F   PTVLEN 
Sbjct: 61  LGEAFKNKVPKEREYLDTLSILYALMRDLRTKSRNEIEAHIDNPDESELFLLAPTVLENK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           ELT+FICDY+R+II+GNAR +EIE LMDEEI  I  ++LK Y+A+S + ++ PAIGI+ A
Sbjct: 121 ELTSFICDYVRLIIIGNARPHEIEALMDEEIQTISTDRLKAYNAMSTLSDAFPAIGIIAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKAMG +++SP++LG  IG +L GT+LGI L Y + +P+ + IK  R KQ+RLY I
Sbjct: 181 VLGVIKAMGAITESPEVLGGLIGAALVGTMLGIFLCYCVVSPVATNIKIVRTKQNRLYTI 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           VK+ L+AYMNG++PQVA+E+GRK +   ERPSI+ V QE++      +A+
Sbjct: 241 VKQTLLAYMNGSVPQVALEHGRKTISSYERPSIDAVEQEMMNPGGGGQAA 290


>gi|261855635|ref|YP_003262918.1| flagellar motor protein MotA [Halothiobacillus neapolitanus c2]
 gi|261836104|gb|ACX95871.1| flagellar motor protein MotA [Halothiobacillus neapolitanus c2]
          Length = 283

 Score =  231 bits (588), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 98/282 (34%), Positives = 155/282 (54%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M+ IIG  +    ++GGF   GG+  +L+QP E +I+ GA L  FV  N  K +K +   
Sbjct: 1   MNVIIGWVLLFGAVLGGFALAGGHLIVLVQPVEYIIIIGAALAAFVAGNSGKTMKATMGG 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
                      +  Y + L LLY +    +K      E  I+DP NS +F   P+VL ++
Sbjct: 61  FATALKGSKYKKALYMETLALLYHIFTRARKEGLMAIEEDIEDPQNSALFKEAPSVLADH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               FI DY+R+++      ++I+NLMD +ID    E   P   I+ + + LPA GIV A
Sbjct: 121 HALDFITDYLRLMVSSTLDVHQIDNLMDIDIDTHHQEASLPGTNIAKIADGLPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG++  M ++++ P +LG  I  +L GT LGI++SY L  P+ + ++       + Y  
Sbjct: 181 VLGVVHTMESVAEPPAVLGGLIAAALVGTFLGILVSYGLVAPVAANLEHKVNDSTKYYQS 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQ 282
           +K A+IA+MNG  PQVA E+GRKVL  S+RP  + + + + +
Sbjct: 241 IKAAMIAFMNGYPPQVAAEFGRKVLFSSDRPGFQELEEFLKK 282


>gi|325923664|ref|ZP_08185289.1| flagellar motor component [Xanthomonas gardneri ATCC 19865]
 gi|325545863|gb|EGD17092.1| flagellar motor component [Xanthomonas gardneri ATCC 19865]
          Length = 284

 Score =  230 bits (587), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 91/270 (33%), Positives = 158/270 (58%)

Query: 15  IGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDT 74
           +GG+    G    L QP+E++I+ GA LG F+++ P K++K++  S+L +F       + 
Sbjct: 15  LGGYVLSHGKLGALWQPYELLIIGGAALGAFLVSTPGKIVKETFSSVLGVFKGPQYKSED 74

Query: 75  YCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMII 134
           Y D L L+Y L+   ++      E+H++ P +STIF + P V+ ++ L  FI D +R++I
Sbjct: 75  YKDTLSLVYELLNKARRDGFMALEDHVEKPQDSTIFGNYPKVVADHHLLDFITDCLRLMI 134

Query: 135 VGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQS 194
             N   +E+E L++ E++   +E + P HA+S + + LP  GIV A+LGI+  MG++   
Sbjct: 135 GSNIEPHELEPLLELELEKHHHEAMAPSHALSKVSDGLPGFGIVAAVLGIVITMGSIGGP 194

Query: 195 PKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIP 254
            + +G  +G +L GT LGI+L+Y    PL++ +++   +  R+Y  VK AL+A + G  P
Sbjct: 195 IEEIGHHVGAALVGTFLGILLAYGFVAPLSAAMEARADQDGRIYEAVKTALLACLRGYNP 254

Query: 255 QVAIEYGRKVLPLSERPSIEIVAQEVLQYN 284
           ++A+E+ RK LP + RPS       +    
Sbjct: 255 KIALEFARKTLPSNVRPSFADFETHLKTIK 284


>gi|315499554|ref|YP_004088357.1| mota/tolq/exbb proton channel [Asticcacaulis excentricus CB 48]
 gi|315417566|gb|ADU14206.1| MotA/TolQ/ExbB proton channel [Asticcacaulis excentricus CB 48]
          Length = 288

 Score =  230 bits (587), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 84/284 (29%), Positives = 163/284 (57%), Gaps = 2/284 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  IIG+ +   C+ G +   GG+   ++    +E++ + GA +   +++N L  IK  G
Sbjct: 1   MFQIIGIVVLFACVFGSYLLSGGSMAPILHSLAYEMMGIGGAAVASVLISNDLHTIKGMG 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
             + ++FG        Y D+L LL+ L   +K       E+HI+ P  S+IF+  P +++
Sbjct: 61  GGMGKVFGGAKWKPSDYRDLLSLLFQLTKTMKAKGVIALESHIEKPQESSIFSRYPKIMK 120

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           ++    FICD +RM+ +     +++E+ M+++++   +E + P HA+  + ++LPA+GIV
Sbjct: 121 DHFAIDFICDTLRMMTMNLEDPHQVEDAMEKQLEKHHHEAMHPAHAMQSVADALPALGIV 180

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG+IK MG +++ P++LG  IG +L GT LG++L+Y L  P  +++     ++   Y
Sbjct: 181 IAVLGVIKTMGAITEPPEVLGGMIGGALVGTFLGVMLAYGLVGPFATRMNGVVEEEAAFY 240

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQ 282
            I++  L+A+++G   Q+++E GR  +P   +PS   + + +  
Sbjct: 241 KIIQAVLVAHLHGNAAQISVEIGRGNIPSGAQPSFAEMEEALNN 284


>gi|295690962|ref|YP_003594655.1| MotA/TolQ/Exbb proton channel [Caulobacter segnis ATCC 21756]
 gi|295432865|gb|ADG12037.1| MotA/TolQ/ExbB proton channel [Caulobacter segnis ATCC 21756]
          Length = 288

 Score =  230 bits (587), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 87/284 (30%), Positives = 164/284 (57%), Gaps = 2/284 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  IIG+ +    + G +   GG   +++   P E++ + GAG+  F+++N + VIK + 
Sbjct: 1   MFQIIGIVLLFALVFGSYLMGGGKMDVILHAAPHELMAILGAGIAAFLISNSMTVIKATA 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
               +IF         Y D+L LL++L   +K       E+HI+ P+ S IF   P +  
Sbjct: 61  GGFGKIFAGPKWKASDYRDLLSLLFLLTKTMKSKGVIALESHIEKPHESKIFERYPKITH 120

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           ++    FICD +RM+ +     +++E+ M+++++   +E L+P HA+  M ++LPA+GIV
Sbjct: 121 DHFAVDFICDTLRMMTMNLEDPHQVEDAMEKQLEKHHHEALEPAHALQSMADALPALGIV 180

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG+IK MG++++ P +LG  IG +L GT LG+ ++Y L  P+ +++++   +    Y
Sbjct: 181 AAVLGVIKTMGSITEPPAVLGGMIGGALVGTFLGVFMAYGLVGPMAARLQAVVNEDAAFY 240

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQ 282
            I++  L+A+++G   Q+++E GR  +P   +PS   + + + Q
Sbjct: 241 KIIQAVLVAHLHGNAAQISVEIGRGNVPSPAQPSFAELEEALSQ 284


>gi|15600147|ref|NP_253641.1| flagellar motor protein MotA [Pseudomonas aeruginosa PAO1]
 gi|218894049|ref|YP_002442918.1| flagellar motor protein MotA [Pseudomonas aeruginosa LESB58]
 gi|254238331|ref|ZP_04931654.1| chemotaxis protein MotA [Pseudomonas aeruginosa C3719]
 gi|9951235|gb|AAG08339.1|AE004908_5 chemotaxis protein MotA [Pseudomonas aeruginosa PAO1]
 gi|126170262|gb|EAZ55773.1| chemotaxis protein MotA [Pseudomonas aeruginosa C3719]
 gi|218774277|emb|CAW30094.1| chemotaxis protein MotA [Pseudomonas aeruginosa LESB58]
          Length = 283

 Score =  230 bits (587), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 93/282 (32%), Positives = 154/282 (54%), Gaps = 2/282 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           MS IIG+ +    ++GGF   GG    +IQPFE++I+ GA LG F+ +NP          
Sbjct: 1   MSKIIGIIVVFASVLGGFLLSGGKIGAIIQPFEVLIIGGAALGAFLQSNPGSTFMVVLKK 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
             ++F  +   Q  Y +VL +LY ++   ++      E  I+DP  S IF+  P VL++ 
Sbjct: 61  APKMFSNR-FTQTYYLEVLGMLYEILNKSRREGMMAIEADIEDPAASPIFSKYPGVLKDE 119

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +T ++CDY+R++  GN   +E+E L D E+  +  +   P HA++ + ++LP  GIV A
Sbjct: 120 RMTAYVCDYLRIMSSGNMAPHELEGLFDMELSSLKEDLEHPSHAVTKVADALPGFGIVAA 179

Query: 181 ILGIIKAMGNLSQSP-KILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYI 239
           +LGI+  M  L +     +G  +  +L GT LGI+ +Y    PL   ++    ++  L+ 
Sbjct: 180 VLGIVITMALLGEGSQAEIGHHVAAALVGTFLGILAAYGFVGPLAGALEHDAKEELNLFE 239

Query: 240 IVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
            +K  L+A  +G  P +A+E+GRKVL  + RP+   + Q V 
Sbjct: 240 AIKACLVASASGMPPSLAVEFGRKVLLPAHRPTFAELEQAVR 281


>gi|90577361|ref|ZP_01233172.1| flagellar motor protein [Vibrio angustum S14]
 gi|90440447|gb|EAS65627.1| flagellar motor protein [Vibrio angustum S14]
          Length = 285

 Score =  230 bits (586), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 80/285 (28%), Positives = 147/285 (51%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   IG  I I+C+ GG+   GGN   + QP E +I+AGA LG  ++ NP  V+K+    
Sbjct: 1   MQKFIGAIIIIICVFGGYVWAGGNLRAIWQPAEFLIIAGATLGSLIIGNPPHVLKEMRQQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
             ++   +      Y +++ LL  L+  ++       + HI+ P +STIF   P +  ++
Sbjct: 61  FRQVLSPRNNEAQYYMELMALLQTLLDTVRNKGFKALDEHIESPQSSTIFNRYPLIKHDH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            + +FI D +R++ +G    YE+E L+++EI  I  + L P  ++    E+LP  GI+ A
Sbjct: 121 HVISFITDNLRLMAMGQMSPYELEGLLEQEISAIEEDLLLPSRSMQRTAEALPGFGILAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++GII  M  +  S  ++G  +  +L GT LGI   Y + +P ++ +     +    +  
Sbjct: 181 VMGIIITMQAIDGSIAMIGYHVAAALVGTFLGIFGCYCILDPASNAMAQRVKRNMSAFEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           ++  L+AY+      +AI+ GRK + L  +P+   + + + +   
Sbjct: 241 IRATLVAYVAKKPTLLAIDAGRKHIQLDIKPTFNEMERWLTEQEG 285


>gi|145297472|ref|YP_001140313.1| LafT [Aeromonas salmonicida subsp. salmonicida A449]
 gi|142850244|gb|ABO88565.1| LafT [Aeromonas salmonicida subsp. salmonicida A449]
          Length = 301

 Score =  230 bits (586), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 83/282 (29%), Positives = 152/282 (53%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   IGL +  +C++GGF   GG P  L QP E++I+ GA +G   + N  +V+ +    
Sbjct: 17  MQKQIGLGVIFICVLGGFMMAGGKPIALWQPAELIIIIGAAVGSMFLGNSKEVMHEMWRQ 76

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           + + F      ++ Y ++L L++ L+   +       + HI++P  S++F   P + E+ 
Sbjct: 77  MKQCFKSNKDEKEIYRELLTLMHQLLEETRNKGMKALDEHIENPQQSSVFLMYPQISEDP 136

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +L  FI D +R++ +G    +E++ ++++EI  I  + LKP HA+   GE+ P  GI+ A
Sbjct: 137 QLLGFIIDNLRLLGMGKITPHELDTMLEQEIMAIEEDMLKPAHALHKTGEACPGFGILAA 196

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++GII  M  L      +G  +  +L GT +GI L Y L  P+++ ++    ++  L + 
Sbjct: 197 VMGIIITMQQLDGPLSNIGVHVAAALVGTFIGIFLCYCLLEPISNAMEEMVKRRIGLLMC 256

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQ 282
           +K  LIA + G  P ++++ GRK+L    +PS   + + V  
Sbjct: 257 IKSILIAQLRGKTPLISVDSGRKMLEPDVKPSFLELEEWVTN 298


>gi|332284001|ref|YP_004415912.1| flagellar motor protein MotA [Pusillimonas sp. T7-7]
 gi|330427954|gb|AEC19288.1| flagellar motor protein MotA [Pusillimonas sp. T7-7]
          Length = 290

 Score =  229 bits (585), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 106/290 (36%), Positives = 166/290 (57%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  I  + + G F  +GG+   L QPFE V++AGA +G ++ ++  K +K    S
Sbjct: 1   MFIILGFLIVFISVFGSFVMLGGHLGALYQPFEFVLIAGAAIGAYIASSSSKSVKLLFSS 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L   F     G++ Y +++ LLY+L+   ++      E+ I++P +S IF   P +L + 
Sbjct: 61  LPIAFRKSPYGKELYMELMALLYVLLNKARRDGLMSIESDIEEPESSPIFADYPRILRDK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FI DYMR++I GN  S+EIE LMD+EI+    E+  P +A+  + ++LPA GIV A
Sbjct: 121 NLMEFITDYMRLMISGNMSSFEIETLMDQEIEAHFQERSVPSNALRAVADALPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKA+ ++ Q P IL   I  ++ GT LG++L+Y    P  S I+   +   ++   
Sbjct: 181 VLGVIKALASVDQPPAILADLISKAMVGTFLGVLLAYGFVAPFASSIERRSVASMKVLEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           +K  L+A MNG  PQ+A+E+GRKVL    RPS   +   V Q     K +
Sbjct: 241 IKVTLLASMNGYPPQLAVEFGRKVLYSYARPSFMELEDHVRQTRSTAKKA 290


>gi|26991583|ref|NP_747008.1| flagellar motor protein MotA [Pseudomonas putida KT2440]
 gi|148549983|ref|YP_001270085.1| flagellar motor protein MotA [Pseudomonas putida F1]
 gi|24986671|gb|AAN70472.1|AE016688_11 motility protein, MotA family [Pseudomonas putida KT2440]
 gi|148514041|gb|ABQ80901.1| Flagellar motor component-like protein [Pseudomonas putida F1]
 gi|313500884|gb|ADR62250.1| Flagellar motor protein MotA [Pseudomonas putida BIRD-1]
          Length = 283

 Score =  229 bits (585), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 93/282 (32%), Positives = 149/282 (52%), Gaps = 2/282 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M+ IIG+ +    ++GG+    G    LIQPFE++I+ GA  G F+ ANP  +       
Sbjct: 1   MAKIIGIIVVFASVLGGYVLSHGKIAALIQPFEVLIIGGAAFGAFLQANPGHMTMHVIKK 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            +++F         Y +VL L+Y ++   ++      E  I+D   S IF   PTVL + 
Sbjct: 61  SMKMF-GSRFSHAFYLEVLGLVYEILNKSRREGMMAIEADIEDAAASPIFAKYPTVLADE 119

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +T F+CDY+R++  GN   +E+E L D E+  +  E   P HA++ + + +P  GIV A
Sbjct: 120 RMTAFVCDYLRIMSTGNMAPHELEGLFDMELLSMKEELEHPSHAVTGIADGMPGFGIVAA 179

Query: 181 ILGIIKAMGNLSQ-SPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYI 239
           +LGI+  M +L       +G  +G +L GT  GI+ +Y    PL   ++    ++  LY 
Sbjct: 180 VLGIVVTMASLGDGDQAAIGMHVGAALVGTFFGILAAYGFFGPLAKCLEHDAKEELNLYE 239

Query: 240 IVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
            +K +L+A  +G  P +A+E+GRKVL    RPS   + Q V 
Sbjct: 240 SIKASLVASASGMPPSLAVEFGRKVLYPKHRPSFAELEQAVR 281


>gi|237653885|ref|YP_002890199.1| flagellar motor protein MotA [Thauera sp. MZ1T]
 gi|237625132|gb|ACR01822.1| flagellar motor protein MotA [Thauera sp. MZ1T]
          Length = 284

 Score =  229 bits (585), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 102/285 (35%), Positives = 162/285 (56%), Gaps = 1/285 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  IIG  I +   +G +    G+   L  P E + + G  +GGFV  N  K IK +  S
Sbjct: 1   MFLIIGYVIILAASLGTYAV-HGSLAALWVPMEYLAIIGLMIGGFVAGNGPKAIKGTLGS 59

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L          +  Y D+L LL+ ++  ++K      EN I++P +S IF+  P+V  ++
Sbjct: 60  LSLAVKGSKYNKALYVDLLALLFEILAKVRKEGLMSIENDIENPDSSPIFSKYPSVAADH 119

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+ DY+RM++ GN  ++EIENLMD EI+    E  +  H +S + +++PA GIV A
Sbjct: 120 HAVEFMTDYLRMMVGGNLNAFEIENLMDMEIETHHQEAHQAPHVVSKVADAVPAFGIVVA 179

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  MG++ Q P +LG  IG +L GT LGI++SY    P+ SQ++    +  ++Y +
Sbjct: 180 VMGVVNVMGSVGQPPAVLGKMIGGALVGTFLGILVSYGFVAPIASQLEQKVEESGKIYQV 239

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           +K  L+A MNG  PQVA+E+GRKVL  ++RP    + QE+     
Sbjct: 240 IKVVLLASMNGYAPQVAVEFGRKVLYSTDRPGFAELEQEIKNRKG 284


>gi|222147564|ref|YP_002548521.1| flagellar motor protein MotA [Agrobacterium vitis S4]
 gi|221734552|gb|ACM35515.1| chemotaxis transmembrane protein [Agrobacterium vitis S4]
          Length = 291

 Score =  229 bits (585), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 179/291 (61%), Positives = 233/291 (80%), Gaps = 1/291 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M+ IIG  IT+ CI+GGF AMGG+  +LIQPFE++I+ GAGLGGFVMANP+K++KDSG +
Sbjct: 1   MNIIIGFVITVGCILGGFMAMGGHLNVLIQPFELLIIGGAGLGGFVMANPMKIVKDSGKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L E F +    +  Y DVL +LY LM +L+  SRNE E HID+P  S+IF + P +L+N 
Sbjct: 61  LGEAFKHAVPKERAYLDVLGVLYSLMRDLRTKSRNEIEAHIDNPEESSIFQTAPNLLKNK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           ELT+FICDY+R+II+GNARS+EIE LMDEEI+ IL++K+KPYHAI+ MG+S PAIGIV A
Sbjct: 121 ELTSFICDYVRLIIIGNARSHEIEALMDEEINTILHDKMKPYHAITAMGDSFPAIGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKAMG +++SP++LG  IG +L GT+LGI LSYS+CNPLTSQIK  R KQHRLYII
Sbjct: 181 VLGVIKAMGKINESPEVLGGLIGAALVGTMLGIFLSYSVCNPLTSQIKIVRTKQHRLYII 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQ-YNHNKKAS 290
           VK+ L+AYMNG++PQVA+EYGRK +   ERPSI+ V QE++     N+KA+
Sbjct: 241 VKQTLLAYMNGSVPQVALEYGRKTISSYERPSIDAVEQEMMNPGGGNEKAA 291


>gi|269138689|ref|YP_003295390.1| flagellar motor protein [Edwardsiella tarda EIB202]
 gi|267984350|gb|ACY84179.1| flagellar motor protein [Edwardsiella tarda EIB202]
 gi|304558695|gb|ADM41359.1| Flagellar motor rotation protein MotA [Edwardsiella tarda FL6-60]
          Length = 269

 Score =  229 bits (585), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 94/262 (35%), Positives = 154/262 (58%)

Query: 29  IQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDTYCDVLKLLYILMYN 88
            QP E++I+ GAG+G F++ N  K IK +  +L ++       +  Y DV+ L+Y L+  
Sbjct: 2   YQPSELLIIGGAGIGAFIVGNNGKAIKSTLRTLPKLARGSKYNKALYMDVMGLMYQLLAK 61

Query: 89  LKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMIIVGNARSYEIENLMD 148
            ++      E  I+DP  S IF++ P ++ +N L  FI DYMR+II GN  ++EIE+LMD
Sbjct: 62  SRQQGMLSLERDIEDPKASEIFSNYPRLIADNTLIEFITDYMRLIISGNMNAFEIESLMD 121

Query: 149 EEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQSPKILGTAIGVSLTG 208
           EEI+    E   P  +++ +G+SLPA GIV A++G++ A+ +  +    LG  I  ++ G
Sbjct: 122 EEIETFEQEAEVPAGSLAAVGDSLPAFGIVAAVMGVVHALASADRPAAELGALIAHAMVG 181

Query: 209 TLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIPQVAIEYGRKVLPLS 268
           T LGI+L+Y   +PL S ++    +  ++   +K  L++ +NG  PQ+A+E+GRK L  +
Sbjct: 182 TFLGILLAYGFISPLASLMRQKSAETTKMMHCIKTTLLSSLNGYAPQIAVEFGRKTLYST 241

Query: 269 ERPSIEIVAQEVLQYNHNKKAS 290
           ERPS   + + V Q     K +
Sbjct: 242 ERPSFIELEEHVRQVKTPAKQA 263


>gi|325271246|ref|ZP_08137791.1| flagellar motor protein MotA [Pseudomonas sp. TJI-51]
 gi|324103649|gb|EGC00951.1| flagellar motor protein MotA [Pseudomonas sp. TJI-51]
          Length = 283

 Score =  229 bits (584), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 93/282 (32%), Positives = 149/282 (52%), Gaps = 2/282 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M+ IIG+ +    ++GG+    G    LIQPFE++I+ GA  G F+ ANP  +       
Sbjct: 1   MAKIIGIIVVFASVLGGYVLSHGKIAALIQPFEVLIIGGAAFGAFLQANPGYMTMHVIKK 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            +++F         Y +VL L+Y ++   ++      E  I+D   S IF   PTVL + 
Sbjct: 61  SMKMF-GSRFSHAFYLEVLGLVYEILNKSRREGMMAIEADIEDAAASPIFAKYPTVLADE 119

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +T F+CDY+R++  GN   +E+E L D E+  +  E   P HA++ + + +P  GIV A
Sbjct: 120 RMTAFVCDYLRIMSTGNMAPHELEGLFDMELLSMKEELEHPSHAVTGIADGMPGFGIVAA 179

Query: 181 ILGIIKAMGNLSQ-SPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYI 239
           +LGI+  M +L       +G  +G +L GT  GI+ +Y    PL   ++    ++  LY 
Sbjct: 180 VLGIVVTMASLGDGDQAAIGMHVGAALVGTFFGILAAYGFFGPLAKCLEHDAKEELNLYE 239

Query: 240 IVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
            +K +L+A  +G  P +A+E+GRKVL    RPS   + Q V 
Sbjct: 240 SIKASLVASASGMPPSLAVEFGRKVLYPKHRPSFAELEQAVR 281


>gi|107104053|ref|ZP_01367971.1| hypothetical protein PaerPA_01005126 [Pseudomonas aeruginosa PACS2]
          Length = 283

 Score =  229 bits (584), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 92/282 (32%), Positives = 154/282 (54%), Gaps = 2/282 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           MS IIG+ +    ++GGF   GG    +IQPFE++I+ GA LG F+ +NP          
Sbjct: 1   MSKIIGIIVVFASVLGGFLLSGGKIGAIIQPFEVLIIGGAALGAFLQSNPGSTFMVVLKK 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
             ++F  +   Q  Y +VL +LY ++   ++      E  I+DP  S IF+  P VL++ 
Sbjct: 61  APKMFSNR-FTQTYYLEVLGMLYEILNKSRREGMMAIEADIEDPAASPIFSKYPGVLKDE 119

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +T ++CDY+R++  GN   +E+E L D E+  +  +   P HA++ + ++LP  GIV A
Sbjct: 120 RMTAYVCDYLRIMSSGNMAPHELEGLFDMELSSLKEDLEHPSHAVTKVADALPGFGIVAA 179

Query: 181 ILGIIKAMGNLSQSP-KILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYI 239
           +LGI+  M  L +     +G  +  +L GT LGI+ +Y    PL   ++    ++  ++ 
Sbjct: 180 VLGIVITMALLGEGSQAEIGHHVAAALVGTFLGILAAYGFVGPLAVALEHDAKEELNMFE 239

Query: 240 IVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
            +K  L+A  +G  P +A+E+GRKVL  + RP+   + Q V 
Sbjct: 240 AIKACLVASASGMPPSLAVEFGRKVLLPAHRPTFAELEQAVR 281


>gi|124268057|ref|YP_001022061.1| chemotaxis signal transduction protein CheY [Methylibium
           petroleiphilum PM1]
 gi|124260832|gb|ABM95826.1| Chemotaxis signal transduction protein CheY [Methylibium
           petroleiphilum PM1]
          Length = 286

 Score =  229 bits (584), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 96/283 (33%), Positives = 156/283 (55%), Gaps = 2/283 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  IIG  + + CI G +   GGN  +++   P E++ + G   G FV+AN  K +K   
Sbjct: 1   MFVIIGYVVALGCIFGAYAIHGGNMQVILHAIPTEMMAIGGGAAGAFVVANQPKTLKAVL 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
            ++  +       +  Y +++ LLY ++   +K      E  ++DP+NS +F    TV  
Sbjct: 61  KAIPTLLKGSKYTKARYMELMALLYDILQKARKEGLMAIEKDVEDPHNSPLFKKYATVGS 120

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           ++ +  F+ DY+RM++ GN   +EIE+LMD EI+   +E   P  AI  +  +LPA GIV
Sbjct: 121 DHHVVEFVTDYLRMMVSGNLNPHEIESLMDSEIETHHHEAHAPAAAIGRLAGALPAFGIV 180

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG++  MG++ Q P +LG  IG +L GT LGI+L+Y++  PL   ++    +  +  
Sbjct: 181 AAVLGVVNTMGSVGQPPAVLGGMIGSALVGTFLGILLAYAVVEPLGGLLEQKNDEGSKEL 240

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
             +K  L+A M G  P +A+E+GRK L  +ERPS   +   V 
Sbjct: 241 QCIKTTLLASMQGYAPAIAVEFGRKTLYSTERPSFSELEGHVK 283


>gi|190572620|ref|YP_001970465.1| flagellar motor protein MotA [Stenotrophomonas maltophilia K279a]
 gi|190010542|emb|CAQ44151.1| putative chemotaxis protein MotA [Stenotrophomonas maltophilia
           K279a]
          Length = 284

 Score =  229 bits (584), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 91/284 (32%), Positives = 155/284 (54%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  + I+ +IGG+    G    L QP+E+VI+ GA LG F++  P K +K +  +
Sbjct: 1   MLIIVGFLVVIISVIGGYLGAHGRLGALWQPYELVIIGGAALGAFLVGTPAKTVKQTLQA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           ++ +F      Q  Y DVL LLY L+   ++      E+H++ P  S +F + P V  ++
Sbjct: 61  MVGVFKGPRYKQQDYIDVLSLLYELLNKARREGFMALEDHVERPAESALFGNYPKVQADH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FI D +R++I  N   +E+E L++ E++    E + P   ++ + + LP  GIV A
Sbjct: 121 HLIDFITDCLRLMIGSNIEPHELEPLLELELEKHHAEAMAPSQVLTKVADGLPGFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGI+  MG++      +G  +  +L GT LGI+L Y    P+ + +++   +  R+Y  
Sbjct: 181 VLGIVITMGSIGGDIVEVGGHVAGALVGTFLGILLGYGFVGPMAAAMEARAEQDSRIYES 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYN 284
           VK AL+A + G  P++A+E+ RK LP + RP+     Q +    
Sbjct: 241 VKTALLACLRGYNPKIALEFARKTLPSNVRPAFSDFEQHLKTVK 284


>gi|152986658|ref|YP_001351002.1| flagellar motor protein MotA [Pseudomonas aeruginosa PA7]
 gi|150961816|gb|ABR83841.1| chemotaxis protein MotA [Pseudomonas aeruginosa PA7]
          Length = 283

 Score =  229 bits (584), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 94/282 (33%), Positives = 155/282 (54%), Gaps = 2/282 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           MS IIG+ +    ++GG+   GG    +IQPFE++I+ GA LG F+ ANP          
Sbjct: 1   MSKIIGIIVVFASVLGGYLLSGGKIGAIIQPFEVLIIGGAALGAFLQANPGNTFMVVLKK 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
             ++FG++   Q  Y +VL +LY ++   ++      E  I+DP  S IF+  P VL++ 
Sbjct: 61  APKMFGHR-FTQTFYLEVLGMLYEILNKSRREGMMAIEADIEDPSASPIFSKYPGVLKDE 119

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +T ++CDY+R++  GN   +E+E L D E+  +  +   P HA++ + ++LP  GIV A
Sbjct: 120 RMTAYVCDYLRIMSSGNMAPHELEGLFDMELSSLKEDLEHPSHAVTKVADALPGFGIVAA 179

Query: 181 ILGIIKAMGNLSQSP-KILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYI 239
           +LGI+  M  L +     +G  +  +L GT LGI+ +Y    PL   ++    ++  L+ 
Sbjct: 180 VLGIVITMALLGEGSQAEIGHHVAAALVGTFLGILAAYGFVGPLAGALEHDAKEELNLFE 239

Query: 240 IVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
            +K  L+A  +G  P +A+E+GRKVL    RP+   + Q V 
Sbjct: 240 AIKACLVASASGMPPSLAVEFGRKVLLPGHRPTFAELEQAVR 281


>gi|89068742|ref|ZP_01156128.1| chemotaxis MotA protein [Oceanicola granulosus HTCC2516]
 gi|89045705|gb|EAR51767.1| chemotaxis MotA protein [Oceanicola granulosus HTCC2516]
          Length = 288

 Score =  229 bits (584), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 92/284 (32%), Positives = 152/284 (53%), Gaps = 2/284 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILI--QPFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M+  +G+ +    + GGF   GG   I++   P+E +++ GA LG FV+AN   V+K S 
Sbjct: 1   MNLFLGIALVFGLVFGGFILSGGKLDIVLYALPYEGMMIGGAALGAFVIANSFGVLKGSA 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
           + ++++          Y D+L LLY L    K       + H+++P +S IF   P +L+
Sbjct: 61  IGMMKVITGPRWKAADYSDLLNLLYELSRLYKSKGILALDEHVENPKDSEIFKRYPKILK 120

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           ++  T  I D  RM+ +     Y+ E++++ +I    +E L P  A+S M + LPAIGIV
Sbjct: 121 DHFATELITDSFRMLSMNFDDQYQTEDVINRKIKKHHHESLAPASAVSVMADGLPAIGIV 180

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG+IK M  L Q P +LG  IG +L GT LG+ L+Y L  P++ ++K    +    Y
Sbjct: 181 AAVLGVIKTMSALDQPPDVLGKMIGGALVGTFLGVFLAYCLVAPISGRLKQIEEEDGTFY 240

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQ 282
           +I++   +A +    P + IE GR  +P S++P    V     +
Sbjct: 241 LIIRDVFVAMVAKHPPNICIEIGRGNIPTSKQPDFYKVEAAQKE 284


>gi|254521006|ref|ZP_05133061.1| chemotaxis protein [Stenotrophomonas sp. SKA14]
 gi|219718597|gb|EED37122.1| chemotaxis protein [Stenotrophomonas sp. SKA14]
          Length = 284

 Score =  229 bits (584), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 90/284 (31%), Positives = 155/284 (54%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  + I+ ++GG+    G    L QP+E+VI+ GA LG F++  P K +K +  +
Sbjct: 1   MLIIVGFLVVIISVLGGYLGAHGRLGALWQPYELVIIGGAALGAFLVGTPAKTVKQTLQA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           ++ +F      Q  Y DVL LLY L+   ++      E+H++ P  S +F + P V  ++
Sbjct: 61  MVGVFKGPRYKQQDYIDVLSLLYELLNKARREGFMALEDHVERPAESALFGNYPKVQADH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FI D +R++I  N   +E+E L++ E++    E + P   ++ + + LP  GIV A
Sbjct: 121 HLIDFITDCLRLMIGSNIEPHELEPLLELELEKHHAEAMAPSQVLTKVADGLPGFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGI+  MG++      +G  +  +L GT LGI+L Y    P+ + +++   +  R+Y  
Sbjct: 181 VLGIVITMGSIGGDIVEVGGHVAGALVGTFLGILLGYGFVGPMAAAMEARAEQDSRIYES 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYN 284
           VK AL+A + G  P++A+E+ RK LP + RP+     Q +    
Sbjct: 241 VKTALLACLRGYNPKIALEFARKTLPSNVRPAFSDFEQHLKTVK 284


>gi|22758826|gb|AAN04224.1| LafT [Aeromonas salmonicida]
          Length = 301

 Score =  229 bits (584), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 83/282 (29%), Positives = 152/282 (53%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   IGL +  +C++GGF   GG P  L QP E++I+ GA +G   + N  +V+ +    
Sbjct: 17  MQKQIGLGVIFICVLGGFMMAGGKPIALWQPAELIIIIGAAVGSMFLGNSKEVMHEMWRQ 76

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           + + F      ++ Y ++L L++ L+   +       + HI++P  S++F   P + E+ 
Sbjct: 77  MKQCFKSNKDEKEIYRELLTLMHQLLEETRNKGMKALDEHIENPQQSSVFLMYPQISEDP 136

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +L  FI D +R++ +G    +E++ ++++EI  I  + LKP HA+   GE+ P  GI+ A
Sbjct: 137 QLLGFIIDNLRLLGMGKITPHELDTMLEQEIMAIEEDMLKPAHALHKAGEACPGFGILAA 196

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++GII  M  L      +G  +  +L GT +GI L Y L  P+++ ++    ++  L + 
Sbjct: 197 VMGIIITMQQLDGPLSNIGVHVAAALVGTFIGIFLCYCLLEPISNAMEEMVKRRIGLLMC 256

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQ 282
           +K  LIA + G  P ++++ GRK+L    +PS   + + V  
Sbjct: 257 IKSILIAQLRGKTPLISVDSGRKMLEPDVKPSFLELEEWVTN 298


>gi|77456740|ref|YP_346245.1| flagellar motor protein MotA [Pseudomonas fluorescens Pf0-1]
 gi|77380743|gb|ABA72256.1| chemotaxis MotA protein [Pseudomonas fluorescens Pf0-1]
          Length = 283

 Score =  229 bits (584), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 94/282 (33%), Positives = 152/282 (53%), Gaps = 2/282 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M+ IIG+ +    ++GG+    G    LIQPFE++I+ GA LG F+ ANP  +       
Sbjct: 1   MAKIIGIIVVFASVLGGYVLSHGKIAALIQPFEVMIIGGAALGAFLQANPGYMTMHVLKK 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            L +F         Y +VL L+Y ++   ++      E  I+D   S IF   P VL++ 
Sbjct: 61  SLSMFS-SRFSHTFYLEVLGLIYEILNKSRREGMMAIEGDIEDAAASPIFAKYPAVLKDE 119

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +T FICDY+R++  GN   +E+E L D E+  +  +   P HA++ + +++P  GIV A
Sbjct: 120 RMTAFICDYLRIMSSGNMAPHELEGLFDMELYSLKEDLEHPSHAVNGIADAMPGFGIVAA 179

Query: 181 ILGIIKAMGNLSQ-SPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYI 239
           +LGI+  M +L +   K +G  +G +L GT  GI+ +Y    PL   +     ++  +Y 
Sbjct: 180 VLGIVVTMASLGEGDQKSIGLHVGAALVGTFFGILAAYGFFGPLAHSLAHDAKEELNVYE 239

Query: 240 IVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
            +K +L+A  +G  P +A+E+GRKVL  + RPS   + Q V 
Sbjct: 240 AIKASLVASASGMPPSLAVEFGRKVLYPAHRPSFAELEQAVR 281


>gi|225874274|ref|YP_002755733.1| putative chemotaxis MotA protein [Acidobacterium capsulatum ATCC
           51196]
 gi|225793247|gb|ACO33337.1| putative chemotaxis MotA protein [Acidobacterium capsulatum ATCC
           51196]
          Length = 299

 Score =  229 bits (583), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 90/279 (32%), Positives = 159/279 (56%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G+ I I  ++GGF    G   +L+QP E++I+ GA +G  ++ANPL+++K     
Sbjct: 1   MLAIVGILIVIGAVLGGFLMEKGPLLVLMQPAELLIIGGAAVGTMLIANPLRILKAIAGG 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  + G  + G+D Y   LK+LY L+   ++      E  I++P  S +F + P  L+++
Sbjct: 61  LKGVLGKSSFGKDNYLTTLKMLYELLNKARRLGMLGIEADIENPAESQLFQNYPNFLKHH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+CD +RM I GN  +++++ +M+ +I++  +  ++P  A++ M +SLP +GIV A
Sbjct: 121 HHRDFVCDTLRMAISGNVDAFDMDQMMERDIEVHHHGAMQPITALTTMADSLPGLGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG++  MG L   P  +G  +  +L GT LGI++ Y    PL+S +  T   ++    +
Sbjct: 181 VLGVVITMGALDGPPGEIGHKVAAALVGTFLGILMCYGFVGPLSSSMSKTVDDENAYLYV 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQE 279
           ++  LI+++ G  P +AIE GR+ +P   RP    V   
Sbjct: 241 LRIVLISFIKGQPPVLAIEAGRRAIPSHVRPGFAEVEAA 279


>gi|89072297|ref|ZP_01158876.1| flagellar motor protein [Photobacterium sp. SKA34]
 gi|89051829|gb|EAR57281.1| flagellar motor protein [Photobacterium sp. SKA34]
          Length = 285

 Score =  229 bits (583), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 81/284 (28%), Positives = 148/284 (52%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   IG  I I+C+ GG+   GGN   + QP E++I+AGA LG  ++ NP  V+K+    
Sbjct: 1   MQKFIGAIIIIICVFGGYVWAGGNLRAIWQPAELLIIAGATLGSLIIGNPPHVLKEMRQQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
             +I   +      Y +++ LL  L+  ++       + HI+ P +STIF   P +  ++
Sbjct: 61  FRQILSPRNNEAQYYMELMALLQTLLDTVRNKGFKALDEHIESPQSSTIFNRYPLIKNDH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            + +FI D +R++ +G    YE+E L+++EI  I  + L P  ++    E+LP  GI+ A
Sbjct: 121 HVISFITDNLRLMAMGQMSPYELEGLLEQEISAIEEDLLLPSRSMQRTAEALPGFGILAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++GII  M  +  S  ++G  +  +L GT LGI   Y + +P ++ +     +    +  
Sbjct: 181 VMGIIITMQAIDGSIAMIGYHVAAALVGTFLGIFGCYCILDPASNAMAQRVKRNMSAFEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYN 284
           ++  L+AY+      +AI+ GRK + L  +P+   + + + +  
Sbjct: 241 IRATLVAYVAKKPTLLAIDAGRKHIQLDIKPTFNEMEKWLTEQE 284


>gi|91794979|ref|YP_564630.1| MotA/TolQ/ExbB proton channel [Shewanella denitrificans OS217]
 gi|91716981|gb|ABE56907.1| MotA/TolQ/ExbB proton channel [Shewanella denitrificans OS217]
          Length = 285

 Score =  229 bits (583), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 86/285 (30%), Positives = 154/285 (54%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           MS +IGL I +  + GG+   GG    L QP EI+I+ GAGLG  ++ANP  V+++  V 
Sbjct: 1   MSKLIGLIIILASVFGGYIWAGGTLMSLWQPAEILIIFGAGLGALIIANPRSVLEEMLVQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
             E+   +    + Y  +  L+ +LM  ++       + HI++P  S++F   P+VLE+ 
Sbjct: 61  TKELIVKEKEDPELYPQLFALMSLLMSQIQSQGLKVLDEHIENPRESSLFLMYPSVLEHP 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           ++  F+ D +R+  +G    +++E+L +EEI  I  ++L+P  A++ +GE++P  GI+ A
Sbjct: 121 DVLQFLIDNLRIQSIGKMSPHDLEHLFEEEIHRIEEDRLRPSEALNKVGEAMPGFGILAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++GII  M N+     ++G  +  +L GT +GI   Y   +PL+  ++    ++      
Sbjct: 181 VMGIIITMSNIDGPITMIGVKVAAALVGTFIGIFACYCFFDPLSKALEHLVDRKSAQLRC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           V   L A+  G  P +AI+ GRK +    RPS   + + + +   
Sbjct: 241 VAAVLAAFAKGKPPTMAIDAGRKQIQSENRPSFVELERWMEEQKS 285


>gi|116053103|ref|YP_793422.1| flagellar motor protein MotA [Pseudomonas aeruginosa UCBPP-PA14]
 gi|254244158|ref|ZP_04937480.1| chemotaxis protein MotA [Pseudomonas aeruginosa 2192]
 gi|296391794|ref|ZP_06881269.1| flagellar motor protein MotA [Pseudomonas aeruginosa PAb1]
 gi|313109956|ref|ZP_07795883.1| chemotaxis protein MotA [Pseudomonas aeruginosa 39016]
 gi|115588324|gb|ABJ14339.1| chemotaxis protein MotA [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126197536|gb|EAZ61599.1| chemotaxis protein MotA [Pseudomonas aeruginosa 2192]
 gi|310882385|gb|EFQ40979.1| chemotaxis protein MotA [Pseudomonas aeruginosa 39016]
          Length = 283

 Score =  228 bits (582), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 93/282 (32%), Positives = 154/282 (54%), Gaps = 2/282 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           MS IIG+ +    ++GGF   GG    +IQPFE++I+ GA LG F+ ANP          
Sbjct: 1   MSKIIGIIVVFASVLGGFLLSGGKIGAIIQPFEVLIIGGAALGAFLQANPGSTFMVVLKK 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
             ++F  +   Q  Y +VL +LY ++   ++      E  I+DP  S IF+  P VL++ 
Sbjct: 61  APKMFSNR-FTQTYYLEVLGMLYEILNKSRREGMMAIEADIEDPAASPIFSKYPGVLKDE 119

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +T ++CDY+R++  GN   +E+E L D E+  +  +   P HA++ + ++LP  GIV A
Sbjct: 120 RMTAYVCDYLRIMSSGNMAPHELEGLFDMELSSLKEDLEHPSHAVTKVADALPGFGIVAA 179

Query: 181 ILGIIKAMGNLSQSP-KILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYI 239
           +LGI+  M  L +     +G  +  +L GT LGI+ +Y    PL   ++    ++  ++ 
Sbjct: 180 VLGIVITMALLGEGSQAEIGHHVAAALVGTFLGILAAYGFVGPLAVALEHDAKEELNMFE 239

Query: 240 IVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
            +K  L+A  +G  P +A+E+GRKVL  + RP+   + Q V 
Sbjct: 240 AIKACLVASASGMPPSLAVEFGRKVLLPAHRPTFAELEQAVR 281


>gi|84502393|ref|ZP_01000529.1| chemotaxis MotA protein [Oceanicola batsensis HTCC2597]
 gi|84389205|gb|EAQ02002.1| chemotaxis MotA protein [Oceanicola batsensis HTCC2597]
          Length = 288

 Score =  228 bits (582), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 89/288 (30%), Positives = 148/288 (51%), Gaps = 2/288 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M+  +GL +    + GGF   GG   I++   PFE +++ GA LG FV+AN   VIK SG
Sbjct: 1   MTMFLGLAMVFGLVFGGFMLSGGKMDIVLHALPFEGMMIGGAALGSFVIANSFTVIKASG 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
             + ++          Y D+L L+Y L    K       ++HI++P  S IF   P +L+
Sbjct: 61  KGVGKVIKGPKWKAKDYNDLLALMYELTRLYKAKGVLALDDHIENPEGSEIFGRYPRILK 120

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           ++     I D  RM+ +     Y  E++++ +I    +E L+  HAI  M + LPAIGIV
Sbjct: 121 DHFAIDLIRDSFRMLSMQFDDKYATEDVINRKIKKHHHESLEAAHAIQTMADGLPAIGIV 180

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG+IK M ++ Q P++LG  IG +L GT LG+ L+Y +  P++ ++     +    Y
Sbjct: 181 AAVLGVIKTMSSIDQPPEVLGAMIGGALVGTFLGVFLAYCMVQPISGRLTQIEDEDGAFY 240

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHN 286
            +++   +A ++   P + +E GR  +P   +P    V     +    
Sbjct: 241 HVIRDIFVAMVSNQPPNICVEIGRGNIPTRMQPDFYEVEAAQKELPAA 288


>gi|167035947|ref|YP_001671178.1| flagellar motor protein MotA [Pseudomonas putida GB-1]
 gi|166862435|gb|ABZ00843.1| flagellar motor MotA protein [Pseudomonas putida GB-1]
          Length = 283

 Score =  228 bits (582), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 93/282 (32%), Positives = 150/282 (53%), Gaps = 2/282 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M+ IIG+ +    ++GG+    G    LIQPFE++I+ GA  G F+ ANP  +       
Sbjct: 1   MAKIIGIIVVFASVLGGYVLSHGKIAALIQPFEVLIIGGAAFGAFLQANPGHMTMHVIKK 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            +++F         Y +VL L+Y ++   ++      E  I+D   S IF   PTVL + 
Sbjct: 61  SMKMF-GSRFSHAFYLEVLGLVYEILNKSRREGMMAIEADIEDAAASPIFAKYPTVLADE 119

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +T F+CDY+R++  GN   +E+E L D E+  +  E   P HA++ + + +P  GIV A
Sbjct: 120 RMTAFVCDYLRIMSTGNMAPHELEGLFDMELLSMKEELEHPSHAVTGIADGMPGFGIVAA 179

Query: 181 ILGIIKAMGNLSQ-SPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYI 239
           +LGI+  M +L +     +G  +G +L GT  GI+ +Y    PL   ++    ++  LY 
Sbjct: 180 VLGIVVTMASLGEGDQAAIGMHVGAALVGTFFGILAAYGFFGPLAKCLEHDAKEELNLYE 239

Query: 240 IVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
            +K +L+A  +G  P +A+E+GRKVL    RPS   + Q V 
Sbjct: 240 SIKASLVASASGMPPSLAVEFGRKVLYPKHRPSFAELEQAVR 281


>gi|330807220|ref|YP_004351682.1| Chemotaxis protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327375328|gb|AEA66678.1| Chemotaxis protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 283

 Score =  228 bits (582), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 94/282 (33%), Positives = 151/282 (53%), Gaps = 2/282 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M+ IIG+ +    ++GG+    G    LIQPFE++I+ GA LG F+ ANP  +       
Sbjct: 1   MAKIIGIIVVFASVLGGYVLSHGKIAALIQPFEVMIIGGAALGAFLQANPGYMTMHVLKK 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            L +F         Y +VL L+Y ++   ++      E  I+D   S IF   P VL++ 
Sbjct: 61  SLGMFS-SRFSHTFYLEVLGLIYEILNKSRREGMMAIEGDIEDAAASPIFAKYPAVLKDA 119

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +T FICDY+R++  GN   +E+E L D E+  +  +   P HA++ + +++P  GIV A
Sbjct: 120 RMTAFICDYLRIMSSGNMAPHELEGLFDMELYSLKEDLEHPSHAVTGIADAMPGFGIVAA 179

Query: 181 ILGIIKAMGNLSQ-SPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYI 239
           +LGI+  M +L     K +G  +G +L GT  GI+ +Y    PL   +     ++  +Y 
Sbjct: 180 VLGIVVTMASLGDGDQKSIGLHVGAALVGTFFGILAAYGFFGPLAHSLAHDAKEELNVYE 239

Query: 240 IVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
            +K +L+A  +G  P +A+E+GRKVL  + RPS   + Q V 
Sbjct: 240 AIKASLVASASGMPPSLAVEFGRKVLYPAHRPSFAELEQAVR 281


>gi|227820850|ref|YP_002824820.1| flagellar motor protein MotA [Sinorhizobium fredii NGR234]
 gi|227339849|gb|ACP24067.1| chemotaxis protein motility protein A [Sinorhizobium fredii NGR234]
          Length = 292

 Score =  228 bits (581), Expect = 8e-58,   Method: Composition-based stats.
 Identities = 165/292 (56%), Positives = 223/292 (76%), Gaps = 2/292 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M+ IIGL +T  CI+GG+ AMGG+  +L QPFE++I+ GAG+GGF+MAN +KV+KD+G +
Sbjct: 1   MNIIIGLLVTFGCILGGYLAMGGHLEVLNQPFELMIIGGAGIGGFIMANSMKVVKDTGKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L E F +K   +  Y D L +LY LM +L+  SRNE E+HID+P  S IF S PTVL+N 
Sbjct: 61  LGEAFKHKVPKERHYLDTLGVLYSLMRDLRTKSRNEIESHIDNPEESPIFQSAPTVLQNK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           ELT FICDY+R+II+GNARS+EIE LMDEEI  I ++K+K YHA++ MG++LPAIGIV A
Sbjct: 121 ELTAFICDYVRLIIIGNARSHEIEALMDEEIHTITHDKMKCYHALTSMGDALPAIGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKAMG +S++P++LG  I  +L GTLLG+ LSYS+  PL + IK+ R KQ+RLY+I
Sbjct: 181 VLGVIKAMGAISEAPEVLGAKIAAALVGTLLGVFLSYSIVGPLVANIKAVREKQNRLYVI 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQ--YNHNKKAS 290
           VK+ L+AYMNG++PQVA+EYGRK +   ERPSI+ V QE++        KA+
Sbjct: 241 VKQTLLAYMNGSVPQVALEYGRKTISAYERPSIDAVEQEMMNPGGGGESKAA 292


>gi|21244418|ref|NP_644000.1| flagellar motor protein MotA [Xanthomonas axonopodis pv. citri str.
           306]
 gi|294667302|ref|ZP_06732522.1| flagellar motor protein [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
 gi|21110080|gb|AAM38536.1| chemotaxis protein [Xanthomonas axonopodis pv. citri str. 306]
 gi|292602974|gb|EFF46405.1| flagellar motor protein [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
          Length = 284

 Score =  228 bits (581), Expect = 9e-58,   Method: Composition-based stats.
 Identities = 91/270 (33%), Positives = 158/270 (58%)

Query: 15  IGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDT 74
           +GG+    G    L QP+E++I+ GA LG F+++ P K++K++   ++ +F       D 
Sbjct: 15  LGGYVLSHGKLGALWQPYELMIIGGAALGAFLVSTPGKIVKETLSGIMGVFKGPQYKSDD 74

Query: 75  YCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMII 134
           Y D L L+Y L+   ++      E+H++ P +STIF + P V+ ++ L  FI D +R++I
Sbjct: 75  YKDTLSLIYELLNKARRDGFMALEDHVEKPQDSTIFGNYPKVVADHHLLDFITDCLRLMI 134

Query: 135 VGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQS 194
             N   +E+E L++ E++   +E L P HA+S + + LP  GIV A+LGI+  MG++   
Sbjct: 135 GSNIEPHELEPLLELELEKHHHEALAPSHALSKVSDGLPGFGIVAAVLGIVITMGSIGGP 194

Query: 195 PKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIP 254
            + +G  +G +L GT LGI+L+Y   +PL++ +++   +  R+Y  VK AL+A + G  P
Sbjct: 195 IEEIGHHVGAALVGTFLGILLAYGFVSPLSAAMEARAEQDGRIYEAVKTALLACLRGYNP 254

Query: 255 QVAIEYGRKVLPLSERPSIEIVAQEVLQYN 284
           ++A+E+ RK LP + RPS       +    
Sbjct: 255 KIALEFARKTLPSNVRPSFGDFETHLKTIK 284


>gi|167626172|ref|YP_001676466.1| MotA/TolQ/ExbB proton channel [Shewanella halifaxensis HAW-EB4]
 gi|167356194|gb|ABZ78807.1| MotA/TolQ/ExbB proton channel [Shewanella halifaxensis HAW-EB4]
          Length = 285

 Score =  228 bits (581), Expect = 9e-58,   Method: Composition-based stats.
 Identities = 82/285 (28%), Positives = 154/285 (54%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           MS ++GL I +L + GG+   GG    L QP EI+I+ GAG+G  ++ANP  V+ +    
Sbjct: 1   MSKLLGLVIILLSVFGGYVWAGGALISLWQPAEILIIFGAGIGALIIANPKPVLIEMYEQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L E+   +    + Y  +  L+ +LM  ++       ++H++ P  S++F   P VLE+ 
Sbjct: 61  LKELVRVEREDPELYPQLFGLMNMLMAQIQSQGLRVLDDHVEKPRESSLFLMYPVVLEHP 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  F+ D +R+  +G    +++E++++EEI  I  ++++P HA + + E++P  GI+ A
Sbjct: 121 NVLNFLIDNLRLQSIGKLSPHDLEHMLEEEIHRIDEDRMRPSHAFNKVAEAMPGFGILAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++GII  M N+     ++G  +  +L GT +GI   Y + +PL+  ++    +Q      
Sbjct: 181 VMGIIITMSNIDGPITMIGVKVAAALVGTFIGIFACYCIFDPLSKAMEHLVERQSAQMRC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           V   L A+  G  P +AI+ GRK +    RP+   + + +++   
Sbjct: 241 VAAMLTAFAKGKPPMLAIDAGRKQIQSENRPTFIELERWLVEQKS 285


>gi|325915928|ref|ZP_08178224.1| flagellar motor component [Xanthomonas vesicatoria ATCC 35937]
 gi|325537895|gb|EGD09595.1| flagellar motor component [Xanthomonas vesicatoria ATCC 35937]
          Length = 284

 Score =  227 bits (580), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 91/270 (33%), Positives = 158/270 (58%)

Query: 15  IGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDT 74
           +GG+    G    L QP+E++I+ GA LG F+++ P K++K++   ++ +F       D 
Sbjct: 15  LGGYVLSHGKLGALWQPYELMIIGGAALGAFLVSTPGKIVKETLTGIMGVFKGPQYKSDD 74

Query: 75  YCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMII 134
           Y D L L+Y L+   ++      E+H++ P +STIF + P V+ ++ L  FI D +R++I
Sbjct: 75  YKDTLSLIYELLNKARRDGFMALEDHVEKPQDSTIFGNYPKVVADHHLLDFITDCLRLMI 134

Query: 135 VGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQS 194
             N   +E+E L++ E++   +E L P HA+S + + LP  GIV A+LGI+  MG++   
Sbjct: 135 GSNIEPHELEPLLELELEKHHHEALAPAHALSKVSDGLPGFGIVAAVLGIVITMGSIGGP 194

Query: 195 PKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIP 254
            + +G  +G +L GT LGI+L+Y   +PL++ +++   +  R+Y  VK AL+A + G  P
Sbjct: 195 IEEIGHHVGAALVGTFLGILLAYGFVSPLSAAMEARAEQDGRIYEAVKTALLACLRGYNP 254

Query: 255 QVAIEYGRKVLPLSERPSIEIVAQEVLQYN 284
           ++A+E+ RK LP + RPS       +    
Sbjct: 255 KIALEFARKTLPSNVRPSFGDFETHLKTIK 284


>gi|21233082|ref|NP_638999.1| flagellar motor protein MotA [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|188993234|ref|YP_001905244.1| flagellar motor protein MotA [Xanthomonas campestris pv. campestris
           str. B100]
 gi|21114935|gb|AAM42923.1| chemotaxis protein [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|167734994|emb|CAP53206.1| Flagellar motor component MotA [Xanthomonas campestris pv.
           campestris]
          Length = 284

 Score =  227 bits (580), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 92/270 (34%), Positives = 158/270 (58%)

Query: 15  IGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDT 74
           +GG+    G    L QP+E++I+ GA LG F+++ P K++K++   ++ +F       D 
Sbjct: 15  LGGYVLSHGKLGALWQPYELMIIGGAALGAFLVSTPGKIVKETLTGVMGVFKGPQYKSDD 74

Query: 75  YCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMII 134
           Y D L L+Y L+   ++      E+H++ P +STIF + P VL ++ L  FI D +R++I
Sbjct: 75  YKDTLSLIYELLNKARRDGFMALEDHVEKPQDSTIFGTYPKVLADHHLLDFITDCLRLMI 134

Query: 135 VGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQS 194
             N   +E+E L++ E++   +E L P HA+S + + LP  GIV A+LGI+  MG++   
Sbjct: 135 GSNIEPHELEPLLELELEKHHHEALAPAHALSKVSDGLPGFGIVAAVLGIVITMGSIGGP 194

Query: 195 PKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIP 254
            + +G  +G +L GT LGI+L+Y   +PL++ +++   +  R+Y  VK AL+A + G  P
Sbjct: 195 IEEIGHHVGAALVGTFLGILLAYGFVSPLSAAMEARAEQDGRIYEAVKTALLACLRGYNP 254

Query: 255 QVAIEYGRKVLPLSERPSIEIVAQEVLQYN 284
           ++A+E+ RK LP + RPS       +    
Sbjct: 255 KIALEFARKTLPSNVRPSFGDFETHLKTIK 284


>gi|289668314|ref|ZP_06489389.1| flagellar motor protein MotA [Xanthomonas campestris pv. musacearum
           NCPPB4381]
          Length = 284

 Score =  227 bits (580), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 91/270 (33%), Positives = 157/270 (58%)

Query: 15  IGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDT 74
           +GG+    G    L QP+E++I+ GA LG F+++ P K++K++   ++ +F       D 
Sbjct: 15  LGGYVLSHGKLGALWQPYELMIIGGAALGAFLVSTPGKIVKETFSGIMGVFKGPQYKSDD 74

Query: 75  YCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMII 134
           Y D L L+Y L+   ++      E+H++ P +STIF + P V+ ++ L  FI D +R++I
Sbjct: 75  YKDTLSLIYELLNKARRDGFMALEDHVEKPQDSTIFGNYPKVVADHHLLDFITDCLRLMI 134

Query: 135 VGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQS 194
             N   +E+E L++ E++   +E L P HA+S + + LP  GIV A+LGI+  MG +   
Sbjct: 135 GSNIEPHELEPLLELELEKHHHEALAPSHALSKVSDGLPGFGIVAAVLGIVITMGAIGGP 194

Query: 195 PKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIP 254
            + +G  +G +L GT LGI+L+Y   +PL++ +++   +  R+Y  VK AL+A + G  P
Sbjct: 195 IEEIGHHVGAALVGTFLGILLAYGFVSPLSAAMEARAEQDGRIYEAVKTALLACLRGYNP 254

Query: 255 QVAIEYGRKVLPLSERPSIEIVAQEVLQYN 284
           ++A+E+ RK LP + RPS       +    
Sbjct: 255 KIALEFARKTLPSNVRPSFGDFETHLKTIK 284


>gi|304412489|ref|ZP_07394095.1| MotA/TolQ/ExbB proton channel [Shewanella baltica OS183]
 gi|307307148|ref|ZP_07586886.1| MotA/TolQ/ExbB proton channel [Shewanella baltica BA175]
 gi|304349131|gb|EFM13543.1| MotA/TolQ/ExbB proton channel [Shewanella baltica OS183]
 gi|306910387|gb|EFN40818.1| MotA/TolQ/ExbB proton channel [Shewanella baltica BA175]
          Length = 285

 Score =  227 bits (580), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 83/285 (29%), Positives = 149/285 (52%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           MS ++GL I +  + GG+   GG    L QP EI+I+ GAG+G  ++ANP  V+K+    
Sbjct: 1   MSKLVGLLIILASVFGGYVWAGGALSALWQPAEILIIMGAGVGALIIANPQSVLKEMFEQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L E+F       + Y  +  L+  LM  ++       + H+++P  S+IF   P VL + 
Sbjct: 61  LKELFNKGKEDPELYPQLFPLMGTLMAQIQSQGLKVLDEHLENPQQSSIFLMYPAVLNHP 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  F+ D +R+  +G    +++E++++EEI  I  ++L+P  A S +GE++P  GI+ A
Sbjct: 121 NVLQFLIDNLRVQSIGKISPHDLEHILEEEIHRIEEDRLRPSEAFSKVGEAMPGFGILAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGII  M N+     ++G  +  +L GT +GI   Y   +P++  ++    ++      
Sbjct: 181 VLGIIITMSNIDGPITMIGVKVAAALVGTFIGIFACYCFFDPMSKALEHLVDRKSAQLRC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           +   L+ +  G  P +AI+ GRK +    RPS   + + +     
Sbjct: 241 IAAILVTFSKGKPPMMAIDAGRKQIQSENRPSFIELERWMEGQKS 285


>gi|152996654|ref|YP_001341489.1| flagellar motor component [Marinomonas sp. MWYL1]
 gi|150837578|gb|ABR71554.1| flagellar motor component [Marinomonas sp. MWYL1]
          Length = 284

 Score =  227 bits (580), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 93/267 (34%), Positives = 143/267 (53%)

Query: 18  FYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDTYCD 77
           + A  GN   L QPFEIVI+ GA LG F++ANP  V K     L ++       +  Y  
Sbjct: 18  YLASHGNLLALWQPFEIVIICGAALGAFMVANPFIVQKKVLTMLPQVISGSRHNKKFYLQ 77

Query: 78  VLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMIIVGN 137
           +L L+Y L    ++      E+ I+ P+ S +F   P V+ ++E+  F+ D  R+  +  
Sbjct: 78  LLGLMYCLFQKSRQEGFLSIEDDIESPFTSELFNRFPDVVRDHEVVNFLTDNYRIFTLTG 137

Query: 138 ARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQSPKI 197
             +YEIE +MD EI+ I  E + P HA+S + E LP  GIV A+LGI+  MG++    + 
Sbjct: 138 LPAYEIEAIMDNEIEQIQEELVAPSHALSRVAEGLPGFGIVAAVLGIVITMGSIGGPLEE 197

Query: 198 LGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIPQVA 257
           +G  +  +L GT LGI   Y    P  S ++S    + + Y+ +K  L + ++G  P VA
Sbjct: 198 IGAHVAAALVGTFLGIFFGYGFVGPAASHLESLGAHELKAYLCIKACLNSIVSGYAPPVA 257

Query: 258 IEYGRKVLPLSERPSIEIVAQEVLQYN 284
           +E GRK+LP   RPS   ++  + QY 
Sbjct: 258 VETGRKLLPPEMRPSFIELSDGLKQYR 284


>gi|237798268|ref|ZP_04586729.1| flagellar motor protein MotA [Pseudomonas syringae pv. oryzae str.
           1_6]
 gi|331021120|gb|EGI01177.1| flagellar motor protein MotA [Pseudomonas syringae pv. oryzae str.
           1_6]
          Length = 283

 Score =  227 bits (580), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 94/282 (33%), Positives = 152/282 (53%), Gaps = 2/282 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M+ IIG+ + I  I+GG+    G    L QP+E++I+ GA LG F+ ANP  +       
Sbjct: 1   MAKIIGIIVVIASILGGYVLSHGKIMALFQPYEVLIIGGAALGAFLQANPGYMFMHVFKK 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            L++F         Y +VL L+Y ++   ++      E  I+D  +S IFT  P VL++ 
Sbjct: 61  SLKMF-GSRFTHAYYLEVLGLVYEILNKSRREGMMAIEGDIEDAASSPIFTKYPGVLKDE 119

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +T +ICDY+R++  GN   +E+E L D E+  +  E   P HA++ + + +P  GIV A
Sbjct: 120 RMTAYICDYLRIMSSGNMAPHELEGLFDMELLSMKEELEHPSHAVTGVADGMPGFGIVAA 179

Query: 181 ILGIIKAMGNLS-QSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYI 239
           +LGI+  M +L       +G  +G +L GT  GI+ +Y    PL + +     ++  +Y 
Sbjct: 180 VLGIVVTMASLGSGDKAAIGMHVGAALVGTFFGILAAYGFFGPLATSLAHDAKEEMNVYE 239

Query: 240 IVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
            +K +L+A  +G  P +A+E+GRKVL    RPS   + Q V 
Sbjct: 240 SIKASLVASASGMPPSLAVEFGRKVLYPLHRPSFSELEQAVR 281


>gi|163800114|ref|ZP_02194015.1| flagellar motor protein [Vibrio sp. AND4]
 gi|159175557|gb|EDP60351.1| flagellar motor protein [Vibrio sp. AND4]
          Length = 285

 Score =  227 bits (580), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 79/285 (27%), Positives = 144/285 (50%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M    G    ++C+ GG+   GG    + QP E +I+ GA +G  ++ NP  V+K+    
Sbjct: 1   MQKFFGAITILVCVFGGYMWAGGKLGAIWQPAEFLIIIGAAVGSLIIGNPPHVLKEMRQQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L           + Y +++ LL  L+   +       ++HI+ P  S+IFT+ P V  ++
Sbjct: 61  LRATISSPREEYEYYMELMALLNNLLETARSRGFKHLDSHIESPEQSSIFTAHPKVSNDH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L +FI D +R++ +G    +E+E L+++EI+ I  E L P  ++   GE+LP  GI+ A
Sbjct: 121 RLISFITDNLRLMAMGQMSPHELEGLLEQEIESIQTEMLLPSRSMQRTGEALPGFGILAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           + GII  M  +  S  ++G  +  +L GT +GI   Y   +PL++ +     +    +  
Sbjct: 181 VGGIIITMQAIDGSIALIGYHVAAALVGTFIGIFGCYCCLDPLSNAMAQRVRRNMTAFEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           V+  L+AY+      +AI+ GRK + L  +P+   + + + +   
Sbjct: 241 VRATLVAYVAKKPTLLAIDAGRKHIQLDIKPTFNQMEKWLTEQEG 285


>gi|15964407|ref|NP_384760.1| flagellar motor protein MotA [Sinorhizobium meliloti 1021]
 gi|307311549|ref|ZP_07591190.1| flagellar motor protein MotA [Sinorhizobium meliloti BL225C]
 gi|307318904|ref|ZP_07598335.1| flagellar motor protein MotA [Sinorhizobium meliloti AK83]
 gi|17380459|sp|P97215|MOTA_RHIME RecName: Full=Motility protein A; AltName: Full=Chemotaxis protein
           MotA
 gi|15073584|emb|CAC45226.1| Chemotaxis (motility protein A) transmembrane [Sinorhizobium
           meliloti 1021]
 gi|306895318|gb|EFN26073.1| flagellar motor protein MotA [Sinorhizobium meliloti AK83]
 gi|306899566|gb|EFN30195.1| flagellar motor protein MotA [Sinorhizobium meliloti BL225C]
          Length = 292

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 164/289 (56%), Positives = 223/289 (77%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M+ IIGL +T  CI+GG+ AMGG+  +L QPFE++I+ GAG+GGF+MAN +KV+KD+G +
Sbjct: 1   MNIIIGLLVTFGCILGGYMAMGGHLEVLNQPFELMIIGGAGIGGFIMANSMKVVKDTGKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L E F +K   +  Y D L +LY LM +L+  SRNE E+HID+P  S+IF S PTVL+N 
Sbjct: 61  LGEAFRHKVPKEREYLDTLGVLYSLMRDLRTKSRNEIESHIDNPEESSIFQSAPTVLQNK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           ELT FICDY+R+II+GNARS+EIE LMDEEI  I ++K+K YHA++ MG++LPAIGIV A
Sbjct: 121 ELTAFICDYVRLIIIGNARSHEIEALMDEEIQTITHDKMKCYHAMTTMGDALPAIGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKAMG +S++P++LG  I  +L GTLLG+ LSYS+  PL + IKS R KQ+RLY+I
Sbjct: 181 VLGVIKAMGAISEAPEVLGAKIAAALVGTLLGVFLSYSIVGPLVANIKSVREKQNRLYVI 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKA 289
           VK+ L+AYMNG++PQVA+EYGRK +   ERPSI+ V QE++      ++
Sbjct: 241 VKQTLLAYMNGSVPQVALEYGRKTISAYERPSIDAVEQEMMNPGGGSES 289


>gi|166713569|ref|ZP_02244776.1| flagellar motor protein MotA [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 284

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 90/270 (33%), Positives = 158/270 (58%)

Query: 15  IGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDT 74
           +GG+    G    L QP+E++I+ GA LG F+++ P K++K++   ++ +F       + 
Sbjct: 15  LGGYVLSHGKLGALWQPYELMIIGGAALGAFLVSTPGKIVKETLSGIMGVFKGPQYKSED 74

Query: 75  YCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMII 134
           Y D L L+Y L+   ++      E+H++ P +STIF + P V+ ++ L  FI D +R++I
Sbjct: 75  YKDTLSLIYELLNKARRDGFMALEDHVEKPQDSTIFGNYPKVVADHHLLDFITDCLRLMI 134

Query: 135 VGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQS 194
             N   +E+E L++ E++   +E L P HA+S + + LP  GIV A+LGI+  MG++   
Sbjct: 135 GSNIEPHELEPLLELELEKHHHEALAPSHALSKVSDGLPGFGIVAAVLGIVITMGSIGGP 194

Query: 195 PKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIP 254
            + +G  +G +L GT LGI+L+Y   +PL++ +++   +  R+Y  VK AL+A + G  P
Sbjct: 195 IEEIGHHVGAALVGTFLGILLAYGFVSPLSAAMEARAEQDGRIYEAVKTALLACLRGYNP 254

Query: 255 QVAIEYGRKVLPLSERPSIEIVAQEVLQYN 284
           ++A+E+ RK LP + RPS       +    
Sbjct: 255 KIALEFARKTLPSNVRPSFGDFETHLKTIK 284


>gi|58580311|ref|YP_199327.1| flagellar motor protein MotA [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|78049370|ref|YP_365545.1| flagellar motor protein MotA [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|84622282|ref|YP_449654.1| flagellar motor protein MotA [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188578753|ref|YP_001915682.1| flagellar motor protein MotA [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|325926422|ref|ZP_08187747.1| flagellar motor component [Xanthomonas perforans 91-118]
 gi|58424905|gb|AAW73942.1| chemotaxis protein [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|78037800|emb|CAJ25545.1| flagellar motor component MotA [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|84366222|dbj|BAE67380.1| chemotaxis protein [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188523205|gb|ACD61150.1| flagellar motor component MotA [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|325543211|gb|EGD14649.1| flagellar motor component [Xanthomonas perforans 91-118]
          Length = 284

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 90/270 (33%), Positives = 158/270 (58%)

Query: 15  IGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDT 74
           +GG+    G    L QP+E++I+ GA LG F+++ P K++K++   ++ +F       + 
Sbjct: 15  LGGYVLSHGKLGALWQPYELMIIGGAALGAFLVSTPGKIVKETLSGIMGVFKGPQYKSED 74

Query: 75  YCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMII 134
           Y D L L+Y L+   ++      E+H++ P +STIF + P V+ ++ L  FI D +R++I
Sbjct: 75  YKDTLSLIYELLNKARRDGFMALEDHVEKPQDSTIFGNYPKVVADHHLLDFITDCLRLMI 134

Query: 135 VGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQS 194
             N   +E+E L++ E++   +E L P HA+S + + LP  GIV A+LGI+  MG++   
Sbjct: 135 GSNIEPHELEPLLELELEKHHHEALAPSHALSKVSDGLPGFGIVAAVLGIVITMGSIGGP 194

Query: 195 PKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIP 254
            + +G  +G +L GT LGI+L+Y   +PL++ +++   +  R+Y  VK AL+A + G  P
Sbjct: 195 IEEIGHHVGAALVGTFLGILLAYGFVSPLSAAMEARAEQDGRIYEAVKTALLACLRGYNP 254

Query: 255 QVAIEYGRKVLPLSERPSIEIVAQEVLQYN 284
           ++A+E+ RK LP + RPS       +    
Sbjct: 255 KIALEFARKTLPSNVRPSFGDFETHLKTIK 284


>gi|150395477|ref|YP_001325944.1| flagellar motor protein MotA [Sinorhizobium medicae WSM419]
 gi|150026992|gb|ABR59109.1| MotA/TolQ/ExbB proton channel [Sinorhizobium medicae WSM419]
          Length = 292

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 164/289 (56%), Positives = 225/289 (77%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M+ IIGL +T  CI+GG+ AMGG+  +L QPFE++I+ GAG+GGF+MAN +KV+KD+G +
Sbjct: 1   MNIIIGLLVTFGCILGGYMAMGGHLEVLNQPFELMIIGGAGIGGFIMANSMKVVKDTGKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L+E F +K   +  Y D L +LY LM +L+  SRNE E+HID+P +S+IF S PTVL+N 
Sbjct: 61  LVEAFKHKVPKERQYLDTLGVLYSLMRDLRTKSRNEIESHIDNPEDSSIFQSAPTVLQNK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           ELT FICDY+R+II+GNARS+EIE LMDEEI  I ++K+K YHA++ MG++LPAIGIV A
Sbjct: 121 ELTAFICDYVRLIIIGNARSHEIEALMDEEIQTITHDKMKCYHALTSMGDALPAIGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKAMG +S++P++LG  I  +L GTLLG+ LSYS+  PL + IKS R KQ+RLY+I
Sbjct: 181 VLGVIKAMGAISEAPEVLGAKIAAALVGTLLGVFLSYSIVGPLVANIKSVREKQNRLYVI 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKA 289
           VK+ L+AYMNG++PQVA+EYGRK +   ERPSI+ V QE++      ++
Sbjct: 241 VKQTLLAYMNGSVPQVALEYGRKTISAYERPSIDAVEQEMMNPGGGSES 289


>gi|289665511|ref|ZP_06487092.1| flagellar motor protein MotA [Xanthomonas campestris pv. vasculorum
           NCPPB702]
          Length = 284

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 90/270 (33%), Positives = 157/270 (58%)

Query: 15  IGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDT 74
           +GG+    G    L QP+E++I+ GA LG F+++ P K++K++   ++ +F       D 
Sbjct: 15  LGGYVLSHGKLGALWQPYELMIIGGAALGAFLVSTPGKIVKETFSGIMGVFKGPQYKSDD 74

Query: 75  YCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMII 134
           Y D L L+Y L+   ++      E+H++ P +STIF + P ++ ++ L  FI D +R++I
Sbjct: 75  YKDTLSLIYELLNKARRDGFMALEDHVEKPQDSTIFGNYPKLVADHHLLDFITDCLRLMI 134

Query: 135 VGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQS 194
             N   +E+E L++ E++   +E L P HA+S + + LP  GIV A+LGI+  MG +   
Sbjct: 135 GSNIEPHELEPLLELELEKHHHEALAPSHALSKVSDGLPGFGIVAAVLGIVITMGAIGGP 194

Query: 195 PKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIP 254
            + +G  +G +L GT LGI+L+Y   +PL++ +++   +  R+Y  VK AL+A + G  P
Sbjct: 195 IEEIGHHVGAALVGTFLGILLAYGFVSPLSAAMEARAEQDGRIYEAVKTALLACLRGYNP 254

Query: 255 QVAIEYGRKVLPLSERPSIEIVAQEVLQYN 284
           ++A+E+ RK LP + RPS       +    
Sbjct: 255 KIALEFARKTLPSNVRPSFGDFETHLKTIK 284


>gi|302384262|ref|YP_003820085.1| MotA/TolQ/ExbB proton channel [Brevundimonas subvibrioides ATCC
           15264]
 gi|302194890|gb|ADL02462.1| MotA/TolQ/ExbB proton channel [Brevundimonas subvibrioides ATCC
           15264]
          Length = 289

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 89/289 (30%), Positives = 164/289 (56%), Gaps = 2/289 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  IIGL +    + G +   GG   ++    P E++ + GA +  F+++N + V+K S 
Sbjct: 1   MFQIIGLVLLFGMVFGSYAISGGKFDVITHAAPHELMAIGGAAVAAFLISNSIGVVKSSL 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
             + + F      +  Y D+L LL+ L   +K       E+HI+ P  STIF   P VL+
Sbjct: 61  GGIGKAFAGPKWKKQDYKDLLSLLFALTKTMKSKGVIALESHIEKPGESTIFQKYPKVLK 120

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           ++  T FICD +RM+ +     ++IE+ M+++++   +E     HA+  M ++LPA+GIV
Sbjct: 121 DHFATDFICDTLRMMTMNLEDPHQIEDAMEKQLEKHHHEAAAAPHALQGMADALPALGIV 180

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG+IK MG++++ P++LG  IG +L GT +G+ L+Y +  PL +++++   ++   Y
Sbjct: 181 AAVLGVIKTMGSITEPPEVLGGMIGGALVGTFMGVFLAYGIVGPLAARLQAIVDEEAAFY 240

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
            I++  L+A+++G   Q+++E GR  +P S +PS   + + +       
Sbjct: 241 KIIQSVLVAHLHGNAAQISVEIGRGDIPSSAQPSFLEMEESLSAAPAEA 289


>gi|119897739|ref|YP_932952.1| flagellar motor protein MotA [Azoarcus sp. BH72]
 gi|119670152|emb|CAL94065.1| flagellar motor protein MotA [Azoarcus sp. BH72]
          Length = 284

 Score =  227 bits (579), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 105/285 (36%), Positives = 162/285 (56%), Gaps = 1/285 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  IIG  I +   +G +    G+   L  P E + + G  +GGFV  N  K +K +  S
Sbjct: 1   MFLIIGYVIILAASVGTYAV-HGSLAALWVPMEYLAIIGLMVGGFVAGNGPKAMKATLGS 59

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L          +  Y D+L LLY ++  ++K      EN +++P +S IF   P+V  ++
Sbjct: 60  LSLAVKGSPYNKALYMDLLSLLYEILAKVRKEGLMSIENDVENPDSSPIFGKYPSVTSDH 119

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  F+ DY+RM++ GN  ++EIENLMD EI+    E     H +S + + LPA GIV A
Sbjct: 120 HVVEFLTDYLRMMVGGNLNAFEIENLMDMEIETHHQEAHVAPHIVSKVADGLPAFGIVVA 179

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  MG++ Q P +LG  IG +L GT LGI+LSY +  P+ SQI+    +  ++Y +
Sbjct: 180 VMGVVNVMGSVGQPPAVLGKMIGGALVGTFLGILLSYGIVAPIASQIEQKVEESGKIYQV 239

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           +K  L+A MNG  PQVAIE+GRKVL  ++RP+   + QE+     
Sbjct: 240 MKVVLLASMNGYAPQVAIEFGRKVLYANDRPTFSELEQEIKNRKG 284


>gi|323492325|ref|ZP_08097478.1| flagellar motor protein MotA [Vibrio brasiliensis LMG 20546]
 gi|323313372|gb|EGA66483.1| flagellar motor protein MotA [Vibrio brasiliensis LMG 20546]
          Length = 285

 Score =  227 bits (579), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 77/285 (27%), Positives = 145/285 (50%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M    G    +LC+ GG+   GGN   + QP E +I+ GA  G  ++ NP +V+K+    
Sbjct: 1   MQKFFGAITVLLCVFGGYVWAGGNLGAIWQPAEYMIIIGAAAGSLIIGNPPQVLKEMRRQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +          ++   +++ L+ +L+  ++ G     + HI++P  S IF+  P V ++ 
Sbjct: 61  IGLTISGPKEEREYCMELMALMQVLLETVRSGGFKSLDKHIENPEQSPIFSRYPLVAKDY 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L +FI D +R++ +G    +E+E L+++EID I  + L P  ++    E+LP  GI+ A
Sbjct: 121 RLVSFITDNLRLMAMGQMSPHELEGLLEQEIDAIQTDLLLPSRSMQRTAEALPGFGILAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           + GII  M  +  S  ++G  +  +L GT +GI   Y   +PL++ +     +    +  
Sbjct: 181 VGGIIITMQAIDGSIALIGYHVAAALVGTFVGIFGCYCCLDPLSNAMAQRVKRDMTAFEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           V+  L+AY+      +AI+ GRK + L  +P+   + + + +   
Sbjct: 241 VRATLVAYVAKKPTLLAIDAGRKHIQLDIKPTFNQMEKWLAEQEG 285


>gi|158422268|ref|YP_001523560.1| flagellar motor protein [Azorhizobium caulinodans ORS 571]
 gi|158329157|dbj|BAF86642.1| flagellar motor protein [Azorhizobium caulinodans ORS 571]
          Length = 296

 Score =  227 bits (579), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 135/296 (45%), Positives = 194/296 (65%), Gaps = 6/296 (2%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++G+ + +    GGF AMGG+  ++ QPFE VI+ G     F++ANP+ VIKD+G  
Sbjct: 1   MMVLLGIVLGLGATFGGFMAMGGHLDVVWQPFEYVIIGGIAFSTFLIANPMSVIKDTGSG 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           ++      A  +  +  +L LLY LM  ++   RNE E HIDDP NS +F   PT+L++ 
Sbjct: 61  IMHAMSGVAPKRKDFLALLGLLYALMREVRAKPRNEVEAHIDDPANSGLFAHFPTILKDK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           ELT +ICDY R+II+GNA+S+EIE LM++EI  I   K KP  A+  + E+LPA+GI  A
Sbjct: 121 ELTQYICDYARLIIIGNAKSHEIEGLMEQEISTIKKHKTKPAAALGTVAEALPALGICAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGI+KAMG + QSP+ILG  IG +L GT +GI  SY++ +PL  +IK TR KQ + +II
Sbjct: 181 VLGIVKAMGAIDQSPEILGHYIGSALIGTFVGIYSSYAIISPLAHKIKVTREKQCQPFII 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEV------LQYNHNKKAS 290
           VK+ LIA+MNGA+PQ+A+E+GRK +   ERP+I+ V  E             ++A+
Sbjct: 241 VKQTLIAFMNGALPQIALEHGRKTIAEGERPTIDEVESEAISNVPSSNSPPQQQAA 296


>gi|330960100|gb|EGH60360.1| flagellar motor protein MotA [Pseudomonas syringae pv. maculicola
           str. ES4326]
          Length = 283

 Score =  227 bits (578), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 91/282 (32%), Positives = 150/282 (53%), Gaps = 2/282 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M+ IIG+ +    ++GG+    G    L QP+E++I+ GA LG F+ ANP  +       
Sbjct: 1   MAKIIGIIVVFASVLGGYVLSHGKIMALFQPYEVLIIGGAALGAFLQANPGYMTMHVFKK 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            L++F         Y +VL L+Y ++   ++      E  I+D  +S IF   P VL++ 
Sbjct: 61  SLKMF-GSRFTHAYYLEVLGLVYEILNKSRREGMMAIEGDIEDAASSPIFAKYPGVLKDE 119

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +T +ICDY+R++  GN   +E+E L D E+  +  E   P HA++ + + +P  GIV A
Sbjct: 120 RMTAYICDYLRIMSSGNMAPHELEGLFDMELLSMKEELEHPSHAVTGIADGMPGFGIVAA 179

Query: 181 ILGIIKAMGNLS-QSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYI 239
           +LGI+  M +L       +G  +G +L GT  GI+ +Y    PL + +     ++  +Y 
Sbjct: 180 VLGIVITMASLGSGDKAAIGMHVGAALVGTFFGILAAYGFFGPLATCLAHDAKEEMNVYE 239

Query: 240 IVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
            +K +L+A  +G  P +A+E+GRKVL    RPS   + Q V 
Sbjct: 240 SIKASLVASASGMPPSLAVEFGRKVLYPLHRPSFSELEQAVR 281


>gi|1842124|gb|AAB47573.1| membrane associated protein MotA [Sinorhizobium meliloti]
 gi|1870713|gb|AAB48837.1| MotA [Sinorhizobium meliloti]
          Length = 292

 Score =  227 bits (578), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 163/289 (56%), Positives = 223/289 (77%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M+ IIGL +T  CI+GG+ AMGG+  +L QPFE++I+ GAG+GGF+MAN +KV+KD+G +
Sbjct: 1   MNIIIGLLVTFGCILGGYMAMGGHLEVLNQPFELMIIGGAGIGGFIMANSMKVVKDTGKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L E F +K   +  Y D L +LY LM +L+  SRNE E+HID+P  S+IF S PTVL+N 
Sbjct: 61  LGEAFRHKVPKEREYLDTLGVLYSLMRDLRTKSRNEIESHIDNPEESSIFQSAPTVLQNK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           ELT FICDY+R+II+GNARS+EIE LMDEEI  I ++K+K YHA++ MG++LPAIGIV A
Sbjct: 121 ELTAFICDYVRLIIIGNARSHEIEALMDEEIQTITHDKMKCYHAMTTMGDALPAIGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKAMG +S++P+++G  I  +L GTLLG+ LSYS+  PL + IKS R KQ+RLY+I
Sbjct: 181 VLGVIKAMGAISEAPEVVGAKIAAALVGTLLGVFLSYSIVGPLVANIKSVREKQNRLYVI 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKA 289
           VK+ L+AYMNG++PQVA+EYGRK +   ERPSI+ V QE++      ++
Sbjct: 241 VKQTLLAYMNGSVPQVALEYGRKTISAYERPSIDAVEQEMMNPGGGSES 289


>gi|289672565|ref|ZP_06493455.1| flagellar motor protein MotA [Pseudomonas syringae pv. syringae
           FF5]
 gi|330939853|gb|EGH43086.1| flagellar motor protein MotA [Pseudomonas syringae pv. pisi str.
           1704B]
 gi|330951463|gb|EGH51723.1| flagellar motor protein MotA [Pseudomonas syringae Cit 7]
 gi|330978962|gb|EGH78021.1| flagellar motor protein MotA [Pseudomonas syringae pv. aptata str.
           DSM 50252]
          Length = 283

 Score =  227 bits (578), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 92/282 (32%), Positives = 151/282 (53%), Gaps = 2/282 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M+ IIG+ + +  +IGG+    G    L QP+E++I+ GA LG F+ ANP  +       
Sbjct: 1   MAKIIGIIVVLASVIGGYVLSHGKVMALFQPYEVLIIGGAALGAFLQANPGYMFMHVFKK 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            L++F         Y +VL L+Y ++   ++      E  I+D  +S IF   P VL++ 
Sbjct: 61  SLKMF-GSRFTHAYYLEVLGLVYEILNKSRREGMMAIEGDIEDAASSPIFAKYPGVLKDE 119

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +T +ICDY+R++  GN   +E+E L D E+  +  +   P HAI+ + + +P  GIV A
Sbjct: 120 RMTAYICDYLRIMSSGNMAPHELEGLFDMELLSMKEDLEHPSHAITGIADGMPGFGIVAA 179

Query: 181 ILGIIKAMGNLS-QSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYI 239
           +LGI+  M +L       +G  +G +L GT  GI+ +Y    PL + +     ++  +Y 
Sbjct: 180 VLGIVVTMASLGSGDKAAIGMHVGAALVGTFFGILAAYGFFGPLATSLAHDAKEEMNVYE 239

Query: 240 IVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
            +K +L+A  +G  P +A+E+GRKVL    RPS   + Q V 
Sbjct: 240 AIKASLVASASGMPPSLAVEFGRKVLYPLHRPSFSELEQAVR 281


>gi|283851027|ref|ZP_06368312.1| flagellar motor protein MotA [Desulfovibrio sp. FW1012B]
 gi|283573673|gb|EFC21648.1| flagellar motor protein MotA [Desulfovibrio sp. FW1012B]
          Length = 284

 Score =  226 bits (577), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 84/281 (29%), Positives = 153/281 (54%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  IIG+ + +  + GGF   GG+  +L QP E++I+ GA LG F ++ P  +   +   
Sbjct: 1   MFVIIGIVVVLGSVFGGFLLEGGHMAVLFQPIELLIIGGAALGSFFISAPKSIALGTFKH 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +L +F  K      Y D+L LL+ L+   ++      E H+  P  S      P + +N 
Sbjct: 61  VLHVFKGKEPAAADYQDLLTLLFELINIARRDGIVALEPHVSKPEQSATINRYPNIAKNR 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +L  FICD ++ ++     ++  ++LM  +I  + +  +    A++ + ++LP +GIV A
Sbjct: 121 QLAYFICDNIKALLSEGIDAHRYDDLMRTDIATLHHHAMIAPGAVTKVADALPGLGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGI+  MG +++ P++LG +IG +L GT LGI+LSY    P+ S ++     Q  +  +
Sbjct: 181 VLGIVLTMGKINEPPEVLGHSIGAALVGTFLGILLSYGFVGPMASNLEYQAKAQQHMLHV 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
            K+ L A+ +G  P +++E GR+ +P   RP++E +   + 
Sbjct: 241 AKEVLAAFNSGFSPMLSVEMGRRAIPDDVRPTMEDMEGALR 281


>gi|12214187|emb|CAA11955.2| motA protein [Sinorhizobium meliloti]
          Length = 292

 Score =  226 bits (577), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 165/289 (57%), Positives = 223/289 (77%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M+ IIGL +T  CI+GG+ AMGG+  +L QPFE++I+ GAG+GGF+MAN +KV+KD+G +
Sbjct: 1   MNIIIGLLVTFGCILGGYMAMGGHLEVLNQPFELMIIGGAGIGGFIMANSMKVVKDTGKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L E F +K   +  Y D L +LY LM +L+  SRNE E+HID+P  S+IF S PTVL+N 
Sbjct: 61  LGEAFRHKVPKEREYLDTLGVLYSLMRDLRTKSRNEIESHIDNPEESSIFQSAPTVLQNK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           ELT FICDY+R+II+GNARSYEIE LMDEEI  I ++K+K YHA++ MG++LPAIGIV A
Sbjct: 121 ELTAFICDYVRLIIIGNARSYEIEALMDEEIQTITHDKMKCYHAMTTMGDALPAIGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+IKAMG +S++P++LG  I  +L GTLLG+ LSYS+  PL + IKS R KQ+RLY+I
Sbjct: 181 VLGVIKAMGAISEAPEVLGAKIAAALVGTLLGVFLSYSIVGPLVANIKSVREKQNRLYVI 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKA 289
           VK+ L+AYMNG++PQVA+EYGRK +   ERPSI+ V QE++      ++
Sbjct: 241 VKQTLLAYMNGSVPQVALEYGRKTISAYERPSIDAVEQEMMNPGGGSES 289


>gi|66043828|ref|YP_233669.1| flagellar motor protein MotA [Pseudomonas syringae pv. syringae
           B728a]
 gi|63254535|gb|AAY35631.1| chemotaxis motA protein [Pseudomonas syringae pv. syringae B728a]
 gi|330971542|gb|EGH71608.1| flagellar motor protein MotA [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 283

 Score =  226 bits (577), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 92/282 (32%), Positives = 151/282 (53%), Gaps = 2/282 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M+ IIG+ + +  +IGG+    G    L QP+E++I+ GA LG F+ ANP  +       
Sbjct: 1   MAKIIGIIVVLASVIGGYVLSHGKVMALFQPYEVLIIGGAALGAFLQANPGYMFMHVFKK 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            L++F         Y +VL L+Y ++   ++      E  I+D  +S IF   P VL++ 
Sbjct: 61  SLKMF-GTRFTHAYYLEVLGLVYEILNKSRREGMMAIEGDIEDAASSPIFAKYPGVLKDE 119

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +T +ICDY+R++  GN   +E+E L D E+  +  +   P HAI+ + + +P  GIV A
Sbjct: 120 RMTAYICDYLRIMSSGNMAPHELEGLFDMELLSMKEDLEHPSHAITGIADGMPGFGIVAA 179

Query: 181 ILGIIKAMGNLS-QSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYI 239
           +LGI+  M +L       +G  +G +L GT  GI+ +Y    PL + +     ++  +Y 
Sbjct: 180 VLGIVVTMASLGSGDKAAIGMHVGAALVGTFFGILAAYGFFGPLATSLAHDAKEEMNVYE 239

Query: 240 IVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
            +K +L+A  +G  P +A+E+GRKVL    RPS   + Q V 
Sbjct: 240 SIKASLVASASGMPPSLAVEFGRKVLYPLHRPSFSELEQAVR 281


>gi|66770022|ref|YP_244784.1| flagellar motor protein MotA [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|66575354|gb|AAY50764.1| chemotaxis protein [Xanthomonas campestris pv. campestris str.
           8004]
          Length = 284

 Score =  226 bits (577), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 92/270 (34%), Positives = 157/270 (58%)

Query: 15  IGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDT 74
           +GG+    G    L QP+E++I+ GA LG F+++ P K++K++   ++ +F       D 
Sbjct: 15  LGGYVLSHGKLGALWQPYELMIIGGAALGAFLVSTPGKIVKETLTGVMGVFKGPQYKSDD 74

Query: 75  YCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMII 134
           Y D L L+Y L+   ++      E+H++ P +STIF + P VL ++ L  FI D +R++I
Sbjct: 75  YKDTLSLIYELLNKARRDGFMALEDHVEKPQDSTIFGTYPKVLADHHLLDFITDCLRLMI 134

Query: 135 VGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQS 194
             N   +E+E L++ E++   +E L P HA+S + + LP  GIV A+LGI+  MG++   
Sbjct: 135 GSNIEPHELEPLLELELEKHHHEALAPAHALSKVSDGLPGFGIVAAVLGIVITMGSIGGP 194

Query: 195 PKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIP 254
            + +G  +G +L GT LGI+L+Y   +PL + +++   +  R+Y  VK AL+A + G  P
Sbjct: 195 IEEIGHHVGAALVGTFLGILLAYGFVSPLPAAMEARAEQDGRIYEAVKTALLACLRGYNP 254

Query: 255 QVAIEYGRKVLPLSERPSIEIVAQEVLQYN 284
           ++A+E+ RK LP + RPS       +    
Sbjct: 255 KIALEFARKTLPSNVRPSFGDFETHLKTIK 284


>gi|89069808|ref|ZP_01157143.1| flagellar motor protein [Oceanicola granulosus HTCC2516]
 gi|89044609|gb|EAR50725.1| flagellar motor protein [Oceanicola granulosus HTCC2516]
          Length = 289

 Score =  226 bits (577), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 86/275 (31%), Positives = 148/275 (53%), Gaps = 3/275 (1%)

Query: 15  IGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQ 72
            GG+   GG   I+++  PFE++++ GA +G FV++N +  IK +   + ++F       
Sbjct: 15  FGGYLLAGGKMGIILKSLPFEMIMIGGAAIGAFVISNDVPAIKHTLKDVGKVFKGPKWKA 74

Query: 73  DTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRM 132
           + Y D+L LL+ L+   +     E E HI+ P +S IF   P +  + E    ICD +R 
Sbjct: 75  EDYRDLLCLLFELIRVARNNPV-EIEEHIETPESSAIFGRYPKISADGEALALICDTLRS 133

Query: 133 IIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLS 192
             +     +++E ++++ ID  L+ KL   HA+  + + LPA+GIV A+LG+IK M ++ 
Sbjct: 134 ASMNYDDPHQVEEVLEKRIDASLHHKLHSTHALQTIADGLPALGIVAAVLGVIKTMASID 193

Query: 193 QSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGA 252
           Q P++LG  IG +L GT LG+ L+Y L  P  +++KS        Y ++++ L+A +   
Sbjct: 194 QPPEVLGKLIGGALVGTFLGVFLAYGLVGPFAAKVKSVIEDDMHFYRLIREVLVANLYQH 253

Query: 253 IPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
              + IE GR+  P   RPS   V + +     + 
Sbjct: 254 ATNICIEVGRQNTPGQYRPSFSEVEEALKAVKQSA 288


>gi|302189800|ref|ZP_07266473.1| flagellar motor protein MotA [Pseudomonas syringae pv. syringae
           642]
 gi|330873803|gb|EGH07952.1| flagellar motor protein MotA [Pseudomonas syringae pv. morsprunorum
           str. M302280PT]
          Length = 283

 Score =  226 bits (576), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 93/282 (32%), Positives = 151/282 (53%), Gaps = 2/282 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M+ IIG+ + I  ++GG+    G    L QP+E++I+ GA LG F+ ANP  +       
Sbjct: 1   MAKIIGIIVVIASVLGGYVLSHGKIMALFQPYEVLIIGGAALGAFLQANPGYMFMHVFKK 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            L++F         Y +VL L+Y ++   ++      E  I+D  +S IF   P VL++ 
Sbjct: 61  SLKMF-GTRFTHAYYLEVLGLVYEILNKSRREGMMAIEGDIEDAASSPIFAKYPGVLKDE 119

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +T +ICDY+R++  GN   +E+E L D E+  +  E   P HAI+ + + +P  GIV A
Sbjct: 120 RMTAYICDYLRIMSSGNMAPHELEGLFDMELLSMKEELEHPSHAITGIADGMPGFGIVAA 179

Query: 181 ILGIIKAMGNLS-QSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYI 239
           +LGI+  M +L       +G  +G +L GT  GI+ +Y    PL + +     ++  +Y 
Sbjct: 180 VLGIVVTMASLGSGDKAAIGMHVGAALVGTFFGILAAYGFFGPLATSLAHDAKEEMNVYE 239

Query: 240 IVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
            +K +L+A  +G  P +A+E+GRKVL    RPS   + Q V 
Sbjct: 240 SIKASLVASASGMPPSLAVEFGRKVLYPLHRPSFSELEQAVR 281


>gi|146284109|ref|YP_001174262.1| flagellar motor protein MotA [Pseudomonas stutzeri A1501]
 gi|145572314|gb|ABP81420.1| chemotaxis protein MotA [Pseudomonas stutzeri A1501]
 gi|327482426|gb|AEA85736.1| flagellar motor protein MotA [Pseudomonas stutzeri DSM 4166]
          Length = 283

 Score =  226 bits (576), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 98/282 (34%), Positives = 156/282 (55%), Gaps = 2/282 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  IIG+ +    ++GGF   GG    LI PFE++I+ GA LGGF+ ANP          
Sbjct: 1   MVKIIGIIVVFASVLGGFVLSGGKIGALIHPFEVMIIGGAALGGFLQANPGSTTMIVFKK 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            L++F  +      Y +VL LLY ++   ++      E  ++DP  S +F+  P  L++ 
Sbjct: 61  SLKMFSTR-FTHAYYLEVLSLLYAILNKSRREGMMAIEADLEDPAASPLFSKYPGFLQDE 119

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +T F CDY+R++  GN   +E+E L D E+  +  E   P HA+S + + LPA+GIV A
Sbjct: 120 RMTAFTCDYLRIMSSGNMAPHELEGLFDMELTSLKEELDHPAHAVSKVADGLPAMGIVAA 179

Query: 181 ILGIIKAMGNLSQ-SPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYI 239
           +LGI+  M  L++    ++G  +G +L GT LGI+ SY    PL + ++    ++  +Y 
Sbjct: 180 VLGIVITMSILAEADNAMIGYKVGSALVGTFLGILASYGFFGPLAAALEHDAKEELNVYE 239

Query: 240 IVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
            +K  L+A  +G  P +A+E+GRKVL  + RPS   + Q + 
Sbjct: 240 SIKATLVASASGMPPSLAVEFGRKVLYPAHRPSFSELEQAMR 281


>gi|308273453|emb|CBX30055.1| Chemotaxis protein motA [uncultured Desulfobacterium sp.]
          Length = 265

 Score =  226 bits (576), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 81/262 (30%), Positives = 150/262 (57%)

Query: 20  AMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDTYCDVL 79
             GG   ++IQP E +I+ GA +G  +++ P K++KD    ++       + + +Y D+L
Sbjct: 1   MEGGPLAVIIQPVEFMIIGGAAIGALLISAPPKLLKDIIGKIIGTVKGSTISKQSYLDLL 60

Query: 80  KLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMIIVGNAR 139
           KL++ +    +K      E+HI++P  S +FT  P  L N+ +  FICD  R++++G   
Sbjct: 61  KLMFDVFQLSRKDGLIALESHIENPETSNLFTQYPQFLNNHHILHFICDTFRLVVLGGVA 120

Query: 140 SYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQSPKILG 199
           ++++E LMD +I+   +E  KP   +  +G+S+P +GIV A+LGI+  M  +   P+++G
Sbjct: 121 AHDMEALMDCDIETHHHEGTKPGMILQKIGDSMPGLGIVAAVLGIVITMQAIDGPPEVIG 180

Query: 200 TAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIPQVAIE 259
             + V+L GT LGI LSY    P+ + I     ++ +++ ++K  +IA+  G  P +A+E
Sbjct: 181 HKVAVALVGTFLGIYLSYGFVQPIATNIDMANDEESKIFEVIKSGMIAFAKGLNPIIAVE 240

Query: 260 YGRKVLPLSERPSIEIVAQEVL 281
           + R+ +P   RP  + + + V 
Sbjct: 241 FARRSIPSDYRPEFQEMEKHVK 262


>gi|212637802|ref|YP_002314327.1| MotA/TolQ/ExbB proton channel [Shewanella piezotolerans WP3]
 gi|212559286|gb|ACJ31740.1| MotA/TolQ/ExbB proton channel [Shewanella piezotolerans WP3]
          Length = 285

 Score =  226 bits (576), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 81/282 (28%), Positives = 154/282 (54%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           MS ++GL I I  + GG+   GG    L QP EI+I+ GAG+G  ++ANP  V+ +    
Sbjct: 1   MSKLLGLVIIIFSVFGGYVWAGGTLASLWQPAEILIIFGAGVGALIIANPKPVLVEMYDQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L E+   +    + Y  +  L+ +LM  ++       ++H++ P  S++F   PTVLE+ 
Sbjct: 61  LRELVTIEKEDPELYPQLFGLMGMLMTQIQSQGLKVLDDHVEKPRESSLFLMYPTVLEHP 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  F+ D +R+  +G   ++++E+++DEEI  +  + ++P  A++ + E++P  GI+ A
Sbjct: 121 TVLQFLIDNLRLQSIGKLSAHDLEHILDEEIHRMEEDWMRPSLALNKVAEAMPGFGILAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++GII  M N+     ++G  +  +L GT +GI   Y L +PL+  ++    ++      
Sbjct: 181 VMGIIITMSNIDGPITMIGVKVAAALVGTFIGIFACYCLFDPLSKALEHLVERKAAQLRC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQ 282
           V   L ++  G  P +AI+ GRK +    RP+   + + +++
Sbjct: 241 VAAMLTSFAKGKPPMLAIDAGRKQIQSENRPTFVELERWMVE 282


>gi|330447922|ref|ZP_08311570.1| motA/TolQ/ExbB proton channel family protein [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
 gi|328492113|dbj|GAA06067.1| motA/TolQ/ExbB proton channel family protein [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
          Length = 285

 Score =  226 bits (575), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 80/285 (28%), Positives = 149/285 (52%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   IG  I I+C+ GG+   GGN   + QP E++I+AGA +G  ++ NP  V+K+  + 
Sbjct: 1   MQKFIGAIIIIICVFGGYIWAGGNLRAIWQPAELLIIAGATIGSLIIGNPPHVLKEMRLQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
             EI       +  Y +++ LL  L+  ++       ++HI+ P +S IF   P +  ++
Sbjct: 61  FREILSPNHHEEQYYMELMALLQALLDTVRNNGFKALDSHIESPQSSAIFNRYPLISNDH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            + +FI D +R++ +G    YE+E L+++EI  I  + L P  ++    E+LP  GI+ A
Sbjct: 121 HVISFITDNLRLMAMGQMSPYELEGLLEQEISAIEEDLLLPSRSMQRTAEALPGFGILAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++GII  M  +  S  ++G  +  +L GT LGI   Y + +P ++ +     +    +  
Sbjct: 181 VMGIIITMQAIDGSIAMIGYHVAAALVGTFLGIFGCYCILDPASNAMAQRVKRNMSAFEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           ++  L+AY+      +AI+ GRK + L  +P+   + + + +   
Sbjct: 241 IRATLVAYVAKKPTLLAIDAGRKHIQLDIKPTFNEMEKWLTEQEG 285


>gi|28872067|ref|NP_794686.1| chemotaxis motA protein [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213967913|ref|ZP_03396059.1| chemotaxis motA protein [Pseudomonas syringae pv. tomato T1]
 gi|301384433|ref|ZP_07232851.1| flagellar motor protein MotA [Pseudomonas syringae pv. tomato
           Max13]
 gi|302062275|ref|ZP_07253816.1| flagellar motor protein MotA [Pseudomonas syringae pv. tomato K40]
 gi|302132279|ref|ZP_07258269.1| flagellar motor protein MotA [Pseudomonas syringae pv. tomato NCPPB
           1108]
 gi|28855320|gb|AAO58381.1| chemotaxis motA protein [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213927256|gb|EEB60805.1| chemotaxis motA protein [Pseudomonas syringae pv. tomato T1]
 gi|331014599|gb|EGH94655.1| flagellar motor protein MotA [Pseudomonas syringae pv. lachrymans
           str. M302278PT]
          Length = 283

 Score =  226 bits (575), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 92/282 (32%), Positives = 151/282 (53%), Gaps = 2/282 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M+ IIG+ + I  ++GG+    G    L QP+E++I+ GA LG F+ ANP  +       
Sbjct: 1   MAKIIGIIVVIASVLGGYVLSHGKIMALFQPYEVLIIGGAALGAFLQANPGYMFMHVFKK 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            L++F         Y +VL L+Y ++   ++      E  I+D  +S IF   P VL++ 
Sbjct: 61  SLKMF-GTRFTHAYYLEVLGLVYEILNKSRREGMMAIEGDIEDAASSPIFAKYPGVLKDE 119

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +T +ICDY+R++  GN   +E+E L D E+  +  +   P HAI+ + + +P  GIV A
Sbjct: 120 RMTAYICDYLRIMSSGNMAPHELEGLFDMELLSMKEDLEHPSHAITGIADGMPGFGIVAA 179

Query: 181 ILGIIKAMGNLS-QSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYI 239
           +LGI+  M +L       +G  +G +L GT  GI+ +Y    PL + +     ++  +Y 
Sbjct: 180 VLGIVVTMASLGSGDKAAIGMHVGAALVGTFFGILAAYGFFGPLATSLAHDAKEEMNVYE 239

Query: 240 IVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
            +K +L+A  +G  P +A+E+GRKVL    RPS   + Q V 
Sbjct: 240 SIKASLVASASGMPPSLAVEFGRKVLYPLHRPSFSELEQAVR 281


>gi|312958641|ref|ZP_07773161.1| chemotaxis MotA protein [Pseudomonas fluorescens WH6]
 gi|311287184|gb|EFQ65745.1| chemotaxis MotA protein [Pseudomonas fluorescens WH6]
          Length = 283

 Score =  226 bits (575), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 94/282 (33%), Positives = 150/282 (53%), Gaps = 2/282 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M+ IIG+ +    ++GG+    G    LIQPFE++I+ GA LG F+ ANP  +       
Sbjct: 1   MAKIIGIIVVFASVLGGYVLSHGKIAALIQPFEVMIIGGAALGAFLQANPGYMTMHVIKK 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            L +F         Y +VL L+Y ++   ++      E  I+D   S IF   P VL++ 
Sbjct: 61  SLSMF-GSRFTHTFYLEVLGLVYEILNKSRREGMMAIEADIEDAAASPIFAKYPAVLKDE 119

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +T +ICDY+R++  GN   +E+E L D E+  +  E   P HA++ + + +P  GIV A
Sbjct: 120 RMTAYICDYLRIMSSGNMAPHELEGLFDMELFSLKEELEHPSHAVTGVADGMPGFGIVAA 179

Query: 181 ILGIIKAMGNLSQ-SPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYI 239
           +LGI+  M +L +     +G  +G +L GT  GI+ +Y    PL + +     ++  LY 
Sbjct: 180 VLGIVVTMASLGEGDQAAIGMHVGAALVGTFFGILAAYGFFGPLATSLAHDAKEEINLYE 239

Query: 240 IVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
            +K +L+A  +G  P +A+E+GRKVL    RPS   + Q V 
Sbjct: 240 SIKASLVASASGMPPSLAVEFGRKVLYPKHRPSFAELEQAVR 281


>gi|294624637|ref|ZP_06703309.1| flagellar motor protein [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
 gi|292601072|gb|EFF45137.1| flagellar motor protein [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
          Length = 284

 Score =  226 bits (575), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 91/270 (33%), Positives = 159/270 (58%)

Query: 15  IGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDT 74
           +GG+    G    L QP+E++I+ GA LG F+++ P K++K++   ++ +F       D 
Sbjct: 15  LGGYVLSHGKLGALWQPYELMIIGGAALGAFLVSTPGKIVKETLSGIMGVFKGPQYKSDD 74

Query: 75  YCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMII 134
           Y D L L+Y L+   ++      E+H++ P +STIF + P V+ ++ L  FI D +R++I
Sbjct: 75  YKDTLSLIYELLNKARRDGFMALEDHVEKPQDSTIFGNYPKVVADHHLLDFITDCLRLMI 134

Query: 135 VGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQS 194
             N   +E+E L++ E++   +E L P HA+S + + LP  GIV A+LGI+  MG++   
Sbjct: 135 GSNIEPHELEPLLELELEKHHHEALAPSHALSKVSDGLPGFGIVAAVLGIVITMGSIGGP 194

Query: 195 PKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIP 254
            + +G  +G +L GT LGI+L+Y   +PL++ +++   +  R+Y  VK AL+A + G  P
Sbjct: 195 IEEIGHHVGAALVGTFLGILLAYGFVSPLSAAMEARAEQDGRIYEAVKTALLACLRGYNP 254

Query: 255 QVAIEYGRKVLPLSERPSIEIVAQEVLQYN 284
           ++A+E+ RK LP + RPS+      +    
Sbjct: 255 KIALEFARKTLPSNVRPSLGDFETHLKTIK 284


>gi|46581012|ref|YP_011820.1| flagellar motor protein MotA [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120601692|ref|YP_966092.1| flagellar motor protein MotA [Desulfovibrio vulgaris DP4]
 gi|46450433|gb|AAS97080.1| chemotaxis protein MotA [Desulfovibrio vulgaris str. Hildenborough]
 gi|120561921|gb|ABM27665.1| chemotaxis protein MotA [Desulfovibrio vulgaris DP4]
 gi|311234696|gb|ADP87550.1| flagellar motor protein MotA [Desulfovibrio vulgaris RCH1]
          Length = 281

 Score =  226 bits (575), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 86/281 (30%), Positives = 159/281 (56%), Gaps = 1/281 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  IIGL +    IIGG+    GN  +L+QP E++I+ GA +G F+ +     +     +
Sbjct: 1   MFIIIGLVVVFGSIIGGYLIANGNLAVLVQPAEMIIILGAAMGAFLASQTKYTLGLVIKN 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  IFG   + +  Y + L LL  L   + +      E  I+ P +S IFT  P++ ++ 
Sbjct: 61  IKHIFGDPGMNKARYLETLALLNSLFSKMHREGVISIEQDIEKPESSAIFTKYPSISKDK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FI D +R+ +       +IE+LM  +++ +  E++    A++ M ESLP +GIV A
Sbjct: 121 HIVHFIGDTLRVYLT-TGDPSDIESLMKIDMESMHEEEMVAPGAVNRMAESLPGMGIVAA 179

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG++  MG +++ P+ILG  IG +L GT +GI+  Y +  P+ +++++   + H  Y +
Sbjct: 180 VLGVVLTMGMINEPPEILGHHIGAALVGTFVGILFCYGIFGPMAAKLENHAHEMHAYYNV 239

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
           +K+ + A + G+ P +A+EYGR+ +P + RP+   + +++ 
Sbjct: 240 IKEGVAAAIRGSTPIIAVEYGRRAIPHAFRPTFAEMEEKLK 280


>gi|283784103|ref|YP_003363968.1| lateral flagellar motor protein A [Citrobacter rodentium ICC168]
 gi|282947557|emb|CBG87110.1| lateral flagellar motor protein A [Citrobacter rodentium ICC168]
          Length = 287

 Score =  225 bits (574), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 90/287 (31%), Positives = 152/287 (52%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++GL + + C+ GG++  GG    + QP EIVI+ GAG G  ++ NP  V+K+    
Sbjct: 1   MQKVLGLLVVLGCVFGGYFEAGGQLIAIWQPAEIVIILGAGFGAMIIGNPKHVLKEIAHQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  + G K LG +    +L  LY L+  ++ G     + HI+ P  ST+F   P VL   
Sbjct: 61  IKGVIGKKQLGPEFQRQLLMCLYELLEMVQNGGLRMLDQHIEQPEESTVFQKYPQVLTQK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L TFI D  R++ +G   ++E+E ++D+E+D +  E L P  ++    E++P  GI  A
Sbjct: 121 RLVTFIADNFRLMAMGKIDAHELEGILDQELDTVEEELLAPSRSLQRTAEAMPGFGICAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGII  M ++  S  ++G  +  +L GT LG+   Y L +PL + ++     +H L   
Sbjct: 181 VLGIIITMQSIDGSIALIGLKVAAALVGTFLGVFFCYCLMDPLANSMEQQARAEHSLLEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
           V+  L+A   G    +A++ GRK+L L+ +P+   +   V      +
Sbjct: 241 VRTVLVAQAGGKPTLLAVDAGRKLLHLASKPTFANLDAWVNAMLEQE 287


>gi|229588063|ref|YP_002870182.1| flagellar motor protein MotA [Pseudomonas fluorescens SBW25]
 gi|229359929|emb|CAY46783.1| chemotaxis MotA protein [Pseudomonas fluorescens SBW25]
          Length = 283

 Score =  225 bits (574), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 94/282 (33%), Positives = 150/282 (53%), Gaps = 2/282 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M+ IIG+ + I  ++GG+    G    LIQPFE++I+ GA  G F+ ANP  +       
Sbjct: 1   MAKIIGIIVVIASVLGGYVLSHGKIAALIQPFEVLIIGGAAFGAFLQANPGYMTMHVVKK 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            L +F         Y +VL L+Y ++   ++      E  I+D   S IF   P VL++ 
Sbjct: 61  SLGMF-GSRFTHTFYLEVLGLVYEILNKSRREGMMAIEGDIEDAAASPIFAKYPAVLKDE 119

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +T +ICDY+R++  GN   +E+E L D E+  +  E   P HA++ + + +P  GIV A
Sbjct: 120 RMTAYICDYLRIMSSGNMAPHELEGLFDMELFSLKEELEHPSHAVTGIADGMPGFGIVAA 179

Query: 181 ILGIIKAMGNLSQ-SPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYI 239
           +LGI+  M +L +     +G  +G +L GT  GI+ +Y    PL + +     ++  LY 
Sbjct: 180 VLGIVVTMASLGEGDQAAIGMHVGAALVGTFFGILAAYGFFGPLATSLAHDAKEEINLYE 239

Query: 240 IVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
            +K +L+A  +G  P +A+E+GRKVL    RPS   + Q V 
Sbjct: 240 SIKASLVASASGMPPSLAVEFGRKVLYPKHRPSFAELEQAVR 281


>gi|71736229|ref|YP_272856.1| flagellar motor protein MotA [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|257482422|ref|ZP_05636463.1| flagellar motor protein MotA [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|289623745|ref|ZP_06456699.1| flagellar motor protein MotA [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289648638|ref|ZP_06479981.1| flagellar motor protein MotA [Pseudomonas syringae pv. aesculi str.
           2250]
 gi|298484925|ref|ZP_07003024.1| Flagellar motor rotation protein motA [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|71556782|gb|AAZ35993.1| motility protein, MotA family [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|298160612|gb|EFI01634.1| Flagellar motor rotation protein motA [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|320321895|gb|EFW77991.1| flagellar motor protein MotA [Pseudomonas syringae pv. glycinea
           str. B076]
 gi|320331000|gb|EFW86974.1| flagellar motor protein MotA [Pseudomonas syringae pv. glycinea
           str. race 4]
 gi|330865883|gb|EGH00592.1| flagellar motor protein MotA [Pseudomonas syringae pv. aesculi str.
           0893_23]
 gi|330886587|gb|EGH20248.1| flagellar motor protein MotA [Pseudomonas syringae pv. mori str.
           301020]
 gi|330965970|gb|EGH66230.1| flagellar motor protein MotA [Pseudomonas syringae pv. actinidiae
           str. M302091]
 gi|330984571|gb|EGH82674.1| flagellar motor protein MotA [Pseudomonas syringae pv. lachrymans
           str. M301315]
 gi|331009753|gb|EGH89809.1| flagellar motor protein MotA [Pseudomonas syringae pv. tabaci ATCC
           11528]
          Length = 283

 Score =  225 bits (574), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 93/282 (32%), Positives = 151/282 (53%), Gaps = 2/282 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M+ IIG+ + I  ++GG+    G    L QP+E++I+ GA LG F+ ANP  +       
Sbjct: 1   MAKIIGIIVVIASVLGGYVLSHGKIMALFQPYEVLIIGGAALGAFLQANPGYMTMHVFKK 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            L++F         Y +VL L+Y ++   ++      E  I+D  +S IF   P VL++ 
Sbjct: 61  SLKMF-GSRFTHAYYLEVLGLVYEILNKSRREGMMAIEGDIEDAASSPIFAKYPGVLKDE 119

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +T +ICDY+R++  GN   +E+E L D E+  +  E   P HAI+ + + +P  GIV A
Sbjct: 120 RMTAYICDYLRIMSSGNMAPHELEGLFDMELLSMKEELEHPSHAITGIADGMPGFGIVAA 179

Query: 181 ILGIIKAMGNLS-QSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYI 239
           +LGI+  M +L       +G  +G +L GT  GI+ +Y    PL + +     ++  +Y 
Sbjct: 180 VLGIVVTMASLGSGDKAAIGMHVGAALVGTFFGILAAYGFFGPLATCLAHDAKEEMNVYE 239

Query: 240 IVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
            +K +L+A  +G  P +A+E+GRKVL    RPS   + Q V 
Sbjct: 240 SIKASLVASASGMPPSLAVEFGRKVLYPLHRPSFSELEQAVR 281


>gi|304392512|ref|ZP_07374452.1| chemotaxis protein MotA [Ahrensia sp. R2A130]
 gi|303295142|gb|EFL89502.1| chemotaxis protein MotA [Ahrensia sp. R2A130]
          Length = 289

 Score =  225 bits (574), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 127/277 (45%), Positives = 190/277 (68%)

Query: 13  CIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQ 72
           C++GG+ AMGG   +L QP+E VI+ GA +G F++ANP+ V+KD+G  L+E    K  G 
Sbjct: 13  CVLGGYMAMGGKLMVLAQPWEFVIIGGAAIGTFLIANPMPVVKDTGKGLVEALKAKVPGP 72

Query: 73  DTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRM 132
           D Y  +L LL+ L+  ++    +E E HID P +S IF + P VL N +LT FICDY R+
Sbjct: 73  DDYLQILGLLHALLREMRTKPSSEVEGHIDAPEDSEIFKNYPVVLGNKDLTFFICDYCRL 132

Query: 133 IIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLS 192
           I+VGNARS+E+E LM+EEI  I +E+++  HA++ +G+ LPA+GIV A+LG++KAMG + 
Sbjct: 133 ILVGNARSHEVEALMEEEIHTIRHERMESVHALTVIGDGLPALGIVAAVLGVVKAMGAID 192

Query: 193 QSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGA 252
            SP+ILG  IG +L GT +GI LSY++  P+  ++K+ R    R+Y + K+ LIA MNGA
Sbjct: 193 SSPEILGGLIGAALVGTFVGIFLSYAVVAPIAGKLKAVREAHLRVYFVAKQTLIASMNGA 252

Query: 253 IPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKA 289
           +PQ+A+E+GRK +   +RPSI+ + +++        A
Sbjct: 253 VPQIALEFGRKAISGHDRPSIDQMEEQLAGGPVAAAA 289


>gi|220905441|ref|YP_002480753.1| flagellar motor protein MotA [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
 gi|219869740|gb|ACL50075.1| flagellar motor protein MotA [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
          Length = 282

 Score =  225 bits (573), Expect = 7e-57,   Method: Composition-based stats.
 Identities = 93/283 (32%), Positives = 152/283 (53%), Gaps = 1/283 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  +IGL I    +  G+    G   IL QP E +I+ G GLG F  +           S
Sbjct: 1   MYLLIGLAIVAGSVFTGYTLAHGEWGILFQPAEFIIILGCGLGAFFGSQTKYTFGLILKS 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y + L LLY L   + +      E+ ++ P +S IF+  P V ++ 
Sbjct: 61  LKHLFADPGSSKGRYLETLALLYALFSKMHREGVISIESDVEKPESSPIFSKYPNVSKDT 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           ++  FI D +R+ +       +I++LMD +I  +  E + P HA+SHM ESLP +GIV  
Sbjct: 121 KVVNFIGDTLRVYLT-TGDPADIDSLMDVDITTMREEGILPAHAVSHMAESLPGMGIVAC 179

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG++ AMG +++ P++LG  IG +L GT  GI+  Y L  P+ S++++   ++H  Y  
Sbjct: 180 VLGVVLAMGKINEPPEVLGHYIGAALVGTFFGILCCYGLFGPMGSKLENYVAEEHFYYHS 239

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQY 283
           VK+A+ A + G+ P +A+EYGR+ +P   RPS   +  ++   
Sbjct: 240 VKEAVAAAIRGSTPLIAVEYGRRAIPYPFRPSFAEMEDKLKSG 282


>gi|149189847|ref|ZP_01868127.1| flagellar motor protein MotA [Vibrio shilonii AK1]
 gi|148836333|gb|EDL53290.1| flagellar motor protein MotA [Vibrio shilonii AK1]
          Length = 285

 Score =  225 bits (573), Expect = 7e-57,   Method: Composition-based stats.
 Identities = 79/285 (27%), Positives = 146/285 (51%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   +G  I ++C+ GG+   GG+   + QP E +I+ GA +G  ++ NP +V+K+    
Sbjct: 1   MQKFMGAIIILMCVFGGYVWAGGSMMAIWQPAEFLIIIGATVGSLIIGNPPQVLKEMRSQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  I       Q  Y +++ LL +L+  ++ G     + HI++P  S IF   P V  + 
Sbjct: 61  LRSIMSPHKDEQAFYMELMALLQVLLETVRSGGFKALDKHIENPEQSPIFNRYPLVSRDY 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L +FI D +R++ +G    +E+E L+++EI+ I  + L P  ++    E+LP  GI+ A
Sbjct: 121 RLVSFITDNLRLMAMGQMSPHELEGLLEQEIEAIESDLLLPSRSMQRTAEALPGFGILAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           + GII  M  +  S  ++G  +  +L GT LGI   Y   +P ++ +     +    +  
Sbjct: 181 VGGIIITMQAIDGSIALIGYHVAAALVGTFLGIFGCYCCLDPASNAMAQRVKRDMSAFDC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           ++  L+AY+      +AI+ GRK + L  +P+   + + + +   
Sbjct: 241 IRATLVAYVAKKPTLLAIDAGRKHIQLDIKPTFNQMERWLAEQEG 285


>gi|91223191|ref|ZP_01258457.1| flagellar motor protein [Vibrio alginolyticus 12G01]
 gi|269967119|ref|ZP_06181186.1| chemotaxis LafT protein [Vibrio alginolyticus 40B]
 gi|91192004|gb|EAS78267.1| flagellar motor protein [Vibrio alginolyticus 12G01]
 gi|269828256|gb|EEZ82523.1| chemotaxis LafT protein [Vibrio alginolyticus 40B]
          Length = 285

 Score =  225 bits (573), Expect = 7e-57,   Method: Composition-based stats.
 Identities = 76/285 (26%), Positives = 145/285 (50%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M    G+   ++C+ GG+   GG+   + QP E +I+ GA  G  ++ NP  V+K+    
Sbjct: 1   MQKFFGVLTILVCVFGGYMWAGGSLGAIWQPAEFLIIIGAAAGSLIIGNPPHVLKEMRRQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +           + Y +++ LL  L+   +       ++HI+ P  S++F + PT+ E++
Sbjct: 61  VPATIKGPTEEHEYYMELMALLNNLLETARNRGYKFLDSHIEAPEQSSMFLAYPTIAEDH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L +FI D +R++ +G    +E+E L+++EI+ I  E L P  ++    E+LP  GI+ A
Sbjct: 121 RLISFITDNLRLMAMGQMSPHELEGLLEQEIEAIQNEMLLPSRSLQRTAEALPGFGILAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           + GII  M  +  S  ++G  +  +L GT +GI   Y   +PL++ +     +    +  
Sbjct: 181 VGGIIITMQAIDGSIAMIGYHVAAALVGTFIGIFGCYCGLDPLSNAMAQRVKRNMTAFEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           V+  L+AY+      +AI+ GRK + L  +P+   + + + +   
Sbjct: 241 VRATLVAYVAKKPTLLAIDAGRKHIQLDIKPTFNQMEKWLAEQEG 285


>gi|269960143|ref|ZP_06174519.1| chemotaxis LafT protein [Vibrio harveyi 1DA3]
 gi|269835114|gb|EEZ89197.1| chemotaxis LafT protein [Vibrio harveyi 1DA3]
          Length = 285

 Score =  224 bits (572), Expect = 8e-57,   Method: Composition-based stats.
 Identities = 77/285 (27%), Positives = 143/285 (50%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M    G    ++C+ GG+   GGN   + QP E +I+ GA  G  ++ NP +V+K+    
Sbjct: 1   MQKFFGAITVLMCVFGGYMWAGGNLGAIWQPAEFLIIIGAAAGSLIIGNPPQVLKEMRQQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +           + Y +++ LL  L+   +       ++HI+ P  S+IF + P V  ++
Sbjct: 61  VRATISGPREEYEYYMELMALLNNLLETARSRGFKFLDSHIESPEQSSIFLAYPQVSNDH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L +FI D +R++ +G    +E+E L+++EI+ I  E L P  ++    E+LP  GI+ A
Sbjct: 121 RLISFITDNLRLMAMGQMSPHELEGLLEQEIEAIQTEMLLPSRSMQRTAEALPGFGILAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           + GII  M  +  S  ++G  +  +L GT +GI   Y   +PL++ +     +    +  
Sbjct: 181 VGGIIITMQAIDGSIALIGYHVAAALVGTFIGIFGCYCCLDPLSNAMAQRVRRNMTAFEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           V+  L+AY+      +AI+ GRK + L  +P+   + + + +   
Sbjct: 241 VRATLVAYVAKKPTLLAIDAGRKHIQLDIKPTFNQMEKWLAEQEG 285


>gi|89902462|ref|YP_524933.1| MotA/TolQ/ExbB proton channel [Rhodoferax ferrireducens T118]
 gi|89347199|gb|ABD71402.1| MotA/TolQ/ExbB proton channel [Rhodoferax ferrireducens T118]
          Length = 270

 Score =  224 bits (572), Expect = 8e-57,   Method: Composition-based stats.
 Identities = 90/266 (33%), Positives = 147/266 (55%), Gaps = 2/266 (0%)

Query: 18  FYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDTY 75
           +   GGN  ++++  PFE+V + G  LG F + N  KV++ +   + +        +  Y
Sbjct: 2   YILHGGNIGVILKALPFELVTIFGGALGAFAVNNQPKVLRATLKLIPQAVKGSKYTKARY 61

Query: 76  CDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMIIV 135
            +++ LLY ++   +K      E  +++P+ S IF    TV  ++ +  F+ DY+RM++ 
Sbjct: 62  LELMALLYDILQKARKEGLMAIEKDVEEPHGSAIFKKYATVGSDHHVVEFMTDYLRMMVS 121

Query: 136 GNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQSP 195
           GN  ++EIE+LMD EID    E   P  AI+ +  +LPA GIV A+LG++  MG++ Q P
Sbjct: 122 GNLNAHEIESLMDSEIDTHHAEAHAPVAAIARLAGALPAFGIVAAVLGVVNTMGSVGQPP 181

Query: 196 KILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIPQ 255
            +LG  I  +L GT LGI+L+Y++  PL   ++       +    +K  L+A M G  P 
Sbjct: 182 AVLGGMIASALVGTFLGILLAYAVVEPLGGVLEQKIEDSAKELQCIKTTLLASMQGYNPA 241

Query: 256 VAIEYGRKVLPLSERPSIEIVAQEVL 281
            AIE+GRKVL  +ERP+   +   V 
Sbjct: 242 TAIEFGRKVLFSTERPTFLELESYVR 267


>gi|114765231|ref|ZP_01444363.1| flagellar motor protein [Pelagibaca bermudensis HTCC2601]
 gi|114542366|gb|EAU45394.1| flagellar motor protein [Roseovarius sp. HTCC2601]
          Length = 298

 Score =  224 bits (572), Expect = 9e-57,   Method: Composition-based stats.
 Identities = 89/288 (30%), Positives = 148/288 (51%), Gaps = 2/288 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M+ I+GL +    + GGF   GG   I++   PFE +++ GA +G FV+AN + VIK S 
Sbjct: 11  MTMILGLALVFGLVFGGFMLSGGKMDIVLHALPFEGMMIGGAAIGAFVIANSVDVIKKSA 70

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
             ++++          Y D+L L+Y L    K       ++HI+ P +S IF   P +  
Sbjct: 71  GGIVKVLKGPRWKAKDYGDLLNLMYELTRIYKAKGILALDSHIESPSDSDIFNRYPRIAA 130

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           ++     I D  RM+ +     Y  E++++ +I    +E L   HAI  + + LPAIGIV
Sbjct: 131 DHFAIDLIRDSFRMLSMQFDDKYATEDVINRKIKKHHHESLASVHAIQQVADGLPAIGIV 190

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG+IK M ++ Q P+ILG  IG +L GT LG+ L+Y +  P++ ++K    +    Y
Sbjct: 191 AAVLGVIKTMSSIDQPPEILGKMIGGALVGTFLGVFLAYCMVQPISGRLKQIEEEDGAFY 250

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHN 286
           +I++   +A +    P + +E GR  +P   +P    V     +    
Sbjct: 251 MIIRDIFVAMVADHPPSICVEIGRGNIPTRMQPDFYEVEAAQKELPAA 298


>gi|303325923|ref|ZP_07356366.1| chemotaxis protein MotA [Desulfovibrio sp. 3_1_syn3]
 gi|302863839|gb|EFL86770.1| chemotaxis protein MotA [Desulfovibrio sp. 3_1_syn3]
          Length = 282

 Score =  224 bits (572), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 88/283 (31%), Positives = 151/283 (53%), Gaps = 1/283 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  +IGL I    +  G+    G   +L QP E +I+ G GLG F  +           S
Sbjct: 1   MYLLIGLAIVAASVFTGYTLAHGEWGVLFQPAEFIIILGCGLGAFFGSQTKYTFSLIVKS 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F      +  Y + L LLY L   + +      E+ ++ P  S IF+  P V ++ 
Sbjct: 61  LKHLFADPGSSKSRYLETLALLYALFSKMHREGVISIESDVEKPEASPIFSKYPNVSKDT 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FI D +R+ +       +I++LMD +I  +  E + P HA+SHM ES+P +GIV  
Sbjct: 121 RIVNFIGDTLRVYLT-TGDPADIDSLMDVDIATMREEGILPAHAVSHMAESMPGMGIVAC 179

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG++ AMG +++ P++LG  IG +L GT  GI+  Y L  P+ +++++   ++H  Y  
Sbjct: 180 VLGVVLAMGKINEPPEVLGHYIGAALVGTFFGILCCYGLFGPMGAKLENFVSEEHFYYHS 239

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQY 283
           +K+A+ A + G+ P +A+EYGR+ +P   RP+   + +++   
Sbjct: 240 IKEAVAAAIRGSTPLIAVEYGRRTIPYPFRPTFAEMEEKLKNG 282


>gi|326404290|ref|YP_004284372.1| chemotaxis protein MotA [Acidiphilium multivorum AIU301]
 gi|325051152|dbj|BAJ81490.1| chemotaxis protein MotA [Acidiphilium multivorum AIU301]
          Length = 289

 Score =  224 bits (570), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 96/286 (33%), Positives = 162/286 (56%), Gaps = 2/286 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M T+ G+   ++C+ G F   GG    L++  PFE++ + GA +G FV  N +  IK + 
Sbjct: 1   MLTLGGVAFLLVCVFGVFIVTGGAIGPLLKSMPFELITIGGAAVGTFVAGNSMHDIKHTL 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
               ++    A  +  Y D+L LL+ L+           E HI+ P  S +F   P +L+
Sbjct: 61  AGFKKVLRGGAFKKADYTDLLCLLFYLVRLAATRGAMALEPHIERPEESPVFKHFPAILK 120

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           N E T  ICDY+RM+ +     ++IE++M  E+   L E+L   H +  M + LPA+GIV
Sbjct: 121 NEEATAIICDYLRMVGMNADDPHQIEDVMARELRKTLAEELHGAHTLQTMADGLPALGIV 180

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG+IK M ++SQ P +LG  IG +LTGT LG++L+Y +  PL+ +++    +  R +
Sbjct: 181 AAVLGVIKTMAHISQPPAVLGEMIGEALTGTFLGVLLAYGVVGPLSVRLRGVVEEDSRYF 240

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYN 284
            +++  L+A+++G  PQV++E GRK++P    P+ + + + V    
Sbjct: 241 EVIRAVLVAHLHGNAPQVSVEVGRKMVPNLFMPTFQELEESVESLK 286


>gi|260866429|ref|YP_003232831.1| putative lateral flagellar motor protein [Escherichia coli O111:H-
           str. 11128]
 gi|257762785|dbj|BAI34280.1| predicted lateral flagellar motor protein [Escherichia coli O111:H-
           str. 11128]
 gi|323178475|gb|EFZ64053.1| chemotaxis protein lafT [Escherichia coli 1180]
          Length = 287

 Score =  224 bits (570), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 88/287 (30%), Positives = 149/287 (51%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+GL +   C+ GG++  GG    + QP E++I+ GAG G  ++ NP  V+K+    
Sbjct: 1   MQKILGLLVVFGCVFGGYFEAGGQLVAIWQPAEMIIILGAGFGAMIIGNPKHVLKEIAHQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  +   K LG +    +L  LY L+  ++ G     + HI+ P  STIF   P VL   
Sbjct: 61  IKGVISKKQLGPEFQRQLLMCLYELLEMVQNGGLRMLDQHIEQPEESTIFQKYPLVLTQK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L TFI D  R++ +G   ++E+E ++D+E+D      L P  ++    E++P  GI  A
Sbjct: 121 RLVTFIADNFRLMAMGKIDAHELEGILDQELDTAEESLLTPSRSLQRTAEAMPGFGICAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGII  M ++  S  ++G  +  +L GT LG+ + Y L +PL + ++     +H L   
Sbjct: 181 VLGIIITMQSIDGSIALIGLKVAAALVGTFLGVFICYCLMDPLANAMEQQARAEHSLLEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
           V+  L+A   G    +A++ GRK+L L+ +P+   +   V      +
Sbjct: 241 VRTVLVAQAGGKPTLLAVDAGRKLLHLASKPTFANLDAWVNAMLEQE 287


>gi|260767947|ref|ZP_05876881.1| Flagellar motor rotation protein MotA [Vibrio furnissii CIP 102972]
 gi|260615977|gb|EEX41162.1| Flagellar motor rotation protein MotA [Vibrio furnissii CIP 102972]
 gi|315179651|gb|ADT86565.1| flagellar motor protein MotA [Vibrio furnissii NCTC 11218]
          Length = 285

 Score =  224 bits (570), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 80/285 (28%), Positives = 146/285 (51%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   +G  I ++C+ GG+   GG+   + QP E +I+AGA LG  ++ NP +V+K+    
Sbjct: 1   MQKFLGAIIVLMCVFGGYVWAGGSLTAIWQPAEFLIIAGAALGSLIIGNPPQVLKEMRRQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +       Q  Y +++ +L +L+  ++ G     + HI+ P  S IF   P V  + 
Sbjct: 61  LRMMLSQPKNEQAYYMELMAVLQVLLETVRSGGFKSLDKHIESPDQSPIFARYPLVARDY 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L +FI D +R++ +G    +E+E L+++EID I  + L P  ++    E+LP  GI+ A
Sbjct: 121 RLVSFITDNLRLMAMGQMSPHELEGLLEQEIDAIQTDLLLPSRSMQRTAEALPGFGILAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           + GII  M  +  S  ++G  +  +L GT +GI   Y   +P ++ +     +    +  
Sbjct: 181 VGGIIITMQAIDGSIALIGYHVAAALVGTFIGIFGCYCCLDPASNAMAQRVKRDMSAFEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           V+  L+AY+      +AI+ GRK + L  +P+   + + + +   
Sbjct: 241 VRATLVAYVAKKPTLLAIDAGRKHIQLDIKPTFNDMEKWLAEQEG 285


>gi|283133064|dbj|BAI63830.1| flagellar motor protein MotA [Pseudomonas syringae pv. tabaci]
          Length = 283

 Score =  224 bits (570), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 92/282 (32%), Positives = 150/282 (53%), Gaps = 2/282 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M+ IIG+ + I  ++GG+    G    L QP+E++I+ GA LG  + ANP  +       
Sbjct: 1   MAKIIGIIVVIASVLGGYVLSHGKIMALFQPYEVLIIGGAALGALLQANPGYMTMHVFKK 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            L++F         Y +VL L+Y ++   ++      E  I+D  +S IF   P VL++ 
Sbjct: 61  SLKMF-GSRFTHAYYLEVLGLVYEILNKSRREGMMAIEGDIEDAASSPIFAKYPGVLKDE 119

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +T +ICDY+R++  GN   +E+E L D E+  +  E   P HAI+ + + +P  GIV A
Sbjct: 120 RMTAYICDYLRIMSSGNMAPHELEGLFDMELLSMKEELEHPSHAITGIADGMPGFGIVAA 179

Query: 181 ILGIIKAMGNLS-QSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYI 239
           +LGI+  M +L       +G  +G +L GT  GI+ +Y    PL + +     ++  +Y 
Sbjct: 180 VLGIVVTMASLGSGDKAAIGMHVGAALVGTFFGILAAYGFFGPLATCLAHDAKEEMNVYE 239

Query: 240 IVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
            +K +L+A  +G  P +A+E+GRKVL    RPS   + Q V 
Sbjct: 240 SIKASLVASASGMPPSLAVEFGRKVLYPLHRPSFSELEQAVR 281


>gi|153831609|ref|ZP_01984276.1| chemotaxis protein LafT [Vibrio harveyi HY01]
 gi|148872119|gb|EDL70936.1| chemotaxis protein LafT [Vibrio harveyi HY01]
          Length = 285

 Score =  224 bits (570), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 76/285 (26%), Positives = 142/285 (49%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M    G    ++C+ GG+   GG    + QP E +I+ GA  G  ++ NP +V+K+    
Sbjct: 1   MQKFFGAITVLMCVFGGYMWAGGKLGAIWQPAEFLIIIGAAAGSLIIGNPPQVLKEMRQQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +           + Y +++ LL  L+   +       ++HI+ P  S+IF + P V  ++
Sbjct: 61  VRATISGPRQEYEYYMELMALLNNLLETARSRGFKFLDSHIESPEQSSIFLAYPQVSNDH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L +FI D +R++ +G    +E+E L+++EI+ I  E L P  ++    E+LP  GI+ A
Sbjct: 121 RLISFITDNLRLMAMGQMSPHELEGLLEQEIEAIQTEMLLPSRSMQRTAEALPGFGILAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           + GII  M  +  S  ++G  +  +L GT +GI   Y   +PL++ +     +    +  
Sbjct: 181 VGGIIITMQAIDGSIALIGYHVAAALVGTFIGIFGCYCCLDPLSNAMAQRVRRNMTAFEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           V+  L+AY+      +AI+ GRK + L  +P+   + + + +   
Sbjct: 241 VRATLVAYVAKKPTLLAIDAGRKHIQLDIKPTFNQMEKWLAEQEG 285


>gi|28901411|ref|NP_801066.1| flagellar motor protein MotA [Vibrio parahaemolyticus RIMD 2210633]
 gi|153835868|ref|ZP_01988535.1| chemotaxis protein LafT [Vibrio parahaemolyticus AQ3810]
 gi|260362965|ref|ZP_05775834.1| chemotaxis protein LafT [Vibrio parahaemolyticus K5030]
 gi|260880252|ref|ZP_05892607.1| chemotaxis protein LafT [Vibrio parahaemolyticus AN-5034]
 gi|260895369|ref|ZP_05903865.1| chemotaxis protein LafT [Vibrio parahaemolyticus Peru-466]
 gi|260901194|ref|ZP_05909589.1| chemotaxis protein LafT [Vibrio parahaemolyticus AQ4037]
 gi|417237|sp|Q03477|LAFT_VIBPA RecName: Full=Chemotaxis protein LafT
 gi|677909|gb|AAA62354.1| LafT [Vibrio parahaemolyticus]
 gi|1518953|gb|AAB07357.1| lateral flagellar MotA [Vibrio parahaemolyticus]
 gi|28809958|dbj|BAC62899.1| chemotaxis LafT protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|149750622|gb|EDM61367.1| chemotaxis protein LafT [Vibrio parahaemolyticus AQ3810]
 gi|308085587|gb|EFO35282.1| chemotaxis protein LafT [Vibrio parahaemolyticus Peru-466]
 gi|308092231|gb|EFO41926.1| chemotaxis protein LafT [Vibrio parahaemolyticus AN-5034]
 gi|308109320|gb|EFO46860.1| chemotaxis protein LafT [Vibrio parahaemolyticus AQ4037]
 gi|308112021|gb|EFO49561.1| chemotaxis protein LafT [Vibrio parahaemolyticus K5030]
 gi|328469345|gb|EGF40291.1| flagellar motor protein MotA [Vibrio parahaemolyticus 10329]
          Length = 285

 Score =  223 bits (569), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 77/285 (27%), Positives = 143/285 (50%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   +G+   ++C+ GG+   GG    + QP E +I+ GA  G  ++ NP  V+K+    
Sbjct: 1   MQKFLGVLTILVCVFGGYMWAGGKLGAIWQPAEFLIIIGAAAGSLIIGNPPHVLKEMRQQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +           + Y +++ LL  L+   +       ++HI+ P  S+IF   P V E++
Sbjct: 61  VPATIKGPTEEYEYYMELMALLNNLLETARSRGFKFLDSHIEAPEQSSIFLMYPLVSEDH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L +FI D +R++ +G    +E+E L+++EI+ I  E L P  ++    E+LP  GI+ A
Sbjct: 121 RLISFITDNLRLMAMGQMSPHELEGLLEQEIEAIQNELLLPSRSLQRTAEALPGFGILAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           + GII  M  +  S  ++G  +  +L GT +GI   Y   +PL++ +     +    +  
Sbjct: 181 VGGIIITMQAIDGSIALIGYHVAAALVGTFIGIFGCYCGLDPLSNAMAQRVKRNMTAFEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           V+  L+AY+      +AI+ GRK + L  +P+   + + + +   
Sbjct: 241 VRATLVAYVAKKPTLLAIDAGRKHIQLDIKPTFNQMEKWLAEQEG 285


>gi|156976179|ref|YP_001447085.1| flagellar motor protein MotA [Vibrio harveyi ATCC BAA-1116]
 gi|156527773|gb|ABU72858.1| hypothetical protein VIBHAR_04950 [Vibrio harveyi ATCC BAA-1116]
          Length = 285

 Score =  223 bits (569), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 76/285 (26%), Positives = 142/285 (49%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M    G    ++C+ GG+   GG    + QP E +I+ GA  G  ++ NP +V+K+    
Sbjct: 1   MQKFFGAITVLMCVFGGYMWAGGKLGAIWQPAEFLIIIGAAAGSLIIGNPPQVLKEMRQQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +           + Y +++ LL  L+   +       ++HI+ P  S+IF + P V  ++
Sbjct: 61  VRATISGPRQEYEYYMELMALLNNLLETARSRGFKFLDSHIESPEQSSIFLAYPKVSNDH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L +FI D +R++ +G    +E+E L+++EI+ I  E L P  ++    E+LP  GI+ A
Sbjct: 121 RLISFITDNLRLMAMGQMSPHELEGLLEQEIEAIQTEMLLPSRSMQRTAEALPGFGILAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           + GII  M  +  S  ++G  +  +L GT +GI   Y   +PL++ +     +    +  
Sbjct: 181 VGGIIITMQAIDGSIALIGYHVAAALVGTFIGIFGCYCCLDPLSNAMAQRVRRNMTAFEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           V+  L+AY+      +AI+ GRK + L  +P+   + + + +   
Sbjct: 241 VRATLVAYVTKKPTLLAIDAGRKHIQLDIKPTFNQMEKWLAEQEG 285


>gi|312884824|ref|ZP_07744516.1| flagellar motor protein MotA [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309367476|gb|EFP95036.1| flagellar motor protein MotA [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 285

 Score =  223 bits (568), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 77/285 (27%), Positives = 143/285 (50%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M    G    ++C+ GG+   GGN   + QP E +I+ GA +G  ++ NP +V+K+    
Sbjct: 1   MQKFFGAITVLICVFGGYMWAGGNLTAIWQPAEFLIIIGAAIGSLIIGNPPQVLKEMRRQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +          ++   +++ LL +L+  ++ G     + HI+ P  S IF+  P + ++ 
Sbjct: 61  ITLTISGAKQEKEYCMELMALLQVLLETVRSGGFKSLDKHIEAPDESPIFSRYPLIAKDF 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L +FI D  R++ +G    +E+E L+++EID I    L P  ++    E+LP  GI+ A
Sbjct: 121 RLVSFITDNFRLMAMGQMSPHELEGLLEQEIDAIQTNLLLPSKSMQRTAEALPGFGILAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           + GII  M  +  S  ++G  +  +L GT +GI   Y   +PL++ +     +    +  
Sbjct: 181 VGGIIITMSAIDGSIAMIGYHVAAALVGTFIGIFGCYCCLDPLSNAMAQRVKRDMSAFEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           V+  L+AY+      +AI+ GRK + L  +P+   + Q + +   
Sbjct: 241 VRATLVAYVAKKPTLLAIDAGRKHIQLDIKPTFNQMEQWLAEQEG 285


>gi|300936145|ref|ZP_07151084.1| flagellar motor protein MotA [Escherichia coli MS 21-1]
 gi|300458723|gb|EFK22216.1| flagellar motor protein MotA [Escherichia coli MS 21-1]
          Length = 287

 Score =  223 bits (568), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 89/287 (31%), Positives = 150/287 (52%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+GL + + C+ GG++  GG    + QP EIVI+ GAG G  ++ NP  V+K+    
Sbjct: 1   MQKILGLLVVLGCVFGGYFEAGGQLVAIWQPAEIVIILGAGFGAMIIGNPKHVLKEIAHQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  +   K LG +    +L  LY L+  ++ G     + HI+ P  ST+F   P VL   
Sbjct: 61  IKGVISKKQLGPEFQRQLLMCLYELLEMVQNGGLRMLDQHIEQPEESTVFQKYPLVLTQK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L TFI D  R++ +G   ++E+E ++D+E+D      L P  ++    E++P  GI  A
Sbjct: 121 RLVTFIADNFRLMAMGKIDAHELEGILDQELDTAEESLLTPSRSLQRTAEAMPGFGICAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGII  M ++  S  ++G  +  +L GT LG+ + Y L +PL + ++     +H L   
Sbjct: 181 VLGIIITMQSIDGSIALIGLKVAAALVGTFLGVFICYCLMDPLANAMEQQARAEHSLLEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
           V+  L+A   G    +A++ GRK+L L+ +P+   +   V      +
Sbjct: 241 VRTVLVAQAGGKPTLLAVDAGRKLLHLASKPTFANLDAWVNAMLEQE 287


>gi|94986925|ref|YP_594858.1| flagellar motor protein MotA [Lawsonia intracellularis PHE/MN1-00]
 gi|94731174|emb|CAJ54536.1| Flagellar motor component [Lawsonia intracellularis PHE/MN1-00]
          Length = 282

 Score =  223 bits (568), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 101/283 (35%), Positives = 163/283 (57%), Gaps = 1/283 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  IIG FI I  IIGG+    GN  +L QP E+VI+ GA LG F  +           +
Sbjct: 1   MYIIIGYFIVIASIIGGYLMAKGNLALLFQPAELVIIIGAALGAFFASQTKYSFTLVIKN 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  IFG     +  Y + L LLY L   + +      E+ I+ P +S IF+  PT++++ 
Sbjct: 61  LSHIFGDPNSTKIKYLETLALLYGLFLKMNREGVISIESDIEKPESSPIFSKYPTIVKDT 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           ++  FI D +R+ +   A   +I+NLM+ ++ I   E+L P H+ISHM ESLP +GIV A
Sbjct: 121 KVVAFIADTLRVYLTTGA-PEDIDNLMESDMKITHEEELLPAHSISHMAESLPGMGIVAA 179

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG++  MG +++ P++LG  IG +L GT +GI+  Y    P+ S+++++  + H  Y  
Sbjct: 180 VLGVVITMGKINEPPEVLGHYIGAALVGTFIGILFCYGFFGPMGSKLETSAEEAHFYYNS 239

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQY 283
           +K+A+ A + G+ P +A+EYGR+ +P + RPS   + + +   
Sbjct: 240 IKEAVAAAIRGSTPMIAVEYGRRAIPNTFRPSFSEMEERLKTG 282


>gi|170681048|ref|YP_001742390.1| flagellar motor protein MotA [Escherichia coli SMS-3-5]
 gi|306813286|ref|ZP_07447479.1| flagellar motor protein MotA [Escherichia coli NC101]
 gi|170518766|gb|ACB16944.1| lateral flagellar motor protein A [Escherichia coli SMS-3-5]
 gi|305854049|gb|EFM54488.1| flagellar motor protein MotA [Escherichia coli NC101]
          Length = 287

 Score =  222 bits (567), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 87/287 (30%), Positives = 150/287 (52%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+GL + + C+ GG++  GG    + QP E++I+ GAG G  ++ NP  V+K+    
Sbjct: 1   MQKILGLLVVLGCVFGGYFEAGGQLVAIWQPAEMIIILGAGFGAMIIGNPKHVLKEIAHQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  +   K LG +    +L  LY L+  ++ G     + HI+ P  ST+F   P VL   
Sbjct: 61  IKGVISKKQLGPEFQRQLLMCLYELLEMVQNGGLRMLDQHIEQPEESTVFQKYPLVLTQK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L TFI D  R++ +G   ++E+E ++D+E+D      L P  ++    E++P  GI  A
Sbjct: 121 RLVTFIADNFRLMAMGKIDAHELEGILDQELDTAEESLLTPSRSLQRTAEAMPGFGICAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGII  M ++  S  ++G  +  +L GT LG+ + Y L +PL + ++     +H L   
Sbjct: 181 VLGIIITMQSIDGSIALIGLKVAAALVGTFLGVFICYCLMDPLANAMEQQARAEHSLLEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
           V+  L+A   G    +A++ GRK+L L+ +P+   +   V      +
Sbjct: 241 VRTVLVAQAGGKPTLLAVDAGRKLLHLASKPTFANLDAWVNAMLEQE 287


>gi|170021343|ref|YP_001726297.1| flagellar motor protein MotA [Escherichia coli ATCC 8739]
 gi|188495414|ref|ZP_03002684.1| chemotaxis protein LafT [Escherichia coli 53638]
 gi|218703544|ref|YP_002411063.1| flagellar motor protein MotA [Escherichia coli UMN026]
 gi|256020245|ref|ZP_05434110.1| flagellar motor protein MotA [Shigella sp. D9]
 gi|260853483|ref|YP_003227374.1| putative lateral flagellar motor protein [Escherichia coli O26:H11
           str. 11368]
 gi|293403375|ref|ZP_06647466.1| flagellar motor protein MotA [Escherichia coli FVEC1412]
 gi|293408385|ref|ZP_06652224.1| conserved hypothetical protein [Escherichia coli B354]
 gi|298378987|ref|ZP_06988868.1| flagellar motor protein MotA [Escherichia coli FVEC1302]
 gi|300817252|ref|ZP_07097470.1| flagellar motor protein MotA [Escherichia coli MS 107-1]
 gi|300899472|ref|ZP_07117720.1| flagellar motor protein MotA [Escherichia coli MS 198-1]
 gi|307136894|ref|ZP_07496250.1| flagellar motor protein MotA [Escherichia coli H736]
 gi|307313502|ref|ZP_07593123.1| MotA/TolQ/ExbB proton channel [Escherichia coli W]
 gi|331640758|ref|ZP_08341893.1| chemotaxis MotA protein [Escherichia coli H736]
 gi|331666563|ref|ZP_08367437.1| chemotaxis MotA protein [Escherichia coli TA271]
 gi|331671821|ref|ZP_08372617.1| chemotaxis MotA protein [Escherichia coli TA280]
 gi|332281407|ref|ZP_08393820.1| lateral flagellar motor protein A [Shigella sp. D9]
 gi|169756271|gb|ACA78970.1| MotA/TolQ/ExbB proton channel [Escherichia coli ATCC 8739]
 gi|188490613|gb|EDU65716.1| chemotaxis protein LafT [Escherichia coli 53638]
 gi|218430641|emb|CAR11507.1| Chemotaxis protein lafT, Lateral flagellar motor protein A
           (MotA-like) [Escherichia coli UMN026]
 gi|257752132|dbj|BAI23634.1| predicted lateral flagellar motor protein [Escherichia coli O26:H11
           str. 11368]
 gi|291429228|gb|EFF02248.1| flagellar motor protein MotA [Escherichia coli FVEC1412]
 gi|291471563|gb|EFF14046.1| conserved hypothetical protein [Escherichia coli B354]
 gi|298280100|gb|EFI21604.1| flagellar motor protein MotA [Escherichia coli FVEC1302]
 gi|300356951|gb|EFJ72821.1| flagellar motor protein MotA [Escherichia coli MS 198-1]
 gi|300530228|gb|EFK51290.1| flagellar motor protein MotA [Escherichia coli MS 107-1]
 gi|306906670|gb|EFN37181.1| MotA/TolQ/ExbB proton channel [Escherichia coli W]
 gi|315059559|gb|ADT73886.1| proton conductor component of flagella motor [Escherichia coli W]
 gi|315616808|gb|EFU97425.1| chemotaxis protein lafT [Escherichia coli 3431]
 gi|323158086|gb|EFZ44185.1| chemotaxis protein lafT [Escherichia coli EPECa14]
 gi|323171083|gb|EFZ56732.1| chemotaxis protein lafT [Escherichia coli LT-68]
 gi|323181564|gb|EFZ66984.1| chemotaxis protein lafT [Escherichia coli 1357]
 gi|323379882|gb|ADX52150.1| MotA/TolQ/ExbB proton channel [Escherichia coli KO11]
 gi|331037556|gb|EGI09776.1| chemotaxis MotA protein [Escherichia coli H736]
 gi|331065787|gb|EGI37671.1| chemotaxis MotA protein [Escherichia coli TA271]
 gi|331070810|gb|EGI42169.1| chemotaxis MotA protein [Escherichia coli TA280]
 gi|332103759|gb|EGJ07105.1| lateral flagellar motor protein A [Shigella sp. D9]
          Length = 287

 Score =  222 bits (567), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 88/287 (30%), Positives = 150/287 (52%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+GL + + C+ GG++  GG    + QP E++I+ GAG G  ++ NP  V+K+    
Sbjct: 1   MQKILGLLVVLGCVFGGYFEAGGQLVAIWQPAEMIIILGAGFGAMIIGNPKHVLKEIAHQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  +   K LG +    +L  LY L+  ++ G     + HI+ P  STIF   P VL   
Sbjct: 61  IKGVISKKQLGPEFQRQLLMCLYELLEMVQNGGLRMLDQHIEQPEESTIFQKYPLVLTQK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L TFI D  R++ +G   ++E+E ++D+E+D      L P  ++    E++P  GI  A
Sbjct: 121 RLVTFIADNFRLMAMGKIDAHELEGILDQELDTAEESLLTPSRSLQRTAEAMPGFGICAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGII  M ++  S  ++G  +  +L GT LG+ + Y L +PL + ++     +H L   
Sbjct: 181 VLGIIITMQSIDGSIALIGLKVAAALVGTFLGVFICYCLMDPLANAMEQQARAEHSLLEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
           V+  L+A   G    +A++ GRK+L L+ +P+   +   V      +
Sbjct: 241 VRTVLVAQAGGKPTLLAVDAGRKLLHLASKPTFANLDAWVNAMLEQE 287


>gi|157147078|ref|YP_001454397.1| flagellar motor protein MotA [Citrobacter koseri ATCC BAA-895]
 gi|157084283|gb|ABV13961.1| hypothetical protein CKO_02855 [Citrobacter koseri ATCC BAA-895]
          Length = 287

 Score =  222 bits (567), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 85/287 (29%), Positives = 149/287 (51%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   +G+ I + C++GGF   GG+     QP EI+I+ GAGLG  V+ANP  V+ +    
Sbjct: 1   MQKFLGILIIMGCVVGGFILSGGHLASFWQPGEIIIILGAGLGAMVLANPKAVLSEMYRQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
              I        +    +L LLY L+  ++ G     + HI+ P NS +F   P +L + 
Sbjct: 61  FRGIMRKNEYTDEYQRQLLMLLYELLELVQDGGLKVLDEHIEAPENSALFQKYPLMLHDK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L TFI D  R++ +G    +E+E ++++E+  +    L+P  ++    E++P  GI  A
Sbjct: 121 ALVTFISDNFRLMAMGKINEHELEGILEQELVAMEENLLQPSRSLQRTAEAMPGFGICAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGII  M ++  S  ++G  +  +L GT LG+   Y L +P+ + ++    KQ  +   
Sbjct: 181 VLGIIITMQSIDGSIAVIGVKVAAALVGTFLGVFFCYCLMDPVANAMEQRTKKQISVLEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
           V+  L+ ++ G    +A++ GRK+LP+  +P+   +   V Q   + 
Sbjct: 241 VRTVLVNHVAGKPTLLAVDAGRKMLPMDTKPTFATLDGWVNQMMGDA 287


>gi|331645435|ref|ZP_08346539.1| chemotaxis MotA protein [Escherichia coli M605]
 gi|323191389|gb|EFZ76651.1| chemotaxis protein lafT [Escherichia coli RN587/1]
 gi|331045597|gb|EGI17723.1| chemotaxis MotA protein [Escherichia coli M605]
          Length = 287

 Score =  222 bits (567), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 90/287 (31%), Positives = 150/287 (52%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+GL + + C+ GG++  GG    + QP EIVI+ GAG G  ++ NP  V+K+    
Sbjct: 1   MQKILGLLVVLGCVFGGYFEAGGQLIAIWQPAEIVIILGAGFGAMIIGNPKHVLKEIAHQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  +   K LG +    +L  LY L+  ++ G     + HI+ P  STIF   P VL   
Sbjct: 61  IKGVISKKQLGPEFQRQLLMCLYELLEMVQNGGLRMLDQHIEQPEESTIFQKYPLVLTQK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L TFI D  R++ +G   ++E+E ++D+E+D      L P  ++    E++P  GI  A
Sbjct: 121 RLVTFIADNFRLMAMGKIDAHELEGILDQELDTAEESLLTPSRSLQRTAEAMPGFGICAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGII  M ++  S  ++G  +  +L GT LG+ + Y L +PL + ++     +H L   
Sbjct: 181 VLGIIITMQSIDGSIALIGLKVAAALVGTFLGVFICYCLMDPLANAMEQQARAEHSLLEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
           V+  L+A   G    +A++ GRK+L L+ +P+   +   V      +
Sbjct: 241 VRTVLVAQAGGKPTLLAVDAGRKLLHLASKPTFANLDAWVNAMLEQE 287


>gi|323976252|gb|EGB71345.1| chemotaxis protein MotA [Escherichia coli TW10509]
 gi|327254573|gb|EGE66189.1| chemotaxis protein lafT [Escherichia coli STEC_7v]
          Length = 287

 Score =  222 bits (566), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 87/287 (30%), Positives = 150/287 (52%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+GL + + C+ GG++  GG    + QP E++I+ GAG G  ++ NP  V+K+    
Sbjct: 1   MQKILGLLVVLGCVFGGYFEAGGQLVAIWQPAEMIIILGAGFGAMIIGNPKHVLKEIAHQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  +   K LG +    +L  LY L+  ++ G     + HI+ P  STIF   P +L   
Sbjct: 61  IKGVISKKQLGPEFQRQLLMCLYELLEMVQNGGLRMLDQHIEQPEESTIFQKYPLILTQK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L TFI D  R++ +G   ++E+E ++D+E+D      L P  ++    E++P  GI  A
Sbjct: 121 RLVTFIADNFRLMAMGKIDAHELEGILDQELDTAEESLLTPSRSLQRTAEAMPGFGICAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGII  M ++  S  ++G  +  +L GT LG+ + Y L +PL + ++     +H L   
Sbjct: 181 VLGIIITMQSIDGSIALIGLKVAAALVGTFLGVFICYCLMDPLANAMEQQARAEHSLLEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
           V+  L+A   G    +A++ GRK+L L+ +P+   +   V      +
Sbjct: 241 VRTVLVAQAGGKPTLLAVDAGRKLLHLASKPTFANLDAWVNAMLEQE 287


>gi|329850379|ref|ZP_08265224.1| chemotaxis protein motA [Asticcacaulis biprosthecum C19]
 gi|328840694|gb|EGF90265.1| chemotaxis protein motA [Asticcacaulis biprosthecum C19]
          Length = 290

 Score =  222 bits (566), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 85/289 (29%), Positives = 165/289 (57%), Gaps = 2/289 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  IIG+ +    + G +   GGN   +I+  P E++ + G+ +   ++ N L  +K  G
Sbjct: 1   MFQIIGIVLLFGMVFGSYMLAGGNFAPIIEAAPHELMAIGGSAVAASLIGNSLTTLKGMG 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
             + ++FG        Y D+L LL++L   +K       E+HI+ P++S+IF   P +++
Sbjct: 61  GGMGKVFGGPKWKASDYRDLLSLLFLLTKTMKSKGVIALESHIEKPHDSSIFKRFPKIVK 120

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           ++    FICD +RM+ +     +++E+ M+++++   +E L P HA+ +M ++LPA+GIV
Sbjct: 121 DHFAVDFICDTLRMMTMNLEDPHQVEDAMEKQLEKHHHEALHPAHALQNMADALPALGIV 180

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG+IK MG++++ P++LG  IG +L GT +G+ L+Y L  P  +++     ++   Y
Sbjct: 181 AAVLGVIKTMGSITEPPEVLGAMIGGALVGTFMGVFLAYGLVGPFATRMSGVIEEESAFY 240

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
            I++  L+A+++G   Q+++E GR  +P   +PS   + + +       
Sbjct: 241 KIIQSVLVAHLHGNAAQISVEIGRGSIPTPSQPSFLEMEEALNNIPAEA 289


>gi|59889799|emb|CAH19155.1| Lateral flagellar motor protein A (MotA-like) [Escherichia coli]
 gi|284920063|emb|CBG33120.1| lateral flagellar motor protein A (MotA-like) [Escherichia coli
           042]
          Length = 287

 Score =  222 bits (566), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 88/287 (30%), Positives = 150/287 (52%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+GL + + C+ GG++  GG    + QP E++I+ GAG G  ++ NP  V+K+    
Sbjct: 1   MQKILGLLVVLGCVFGGYFEAGGQLVAIWQPAEMIIIWGAGFGAMIIGNPKHVLKEIAHQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  +   K LG +    +L  LY L+  ++ G     + HI+ P  STIF   P VL   
Sbjct: 61  IKGVISKKQLGPEFQRQLLMCLYELLEMVQNGGLRMLDQHIEQPEESTIFQKYPLVLTQK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L TFI D  R++ +G   ++E+E ++D+E+D      L P  ++    E++P  GI  A
Sbjct: 121 RLVTFIADNFRLMAMGKIDAHELEGILDQELDTAEESLLTPSRSLQRTAEAMPGFGICAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGII  M ++  S  ++G  +  +L GT LG+ + Y L +PL + ++     +H L   
Sbjct: 181 VLGIIITMQSIDGSIALIGLKVAAALVGTFLGVFICYCLMDPLANAMEQQARAEHSLLEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
           V+  L+A   G    +A++ GRK+L L+ +P+   +   V      +
Sbjct: 241 VRTVLVAQAGGKPTLLAVDAGRKLLHLASKPTFANLDAWVNAMLEQE 287


>gi|103488395|ref|YP_617956.1| flagellar motor protein MotA [Sphingopyxis alaskensis RB2256]
 gi|98978472|gb|ABF54623.1| flagellar motor protein [Sphingopyxis alaskensis RB2256]
          Length = 287

 Score =  222 bits (565), Expect = 6e-56,   Method: Composition-based stats.
 Identities = 89/280 (31%), Positives = 152/280 (54%), Gaps = 4/280 (1%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  ++G+ + IL + GGF   GGN   ++   P E++I+ GA LG  ++ N    +K   
Sbjct: 1   MFPVVGIVVLILLVFGGFALTGGNLGPVMHALPHEMLIIGGAALGSLIIGNSGADLKALA 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
             L ++F      +  Y D + L+  LM  ++       E HI+DP NSTIF   P +L+
Sbjct: 61  GGLGKVFKGPQYKKQDYLDCILLVSSLMKMMRTEGPVAVEPHIEDPKNSTIFQQYPKLLK 120

Query: 119 NNELTTFICDYMRMIIV--GNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIG 176
           ++ L   ICD +R+++V  G    + +E +MD  +    +  +KP   +  + ++LPA+G
Sbjct: 121 DDTLVHLICDTLRLVVVSSGTLDPHAVEEVMDNALKSHHHHSMKPADGLQSLADALPALG 180

Query: 177 IVGAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHR 236
           IV A+LG++K MG++ + P+ILG  IG +L GT LG++L+Y L  P  ++ ++       
Sbjct: 181 IVAAVLGVVKTMGSIDKPPEILGAMIGSALVGTFLGVLLAYGLVGPFATRARTVIESDGA 240

Query: 237 LYIIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIV 276
           +Y  VK+ +IA ++G    + IE  R  +    +PS   V
Sbjct: 241 IYHTVKQLIIASLHGHPQPLVIEAARSGVDHHNQPSFAEV 280


>gi|260779336|ref|ZP_05888228.1| Flagellar motor rotation protein MotA [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260605500|gb|EEX31795.1| Flagellar motor rotation protein MotA [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 285

 Score =  222 bits (565), Expect = 6e-56,   Method: Composition-based stats.
 Identities = 77/285 (27%), Positives = 141/285 (49%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M    G    +LC+ GG+   GG    + QP E +I+ GA  G  ++ NP +V+K+    
Sbjct: 1   MQKFFGAITVLLCVFGGYMWAGGKLGAIWQPAEFLIIIGAAAGSLIIGNPPQVLKEMRQQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +           + Y +++ LL  L+   +       ++HI+ P  S+IF + P V  + 
Sbjct: 61  VRATISAPREEYEYYMELMALLNNLLETARSRGFKFLDSHIEAPDQSSIFLAYPKVGSDY 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L +FI D +R++ +G    +E+E L+++EI+ I  E L P  ++    E+LP  GI+ A
Sbjct: 121 RLISFITDNLRLMAMGQMSPHELEGLLEQEIEAIQTEMLLPSRSMQRTAEALPGFGILAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           + GII  M  +  S  ++G  +  +L GT +GI   Y   +PL++ +     +    +  
Sbjct: 181 VGGIIITMQAIDGSIALVGYHVAAALVGTFVGIFGCYCCLDPLSNAMAQRVKRNMTAFEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           V+  L+AY+      +AI+ GRK + L  +P+   + + + +   
Sbjct: 241 VRATLVAYVAKKPTLLAIDAGRKHIQLDIKPTFNQMEKWLAEQEG 285


>gi|78485776|ref|YP_391701.1| chemotaxis protein [Thiomicrospira crunogena XCL-2]
 gi|78364062|gb|ABB42027.1| Flagellar motor protein MotA [Thiomicrospira crunogena XCL-2]
          Length = 273

 Score =  221 bits (564), Expect = 7e-56,   Method: Composition-based stats.
 Identities = 91/265 (34%), Positives = 156/265 (58%)

Query: 14  IIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQD 73
           +  G Y   G+  ILIQP E++I+ G+ LG F++ANP  V+K S    L +       ++
Sbjct: 3   LYLGGYLPHGSIGILIQPLEVLIICGSALGAFIIANPGWVVKKSFSGALGLAKPDPYNKE 62

Query: 74  TYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMI 133
            Y ++L L++ +    ++      E  +++P++S +F + P V+ ++    FICDY+R++
Sbjct: 63  AYVELLGLMFRIFNKARREGLMAIEADVEEPHSSELFNASPKVVSDHHAVDFICDYLRLM 122

Query: 134 IVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQ 193
           I G +  Y++E+LM  E+DI  +E   P  A+  + E+LP  GIV A+LGII  MG L  
Sbjct: 123 ISGASNPYQLEDLMILEMDIHHHEAAAPAEAVGKVAEALPGFGIVAAVLGIIVTMGYLDA 182

Query: 194 SPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAI 253
            P  +   + V+L GT LGI+++Y +  P++S + +    +   +  +K  L+A +NG  
Sbjct: 183 GPLEIAHHMSVALVGTFLGILVAYGVVGPISSDMANRAHNEGAYFGTIKTCLMANLNGYA 242

Query: 254 PQVAIEYGRKVLPLSERPSIEIVAQ 278
           PQ+A+E+GRK +P SERPS + + +
Sbjct: 243 PQIAVEFGRKSIPASERPSFQELEE 267


>gi|330861236|emb|CBX71487.1| chemotaxis protein motA [Yersinia enterocolitica W22703]
          Length = 259

 Score =  221 bits (564), Expect = 8e-56,   Method: Composition-based stats.
 Identities = 84/254 (33%), Positives = 144/254 (56%)

Query: 37  VAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNE 96
           + GAG+G F++ N  K IK +  +L ++       +  Y D++ LLY L+   ++     
Sbjct: 1   IGGAGIGAFIVGNNGKAIKATMKALPKLMRRSKYNKVLYMDLMALLYRLLAKSRQQGMLS 60

Query: 97  TENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILY 156
            E  I+ P  S IF++ P +L +  L  FI DY+R+I+ GN  ++EIE LMDEEI+    
Sbjct: 61  LERDIESPLESEIFSNYPRILADKVLVEFITDYLRLIVSGNMNAFEIEALMDEEIETHEQ 120

Query: 157 EKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILS 216
           E   P  +++ +G+SLPA GIV A++G++ A+ +  +    LG  I  ++ GT LGI+L+
Sbjct: 121 ECEVPAGSLAMVGDSLPAFGIVAAVMGVVHALASADRPAAELGALIAHAMVGTFLGILLA 180

Query: 217 YSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIV 276
           Y   +PL + ++    +  ++   +K  L++ +NG  PQ+A+E+GRK L  +ERPS   +
Sbjct: 181 YGFISPLATLLRQQSAETTKMMQCIKVTLLSSLNGYAPQIAVEFGRKTLYTTERPSFIEL 240

Query: 277 AQEVLQYNHNKKAS 290
            + V +       +
Sbjct: 241 EEHVRRVKAPAPQA 254


>gi|315126000|ref|YP_004068003.1| LafT [Pseudoalteromonas sp. SM9913]
 gi|315014514|gb|ADT67852.1| LafT [Pseudoalteromonas sp. SM9913]
          Length = 287

 Score =  221 bits (564), Expect = 8e-56,   Method: Composition-based stats.
 Identities = 86/287 (29%), Positives = 154/287 (53%), Gaps = 2/287 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  +IGL + +  ++GGF   GGN   + QP+E +I+ GAGLG  ++ N   V+ +    
Sbjct: 1   MQRVIGLIVVLATVLGGFAFAGGNIATMWQPYEFLIIFGAGLGALIVGNSKYVLTEMLSQ 60

Query: 61  LLEIFGYKA--LGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
           L   F         + Y D+L ++Y L+   +       + H+++P  S+IF + P V E
Sbjct: 61  LKYQFISGKGTDTSELYHDLLLVIYSLLDLARVKGIKGLDEHVENPETSSIFLAYPKVYE 120

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
             +L TFICD +R+  +G   S++ + ++++EI  I  ++LKP H+++++ E++P  GI+
Sbjct: 121 FPQLVTFICDNLRLFSMGKINSHDFDAMLEQEIYTIEEQRLKPSHSLANIAEAMPGFGIL 180

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+ GII  M +L      +G  +  +L GT +GI   Y L  PL S ++    KQ  ++
Sbjct: 181 AAVGGIIITMQHLDGPLSEIGYHVAAALVGTFIGIFACYCLIAPLASAMEQYVKKQVAMF 240

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
             V+  L+A+  G +P VA + GRK++    +P+   + + +     
Sbjct: 241 ECVRAMLVAHAKGHVPIVATDSGRKLINEEIKPTFTTMEEWITNKAA 287


>gi|283834437|ref|ZP_06354178.1| chemotaxis MotA protein [Citrobacter youngae ATCC 29220]
 gi|291069984|gb|EFE08093.1| chemotaxis MotA protein [Citrobacter youngae ATCC 29220]
          Length = 287

 Score =  221 bits (563), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 89/287 (31%), Positives = 151/287 (52%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I GL + + C+ GG++  GG    + QP EI+I+ GAGLG  ++ NP+ V+K+    
Sbjct: 1   MQKIFGLLVVLGCVFGGYFEAGGQLIAIWQPAEIIIIVGAGLGAMIIGNPVHVLKEIAHQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  +   K +G +    +L  LY L+  ++ G     + HI+ P  STIF   P VL   
Sbjct: 61  IKGVISKKKMGPEFQRQLLMCLYELLEMVQNGGLRMLDQHIEQPEESTIFQKYPLVLTQK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L TFI D  R++ +G   ++E+E ++D+E+D      L P  ++    E++P  GI  A
Sbjct: 121 RLVTFIADNFRLMAMGKIDAHELEGILDQELDTAEESLLTPSRSLQRTAEAMPGFGICAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGII  M ++  S  ++G  +  +L GT LG+ + Y L +PL + ++     +H L   
Sbjct: 181 VLGIIITMQSIDGSIALIGLKVAAALVGTFLGVFICYCLMDPLANAMEQQARAEHSLLEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
           V+  L+A   G    +A++ GRK+L L+ +P+   +   V      +
Sbjct: 241 VRTVLVAQAGGKPTLLAVDAGRKLLHLASKPTFANLDAWVNAMLEQE 287


>gi|262273511|ref|ZP_06051325.1| Flagellar motor rotation protein MotA [Grimontia hollisae CIP
           101886]
 gi|262222489|gb|EEY73800.1| Flagellar motor rotation protein MotA [Grimontia hollisae CIP
           101886]
          Length = 282

 Score =  221 bits (562), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 85/282 (30%), Positives = 155/282 (54%), Gaps = 1/282 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  +    ++GG+    G    L QP E VI+ GA LG  V+ANP  V+K+    
Sbjct: 1   MQVILGFVVVFATVMGGYVMATGKIAALWQPPEFVIILGAALGAMVIANPPYVLKNILTR 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +   K  G D Y  VL+L+Y L+  ++K    + ++HI++P +S IF+  P V+++ 
Sbjct: 61  LKMLM-GKPYGDDFYKSVLQLMYELLEVVRKDGMKKLDDHIENPESSDIFSRYPNVVKSP 119

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FI D +R + +G    +++E  ++ E++ +  + ++P  A++  GE++P  GIV A
Sbjct: 120 ILLPFITDNLRTLAMGKMTHHDLEAALELEMEALEADLMRPSKALTKTGEAMPGFGIVAA 179

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGI+  M N+     ++G  +  +L GT  G++++Y + +PL+S I     K+     +
Sbjct: 180 VLGIVVTMQNIGGPLTLIGVKVAAALVGTFFGVLMAYGVFDPLSSSITGLVKKEMLALRM 239

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQ 282
           V   L+A   G    +A++ GR++L    +PS   + Q +++
Sbjct: 240 VATILVAQAQGKPTILALDSGRRLLYSEYKPSFSEMEQWMVR 281


>gi|257094101|ref|YP_003167742.1| chemotaxis MotA protein [Candidatus Accumulibacter phosphatis clade
           IIA str. UW-1]
 gi|257046625|gb|ACV35813.1| chemotaxis MotA protein [Candidatus Accumulibacter phosphatis clade
           IIA str. UW-1]
          Length = 285

 Score =  221 bits (562), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 97/281 (34%), Positives = 165/281 (58%), Gaps = 1/281 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  I +   +G +    G+   L  P E V + G  +GGFV +N LK+IK +  +
Sbjct: 1   MFLIVGYVIILAAALGTYSV-HGSLAALWVPLEYVAIVGLTIGGFVASNDLKIIKTTVGA 59

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  IF      +  Y D+L +L+ ++  ++K      EN +++P +S IF+  P++  ++
Sbjct: 60  LPGIFKGSKFTKVLYVDLLAMLFEVLAKVRKEGLMSIENDVENPQDSPIFSKYPSLAGDH 119

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FI DY+RM++ GN  + EIENLMD EI+   +E   P H +S + +++PA GIV A
Sbjct: 120 HVMEFITDYLRMMVGGNLNAIEIENLMDIEIETHHHEVETPGHVVSKVADAVPAFGIVVA 179

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  MG++ + P +LG  IG +L GT LGI+++Y   +P+ S ++       ++Y +
Sbjct: 180 VMGVVNVMGSVGEPPAVLGKMIGGALVGTFLGILIAYGFVSPVASLLEQKAQDGTKIYQV 239

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
           +K  L+A M+G  PQVA+E+GRK L    RP+   + +E+ 
Sbjct: 240 IKVVLLASMSGYAPQVAVEFGRKTLVSGLRPTFRELEEELK 280


>gi|16125003|ref|NP_419567.1| flagellar motor protein MotA [Caulobacter crescentus CB15]
 gi|221233724|ref|YP_002516160.1| flagellar motor protein MotA [Caulobacter crescentus NA1000]
 gi|13421983|gb|AAK22735.1| chemotaxis MotA protein [Caulobacter crescentus CB15]
 gi|220962896|gb|ACL94252.1| chemotaxis motA protein [Caulobacter crescentus NA1000]
          Length = 288

 Score =  221 bits (562), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 87/285 (30%), Positives = 161/285 (56%), Gaps = 2/285 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  IIG+ +    + G +   GG   ++I   P E++ + GAG+  F++ N + VIK + 
Sbjct: 1   MFQIIGIVLLFAMVFGSYIMAGGKMDVIIHAAPHELMAIGGAGVAAFLIGNSVTVIKATL 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
                IF         Y D+L LL++L   +K       E HI+ P+ STIF+  P +  
Sbjct: 61  GGFGTIFKGPKWKAQDYRDLLSLLFLLTKTMKSKGVIALEAHIEKPHESTIFSRYPKIAH 120

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           ++    FICD +RM+ +     +++E+ M+++++   +E     HA++ + + LPA+GIV
Sbjct: 121 DHFAVDFICDTLRMMTMNLEDPHQVEDAMEKQLEKHHHEAHGAAHALTQLSDGLPALGIV 180

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG+IK MG++++ P +LGT IG +L GT +G+ ++Y L  P+ +++     + H  Y
Sbjct: 181 AAVLGVIKTMGSITEPPAVLGTMIGGALVGTFMGVFMAYGLVGPMATRLGGVLDEDHNFY 240

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQY 283
            I++  L+A+++G   Q+++E GR  +P + +PS   + + + Q 
Sbjct: 241 KIIQAVLVAHLHGNAAQISVEIGRGNVPSAYQPSFAELEEALSQM 285


>gi|218886186|ref|YP_002435507.1| flagellar motor protein MotA [Desulfovibrio vulgaris str. 'Miyazaki
           F']
 gi|218757140|gb|ACL08039.1| flagellar motor protein MotA [Desulfovibrio vulgaris str. 'Miyazaki
           F']
          Length = 281

 Score =  220 bits (561), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 85/282 (30%), Positives = 155/282 (54%), Gaps = 1/282 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  IIGL +    I+ G+    G  ++L QP E++I+ GA +G F++++    +     +
Sbjct: 1   MFAIIGLVVVFGSILTGYLMSHGVLHVLWQPAELIIILGAAIGAFIVSSTKYSLGLVLKN 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  + G   + +  Y DVL LL  L   + +      E  I+ P  S+IF   P + ++ 
Sbjct: 61  LKLVLGDPGMSKAKYLDVLGLLNSLFVKMHREGVISIEQDIEKPEGSSIFNKYPAIAKDK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               FI D +R+ +       EI++LM+ ++  +  E+    H+I  M ESLP +GIV A
Sbjct: 121 HTVHFIGDTLRVYLT-TGDPNEIDSLMEVDMKSMHEEESIAPHSIGRMAESLPGMGIVAA 179

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG++  MG +S+ P++LG  IG +L GT +GI+  Y +  P+ ++I+    + H  + +
Sbjct: 180 VLGVVLTMGKISEPPEVLGHHIGAALIGTFIGILFCYGVFGPMGAKIEQANHEHHMYFAV 239

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQ 282
           +K+A+ A + G+ P +A+EYGR+ +P + RP+   + +++  
Sbjct: 240 IKEAVAAAIRGSTPIIAVEYGRRAIPHTFRPTFAEMEEKLKS 281


>gi|94495403|ref|ZP_01301983.1| flagellar motor protein [Sphingomonas sp. SKA58]
 gi|94424791|gb|EAT09812.1| flagellar motor protein [Sphingomonas sp. SKA58]
          Length = 287

 Score =  220 bits (561), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 88/286 (30%), Positives = 153/286 (53%), Gaps = 4/286 (1%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  IIGL + +  + GGF   GG+   ++   P E++I+ GA +G  ++ N    +K  G
Sbjct: 1   MFAIIGLVVLLGMVFGGFIFTGGDIGPVLHALPHEMLIIGGAAVGALIIGNSGADLKALG 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
             L ++F   A  +  + D + L+  LM  L+       E HI+DP  S IF   P +++
Sbjct: 61  GGLAKVFKGPAYKKQDFLDCIFLVSKLMKTLRVEGPVALEPHIEDPGTSPIFAEYPKLMK 120

Query: 119 NNELTTFICDYMRMIIV--GNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIG 176
           +  L   I D +R+++V  G    + +E +MD  +    +E LKP   +  + ++LPA+G
Sbjct: 121 DKTLIHLISDTLRLVVVSSGTLDPHAVEEVMDNSLKTHHHEALKPADNLQGLADALPALG 180

Query: 177 IVGAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHR 236
           IV A+LG++K MG++ Q P +LG  IG +L GT LG++L+Y + NP  ++ ++   +   
Sbjct: 181 IVAAVLGVVKTMGSIDQPPSVLGAMIGSALVGTFLGVLLAYGMVNPFANRCRTVIEQDGA 240

Query: 237 LYIIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQ 282
           +Y +VK+ +IA ++G    + IE  R  L  + +P    V   +  
Sbjct: 241 IYHVVKQIIIASLHGHPQPLVIEAARSSLIHANQPGFAEVFDGMRN 286


>gi|307293779|ref|ZP_07573623.1| chemotaxis MotA protein [Sphingobium chlorophenolicum L-1]
 gi|306879930|gb|EFN11147.1| chemotaxis MotA protein [Sphingobium chlorophenolicum L-1]
          Length = 287

 Score =  220 bits (561), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 87/280 (31%), Positives = 153/280 (54%), Gaps = 4/280 (1%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  IIGL + +  + GGF   GG+   ++   P E++I+ GA +G  ++ N    +K  G
Sbjct: 1   MFAIIGLVVLLAMVFGGFIFTGGDIGPVLHALPHEMLIIGGAAVGALIIGNSGADLKALG 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
             L ++F      +  + D + L+  LM  L+       E HI+DP +STIF+  P ++ 
Sbjct: 61  GGLGKVFKGPKYKKQDFLDCIFLVSKLMKTLRVEGPVALEPHIEDPASSTIFSEYPRLMG 120

Query: 119 NNELTTFICDYMRMIIV--GNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIG 176
           +  L   I D +R+++V  G    + +E +MD  +    +E LKP   +  + ++LPA+G
Sbjct: 121 DKTLIHLISDTLRLVVVSSGTLDPHAVEEVMDNALKTHHHESLKPADNLQGLADALPALG 180

Query: 177 IVGAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHR 236
           IV A+LG++K MG++ Q P +LG  IG +L GT LG++L+Y + NP  ++ ++       
Sbjct: 181 IVAAVLGVVKTMGSIDQPPAVLGAMIGSALVGTFLGVLLAYGMVNPFANRCRAVIEADGS 240

Query: 237 LYIIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIV 276
           +Y +VK+ ++A ++G    + IE  R  L  + +P+   V
Sbjct: 241 MYHVVKQIIVASLHGHPQPLVIEAARSSLTHANQPAFAEV 280


>gi|209963561|ref|YP_002296476.1| chemotaxis MotA protein [Rhodospirillum centenum SW]
 gi|7025362|gb|AAF35850.1|AF220005_1 lateral flagellar motor protein MotA [Rhodospirillum centenum]
 gi|209957027|gb|ACI97663.1| chemotaxis MotA protein [Rhodospirillum centenum SW]
          Length = 294

 Score =  220 bits (561), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 102/280 (36%), Positives = 165/280 (58%), Gaps = 4/280 (1%)

Query: 15  IGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDT 74
           +GGF A+GGN  +L QPFE++I+ G  +G FV+ANP +V +D+ ++L E+F      Q  
Sbjct: 15  LGGFAALGGNLGVLWQPFEVLIICGGAVGAFVIANPSQVRRDTVLALRELFRGTRRKQGD 74

Query: 75  YCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMII 134
           Y D+L  LY ++   +       E  I+ P +S IF   P+VL +     F+ DY+R++ 
Sbjct: 75  YLDLLGALYTVLRMARTKGLLSLEKDIERPEDSQIFQQFPSVLGHERAMRFLTDYLRLMS 134

Query: 135 VGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQS 194
           +G  RS+E+E LM+EE+  +  E  +  HA+  + E LPA+GIV A+LG+IKAMG+++  
Sbjct: 135 LGADRSHEMEALMEEELSTLQKELQRVSHALHVVAEGLPALGIVAAVLGMIKAMGSIAAP 194

Query: 195 PKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIP 254
           P++LG  IG +L GT +G++LSY    PL       R ++ + +  +K  L AY++G+ P
Sbjct: 195 PEVLGHMIGGALVGTFMGVLLSYGFIGPLAGAAHRMRDEELKYFQCMKAGLTAYLHGSAP 254

Query: 255 QVAIEYGRKVLPLSERPSIEIVAQ----EVLQYNHNKKAS 290
            + +E+ RKVL    +PS   V +       +    +KA+
Sbjct: 255 AICVEHARKVLYSEVQPSFYDVEEVTTAAAARLTERQKAA 294


>gi|116620374|ref|YP_822530.1| chemotaxis protein [Candidatus Solibacter usitatus Ellin6076]
 gi|116223536|gb|ABJ82245.1| chemotaxis protein [Candidatus Solibacter usitatus Ellin6076]
          Length = 305

 Score =  220 bits (561), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 84/277 (30%), Positives = 157/277 (56%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  +IG+ +    +IGGF    GN Y+L+QP E++IV GA  G  ++ANP  VI      
Sbjct: 1   MHALIGIAVVFAAVIGGFLLERGNLYVLLQPAELLIVGGAAAGIVMVANPPAVIFRMWRG 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            L  F        ++   L++LY +   +++    E E+ ++DP  S IF + P  L + 
Sbjct: 61  TLAAFRPPPHNPQSFLRYLRMLYEIFCYIQRAGVVEFESDVEDPKGSRIFANHPDFLNDP 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+CD +RM++VG   + E++ LM+ +I+     + +P +++  + ++LP +GIV A
Sbjct: 121 MTCAFVCDSLRMLVVGVTTASELDQLMELDIEAQQRGRQEPVNSLHAVADALPGLGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG++  M  +  +P+ +G  +  +L GT LGI+L Y +  P+ +++++    + +L  +
Sbjct: 181 VLGVVITMQAIGGAPEAVGQKVAAALVGTFLGILLCYGVVGPVAARLQTLGETESQLLHV 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVA 277
           ++ A++A+  GA P +A EY R+ +P+  RPS + + 
Sbjct: 241 LRIAIVAFARGASPILAAEYARRSIPVDLRPSFQAME 277


>gi|238753169|ref|ZP_04614612.1| Lateral flagellar motor protein A (MotA-like) [Yersinia rohdei ATCC
           43380]
 gi|238708608|gb|EEQ00883.1| Lateral flagellar motor protein A (MotA-like) [Yersinia rohdei ATCC
           43380]
          Length = 525

 Score =  220 bits (560), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 84/282 (29%), Positives = 153/282 (54%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  + GL + ++C+IGG+   GG      QP EI+I+ G+G+G  ++ANP  V+K+    
Sbjct: 238 MQKLFGLVVIMVCVIGGYLMSGGIMSSFWQPGEIIIILGSGVGAMILANPSYVLKEMWHQ 297

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           ++ I        +    +L LLY L+  + +G     + HI+ P NS +F   P VL+++
Sbjct: 298 IIAITRKSEYTSEFQQQLLMLLYELLEMVDEGGLKRLDQHIEIPANSPLFQRYPLVLQDH 357

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L TFI D  R++ +G    +E+E ++++E+  +  E L P  +     E++P  GI  A
Sbjct: 358 HLVTFISDNFRLMAMGKINQHELEGILEQELSAVEEELLVPSRSFHRTAEAMPGFGICAA 417

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGII  M ++  S  ++G  +  +L GT LG+ + Y L +PL + ++    K+   +  
Sbjct: 418 VLGIIITMQSIDGSIALIGVKVAAALIGTFLGVFICYCLMDPLANAMEQAMKKKLAFFEC 477

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQ 282
           V+  L+ ++ G    +A++ GRK+LPL  +P+   +   + +
Sbjct: 478 VRMVLVNHVAGKPSLLAVDAGRKMLPLDSKPTFATLDSWINK 519


>gi|294013094|ref|YP_003546554.1| chemotaxis MotA protein [Sphingobium japonicum UT26S]
 gi|292676424|dbj|BAI97942.1| chemotaxis MotA protein [Sphingobium japonicum UT26S]
          Length = 287

 Score =  220 bits (560), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 87/280 (31%), Positives = 153/280 (54%), Gaps = 4/280 (1%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  IIGL + +  + GGF   GG+   ++   P E++I+ GA +G  ++ N    +K  G
Sbjct: 1   MFAIIGLVVLLAMVFGGFIFTGGDIGPVLHALPHEMIIIGGAAVGALIIGNSGSDLKALG 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
             L ++F      +  + D + L+  LM  L+       E HI+DP +STIF+  P ++ 
Sbjct: 61  GGLGKVFKGPKYKKQDFLDCIFLVSKLMKTLRVEGPVALEPHIEDPASSTIFSEYPRLMG 120

Query: 119 NNELTTFICDYMRMIIV--GNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIG 176
           +  L   I D +R+++V  G    + +E +MD  +    +E L+P   +  + ++LPA+G
Sbjct: 121 DKTLIHLISDTLRLVVVSSGTLDPHAVEEVMDNALKTHHHEALRPADNLQGLADALPALG 180

Query: 177 IVGAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHR 236
           IV A+LG++K MG++ Q P ILG  IG +L GT LG++L+Y + NP  ++ ++       
Sbjct: 181 IVAAVLGVVKTMGSIDQPPAILGGMIGSALVGTFLGVLLAYGMVNPFANRCRAVIEADGS 240

Query: 237 LYIIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIV 276
           +Y +VK+ ++A ++G    + IE  R  L  + +P+   V
Sbjct: 241 MYHVVKQIIVASLHGHPQPLVIEAARSSLTHANQPAFAEV 280


>gi|261341476|ref|ZP_05969334.1| chemotaxis MotA protein [Enterobacter cancerogenus ATCC 35316]
 gi|288316272|gb|EFC55210.1| chemotaxis MotA protein [Enterobacter cancerogenus ATCC 35316]
          Length = 287

 Score =  220 bits (560), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 85/286 (29%), Positives = 148/286 (51%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   +G+FI   C++GGF   GG      QP EI+I+ GAGLG  V+ANP  V+ +    
Sbjct: 1   MQKFLGIFIIFACVVGGFLMSGGRLASFWQPGEIIIILGAGLGAMVLANPKPVLAEMYRQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
              I        +    +L LL+ L+  ++ G     + HI+ P +S +F   P +L+N 
Sbjct: 61  FRGIMRKNEYTDEYQRQLLMLLFELLELVQDGGLKVLDEHIEVPESSPLFQKYPLILQNK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            + TFI D  R++ +G    +E+E ++++E+  +    L+P  ++    E++P  GI  A
Sbjct: 121 AIITFIADNFRLMAMGKINEHELEGILEQELVAMEENLLQPSRSLQRTAEAMPGFGICAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGII  M ++  S  ++G  +  +L GT LG+   Y L +P+ + ++    KQ  +   
Sbjct: 181 VLGIIITMQSIDGSIAVIGVKVAAALVGTFLGVFFCYCLMDPVANAMEQRTKKQMAVIEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHN 286
           V+  L+ ++ G    +A++ GRK+LPL  +P+   +   V Q    
Sbjct: 241 VRTVLVNHVAGKPTLLAVDAGRKMLPLDSKPTFATLDSWVNQMTGE 286


>gi|114797426|ref|YP_758984.1| flagellar motor protein MotA [Hyphomonas neptunium ATCC 15444]
 gi|114737600|gb|ABI75725.1| putative chemotaxis MotA protein [Hyphomonas neptunium ATCC 15444]
          Length = 288

 Score =  220 bits (560), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 91/289 (31%), Positives = 168/289 (58%), Gaps = 3/289 (1%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M+ I+GL +T++ + GG+   GG   I++   PFE++++ GA  G F+ +N    +K +G
Sbjct: 1   MNAILGLVVTMVMVFGGYMLAGGKLGIILHSLPFEMMMIGGAATGAFLASNDFGTVKHTG 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
             +   F      ++ Y D+L L++ L++ L K +  + E HI+ P  S++F   P +L+
Sbjct: 61  GDVAAAFTGPKWKKNDYQDLLLLMHELLHIL-KQNPVDIEPHIEAPNESSVFMKYPRILK 119

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           ++E    ICD +R +I+     +++E L+D+ ++ +L EKL   HA+  M ++LPA+GIV
Sbjct: 120 DHEAIEMICDTIRSMIMNFDNVHQVEELLDKHLESLLEEKLHGSHALQQMADALPALGIV 179

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG+IK M ++ + P++LG  IG +L GT LG+ L+Y +  P  +++K+ R ++H  Y
Sbjct: 180 AAVLGVIKTMASIDKPPEVLGGMIGGALVGTFLGVFLAYGVVGPFAARVKTIRSEEHLFY 239

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
            ++ + L++ ++     + +E  R+  P   RPS + V Q V       
Sbjct: 240 SMIGQVLVSNLHKNPVNICVEVARRQAPARVRPSFDEVEQAVRGLKQAA 288


>gi|13446370|gb|AAK20926.1| LafT [Aeromonas hydrophila]
          Length = 284

 Score =  220 bits (560), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 80/282 (28%), Positives = 148/282 (52%), Gaps = 1/282 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   IGL  +   +   F   GG P  L QP E++I+ GA +G   + N  +V+ +    
Sbjct: 1   MQKQIGL-GSFSFVCWCFMMAGGKPIALWQPAELIIIIGAAVGSMFLGNSKEVMHEMWRQ 59

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           + + F      ++ Y ++L L++ L+   +       + HI++P  S++F   P + E+ 
Sbjct: 60  MRQCFKSNKDEKEIYRELLTLMHQLLEETRNKGMKALDEHIENPQQSSVFLMYPQISEDP 119

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +L  FI D +R++ +G    +E++ ++++EI  I  + LKP HA+   GE+ P  GI+ A
Sbjct: 120 QLLGFIIDNLRLLGMGKITPHELDTMLEQEIMAIEEDMLKPAHALHKTGEACPGFGILAA 179

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++GII  M  L      +G  +  +L GT +GI L Y L  P+++ ++    ++  L + 
Sbjct: 180 VMGIIITMQQLDGPLSNIGVHVAAALVGTFIGIFLCYCLLEPISNAMEEMVKRRIGLLMC 239

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQ 282
           +K  LIA + G  P ++++ GRK+L   ++PS   + + V  
Sbjct: 240 IKSILIAQLRGKTPLISVDSGRKMLEPDDKPSFLELEEWVTN 281


>gi|87121903|ref|ZP_01077788.1| flagellar motor protein [Marinomonas sp. MED121]
 gi|86162701|gb|EAQ63981.1| flagellar motor protein [Marinomonas sp. MED121]
          Length = 278

 Score =  220 bits (560), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 91/278 (32%), Positives = 152/278 (54%)

Query: 7   LFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFG 66
           + I I  ++ G+ A  G    L QPFE++I+ G+ LG F++ANP  + K     L + F 
Sbjct: 1   MIIVIASVVTGYMASHGEMMALWQPFEVLIICGSALGAFMVANPWHLQKRILKLLPQAFL 60

Query: 67  YKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFI 126
                +  Y  ++ L+Y L +  ++      E+HI+ PY S +F S P +L + E+  FI
Sbjct: 61  GSRHNERYYMGLMALMYTLFFRSRQEGFLAIEDHIEAPYESELFQSFPDLLRDQEMVEFI 120

Query: 127 CDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIK 186
            D  R+ I+    ++E E ++D EI+ I  + + P HA++ + E+LP  GIV A+LGI+ 
Sbjct: 121 TDNYRIFILTGLPAHEFEAIIDAEIEKIAEDLVAPGHAVNKVAEALPGFGIVAAVLGIVI 180

Query: 187 AMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALI 246
            MG++    + +G  +  +L GT LG+  +Y    PL   ++     + + Y  VK +L+
Sbjct: 181 TMGSIGGPMEEIGYHVAAALVGTFLGVFFAYGFVGPLAGHLEGLGEHELKAYNAVKASLV 240

Query: 247 AYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYN 284
           + ++G  P  A+E GRK+LP  ERPS   +A+ V  Y 
Sbjct: 241 STVSGFSPGAAVETGRKLLPSEERPSFAELAEYVRTYR 278


>gi|58038612|ref|YP_190576.1| flagellar motor protein MotA [Gluconobacter oxydans 621H]
 gi|58001026|gb|AAW59920.1| Chemotaxis MotA protein [Gluconobacter oxydans 621H]
          Length = 288

 Score =  219 bits (558), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 93/276 (33%), Positives = 157/276 (56%), Gaps = 2/276 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  IIGL + + C+ G F A GG    L+   PFE++ + GA +G F+MAN L  +K   
Sbjct: 1   MFIIIGLVVVLGCVFGSFVASGGAIGPLVSSMPFELLTILGAAVGTFLMANSLGAVKHLP 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
             + +       G+  Y D+L LL+ +            E+HI+DP  ST+F + P + +
Sbjct: 61  AGIKKAMKGSQYGRADYVDLLSLLFHIAKLASSKGFMALESHIEDPQGSTVFGAFPKIRD 120

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           N  + +FICDY+RM  +     Y+++ +M  E+   + E++   HA+  + ++LPA+GIV
Sbjct: 121 NPHVCSFICDYLRMAGMNATDPYQMDEVMGNELKKNMREEMHLPHALQSVSDALPALGIV 180

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG+IK M ++S+ P +LG  I  +L GT LGI+L+Y +  P+ S++     ++    
Sbjct: 181 AAVLGVIKTMASISKPPIVLGEMIAGALVGTFLGILLAYGIVAPIASRLGGVVEEESSYL 240

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIE 274
            +V+  ++A++ G  PQV++E GRK +P    PS +
Sbjct: 241 DLVRSVIVAHLQGNAPQVSVEIGRKSIPSDLMPSFQ 276


>gi|148260893|ref|YP_001235020.1| flagellar motor protein MotA [Acidiphilium cryptum JF-5]
 gi|146402574|gb|ABQ31101.1| MotA/TolQ/ExbB proton channel [Acidiphilium cryptum JF-5]
          Length = 286

 Score =  219 bits (558), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 94/281 (33%), Positives = 159/281 (56%), Gaps = 2/281 (0%)

Query: 6   GLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLE 63
           G+   ++C+ G F   GG    L++  PFE++ + GA +G FV  N +  IK +     +
Sbjct: 3   GVAFLLVCVFGVFIVTGGAIGPLLKSMPFELITIGGAAVGTFVAGNSMHDIKHTLAGFKK 62

Query: 64  IFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELT 123
           +    A  +  Y D+L LL+ L+           E HI+ P  S +F   P +L+N E T
Sbjct: 63  VLRGGAFKKADYTDLLCLLFYLVRLAATRGAMALEPHIERPEESPVFKHFPAILKNEEAT 122

Query: 124 TFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILG 183
             ICDY+RM+ +     ++IE++M  E+   L E+L   H +  M + LPA+GIV A+LG
Sbjct: 123 AIICDYLRMVGMNADDPHQIEDVMARELRKTLAEELHGAHTLQTMADGLPALGIVAAVLG 182

Query: 184 IIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKK 243
           +IK M ++SQ P +LG  IG +LTGT LG++L+Y +  PL+ +++    +  R + +++ 
Sbjct: 183 VIKTMAHISQPPAVLGEMIGEALTGTFLGVLLAYGVVGPLSVRLRGVVEEDSRYFEVIRA 242

Query: 244 ALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYN 284
            L+A+++G  PQV++E GRK++P    P+ + + + V    
Sbjct: 243 VLVAHLHGNAPQVSVEVGRKMVPNLFMPTFQELEESVESLK 283


>gi|157959886|ref|YP_001499920.1| MotA/TolQ/ExbB proton channel [Shewanella pealeana ATCC 700345]
 gi|157844886|gb|ABV85385.1| MotA/TolQ/ExbB proton channel [Shewanella pealeana ATCC 700345]
          Length = 285

 Score =  219 bits (557), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 84/282 (29%), Positives = 151/282 (53%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           MS +IGL I +L + GG+   GG    L QP EI+I+ GAGLG  V+A P  V+      
Sbjct: 1   MSKLIGLVIILLSVFGGYMWAGGVLLALWQPAEILIIFGAGLGALVIATPKPVLIVMVEQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L EI   +    + Y  +  L+ +LM  ++       ++H++ P  S++F   P +LE+ 
Sbjct: 61  LKEILKVEKEDPELYPQLFGLMSMLMTQIQMQGLKVIDDHVEKPRESSLFLMYPAILEHP 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  F+ D +R+  +G    +++E++++EEI  I  + ++P HAI+ + E++P  GI+ A
Sbjct: 121 NVLNFLIDNLRLQSMGKISPHDLEHILEEEIHRIEEDSMRPSHAIAKIAEAMPGFGILAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++GII  M ++     ++G  +  +L GT +GI   Y L +P+   ++    ++      
Sbjct: 181 VMGIIITMSSIDGPITMIGVKVSAALVGTFIGIFACYCLFDPIAKALEHLVERKSAQLRC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQ 282
           V   L A+  G  P +AI+ GRK + +  RPS   + + + +
Sbjct: 241 VAAMLAAFAKGKPPMIAIDAGRKQIQIENRPSFIELERWLAE 282


>gi|159045800|ref|YP_001534594.1| flagellar motor protein MotA [Dinoroseobacter shibae DFL 12]
 gi|157913560|gb|ABV94993.1| chemotaxis protein MotA [Dinoroseobacter shibae DFL 12]
          Length = 289

 Score =  219 bits (557), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 82/272 (30%), Positives = 146/272 (53%), Gaps = 3/272 (1%)

Query: 18  FYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDTY 75
           + A GG   I+++  PFE+ ++ GA +G FV+ N +  IK +   + ++F         Y
Sbjct: 18  YLAAGGKMGIILKSLPFEMTMIGGAAVGAFVIGNDMSGIKHTLKDVKKVFKGPTWLAQDY 77

Query: 76  CDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMIIV 135
            D+L LL+ L+   ++      E HI+DP  S IF+  P ++ + E    I D MR   +
Sbjct: 78  KDLLCLLFELIRLARQNPV-GLEEHIEDPAASNIFSKYPKIMADREAIDLIADTMRSAAM 136

Query: 136 GNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQSP 195
                +++E ++++ I+      +   HA+  + + LPA+GIV A+LG+IK MG++ Q P
Sbjct: 137 NYDDPHQVEEVLEKRIESNHEHAMHGSHALQTVADGLPALGIVAAVLGVIKTMGSIDQPP 196

Query: 196 KILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIPQ 255
           +ILG  IG +L GT LG+ L+Y L  P ++++KS   +    Y+++++ L+A ++     
Sbjct: 197 EILGKLIGGALVGTFLGVFLAYGLVGPFSAKVKSVVEEDAHFYLLIREVLVANLHKHTVN 256

Query: 256 VAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
             IE GR+  P   RP+   + + + Q     
Sbjct: 257 NCIEVGRQNTPSHIRPTFSDLEEALKQLKQEA 288


>gi|116624959|ref|YP_827115.1| chemotaxis protein [Candidatus Solibacter usitatus Ellin6076]
 gi|116228121|gb|ABJ86830.1| chemotaxis protein [Candidatus Solibacter usitatus Ellin6076]
          Length = 291

 Score =  218 bits (555), Expect = 8e-55,   Method: Composition-based stats.
 Identities = 83/290 (28%), Positives = 146/290 (50%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M +IIG+ I +  I  G+    G   +L+QP E+VI+ GA +G  V+ANPL V+      
Sbjct: 1   MLSIIGIVIVLGAIAAGYMMEHGKFLVLLQPAELVIIFGAAIGTVVIANPLPVLTKIAKG 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L+ +F      +  Y + LK+LY L    +K    + E  +D+P    +    P  L  +
Sbjct: 61  LVAVFAGSPFTKARYLETLKMLYELFSLSRKAGTAKLEEEVDNPSKGQVLNKYPKFLAQH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+CD +RM + G     EI+++M+ ++D+   E  +P  A+S M ++LP +GIV A
Sbjct: 121 HALHFLCDTLRMAVTGGVDPLEIDSMMEADLDVHHKESAEPIAALSTMADALPGLGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG++  MG L    + +G  +  +L GT LGI+L Y +  PL   +        + Y++
Sbjct: 181 VLGVVLTMGALGGPKEAIGEKVAAALVGTFLGILLCYGIFGPLAVAMGKNAEADSQFYLV 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           ++ A + ++    P +A+E  R+ +P   RP+ + +             +
Sbjct: 241 LRMAALGFVKELSPMLAVELARRSIPAVVRPTFQEMEAACRGGGSVASKA 290


>gi|126734116|ref|ZP_01749863.1| chemotaxis MotA protein [Roseobacter sp. CCS2]
 gi|126716982|gb|EBA13846.1| chemotaxis MotA protein [Roseobacter sp. CCS2]
          Length = 289

 Score =  217 bits (554), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 79/272 (29%), Positives = 145/272 (53%), Gaps = 3/272 (1%)

Query: 18  FYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDTY 75
           +   GG   I+++  PFE++++ GA +G F ++N    IK +   L +I        + Y
Sbjct: 18  YLLAGGKMGIILKALPFEMLMICGAAIGAFAISNDGSAIKHTVKDLGKIVKGPKWKAEDY 77

Query: 76  CDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMIIV 135
            D+L +L+ L+   K       E+HI+ P  STIF   P +L++ E    ICD +R   +
Sbjct: 78  RDLLCMLFELLRVAKTNPV-ALESHIEAPDTSTIFGKYPKILDDAEAIALICDTLRSASM 136

Query: 136 GNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQSP 195
                +++E ++++ I+  L+ K+   HA+  + + LPA+GIV A+LG+IK M ++ Q P
Sbjct: 137 NYDDPHQVEEILEKRIEATLHHKMHSTHALQVVADGLPALGIVAAVLGVIKTMASIDQPP 196

Query: 196 KILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIPQ 255
           ++LG  IG +L GT LG+ L+Y    P   ++K+   +    + ++++ L+A +    P 
Sbjct: 197 EVLGKLIGGALVGTFLGVFLAYGFVGPFAVKVKAVVEEDAHFHQLIREVLVANLYAHAPN 256

Query: 256 VAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
           + +E GR+ +P   RPS   +   +     + 
Sbjct: 257 ICVEVGRQNMPGRYRPSFADMEDALKATKQDA 288


>gi|258622498|ref|ZP_05717520.1| chemotaxis LafT protein [Vibrio mimicus VM573]
 gi|258624679|ref|ZP_05719614.1| chemotaxis LafT protein [Vibrio mimicus VM603]
 gi|262173364|ref|ZP_06041041.1| Flagellar motor rotation protein MotA [Vibrio mimicus MB-451]
 gi|258583071|gb|EEW07885.1| chemotaxis LafT protein [Vibrio mimicus VM603]
 gi|258585198|gb|EEW09925.1| chemotaxis LafT protein [Vibrio mimicus VM573]
 gi|261890722|gb|EEY36709.1| Flagellar motor rotation protein MotA [Vibrio mimicus MB-451]
          Length = 285

 Score =  217 bits (554), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 81/285 (28%), Positives = 150/285 (52%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   +G  I +L + GG+   GG+   + QP EI+I+ GA LG  ++ NP +V+K++   
Sbjct: 1   MQKFLGAIIILLGVFGGYVWAGGSLSAIWQPAEILIIVGAALGSMIIGNPPQVLKETRRQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  I       +++Y +++ L+ +L+  ++ G     + HI++P  S IFT  P V  N 
Sbjct: 61  LTMIMSSTKDERESYMELMALMQVLLDTIRNGGFKALDKHIENPEESQIFTRYPLVTRNY 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L +FI D +R++ +G    +E+E L+++EI+ I  E L P  ++    E+LP  GI+ A
Sbjct: 121 RLVSFITDNLRLMAIGQMSPHELEGLLEQEIEAIQTELLLPSRSMQRTAEALPGFGILAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           + GII  M ++  S  ++G  +  +L GT +GI   Y   +P ++ +     +    +  
Sbjct: 181 VGGIIITMQSIDGSIVMVGYHVAAALVGTFIGIFGCYCCLDPASNAMAQRIRRDMSAFEF 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           V+  L+A++      +AI+ GRK + L  +P+   + + +     
Sbjct: 241 VRATLVAHVAKKPALLAIDSGRKHIQLDIKPTFNQMEKWLADQEG 285


>gi|308050007|ref|YP_003913573.1| MotA/TolQ/ExbB proton channel [Ferrimonas balearica DSM 9799]
 gi|307632197|gb|ADN76499.1| MotA/TolQ/ExbB proton channel [Ferrimonas balearica DSM 9799]
          Length = 285

 Score =  217 bits (552), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 84/285 (29%), Positives = 148/285 (51%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M    GL   I  + GGF    G    L QP E+VIV GA +G ++++NP+ V++D+   
Sbjct: 1   MLKFFGLLTVIASVFGGFLLAKGQLAALWQPAEVVIVMGAAIGSYIISNPMPVLRDTLAQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  I   +    + Y  +  L+  LM  ++       + HI+ P+ S+IF + P VL   
Sbjct: 61  LRGIVTSEKEDPELYPQLFGLMNTLMNQIRMNGLKVLDEHIEKPFESSIFLTYPAVLRQP 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L +F+ D +R+  +G   ++E ++LM+EEI  +  ++++P HA+   GE+LP  GI+ A
Sbjct: 121 MLLSFLVDNLRLQSMGKLTAHEFQHLMEEEIHRLQEDRMRPSHAMHRTGEALPGFGILAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++GII  MG +     ++G  +  +L GT +G+   Y L  P  S +     ++      
Sbjct: 181 VMGIIITMGAIDGPLTMIGVHVAAALVGTFMGVFACYCLFEPAASAMAHLIDRRIAQLHC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           VK  L+A   G  P +A++ GR+++    RPS   + + +++   
Sbjct: 241 VKAILVAQQAGKQPLLALDAGRRLIQEENRPSFLQLERYLVEEQR 285


>gi|157373191|ref|YP_001471791.1| MotA/TolQ/ExbB proton channel [Shewanella sediminis HAW-EB3]
 gi|157315565|gb|ABV34663.1| MotA/TolQ/ExbB proton channel [Shewanella sediminis HAW-EB3]
          Length = 285

 Score =  216 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 79/273 (28%), Positives = 144/273 (52%)

Query: 13  CIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQ 72
            + GG+   GGN   L QP EI+I+ GAG+G  ++ANP  V+ D    L E+   +    
Sbjct: 13  SVFGGYVWAGGNLSSLWQPAEILIIFGAGVGSLIIANPKAVLADMYAQLRELLSVEKEDP 72

Query: 73  DTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRM 132
           + Y  +  L+ +LM  ++       + H++ P  S++F   PTVLE+  +  F+ D +R+
Sbjct: 73  ELYPQLFGLMGMLMSQIQSQGLRVLDEHVEKPRESSLFLMYPTVLEHPNVLQFLIDNLRL 132

Query: 133 IIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLS 192
             +G    +++E++++EEI  I  ++L+P HA+  + E++P  GI+ A++GII  M N+ 
Sbjct: 133 QSIGKISPHDLEHILEEEIYRIEEDRLRPAHALGRIAEAMPGFGILAAVMGIIITMSNID 192

Query: 193 QSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGA 252
               ++G  +  +L GT +GI   Y L  P +  ++    ++      V   L A+  G 
Sbjct: 193 GPITMIGVKVAAALVGTFIGIFACYCLFEPTSKALEHLVERKSAQLRCVAAMLTAFAKGK 252

Query: 253 IPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
            P +AI+ GRK +    RP+   + + +++   
Sbjct: 253 PPMIAIDAGRKQIQSENRPTFIELERWMVEQKS 285


>gi|332187926|ref|ZP_08389659.1| hypothetical protein SUS17_3016 [Sphingomonas sp. S17]
 gi|332012087|gb|EGI54159.1| hypothetical protein SUS17_3016 [Sphingomonas sp. S17]
          Length = 287

 Score =  216 bits (550), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 88/280 (31%), Positives = 149/280 (53%), Gaps = 4/280 (1%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M   IGL I +  + GGF   GG    +    P E++I+ GA +G  V+ N  K +K  G
Sbjct: 1   MFPAIGLVILLGMVFGGFAITGGQLGPVFHAIPHEMLIIGGAAVGALVIGNSGKELKALG 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
            ++ +IF      +  Y DV+ L+  LM  L+       E H++DP +S++F   P ++ 
Sbjct: 61  GAMGKIFKGPKYKKQDYLDVIFLVSKLMKMLRTEGPIALEPHVEDPKSSSVFAEYPRLVA 120

Query: 119 NNELTTFICDYMRMIIV--GNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIG 176
           ++ L   I D +R+++V  G    + +E +MD  I    +E   P   +  + +SLPA+G
Sbjct: 121 DHTLVNLIADTLRLVVVSSGTLDVHAVEEVMDNAIKTHHHEVEGPQGTLQSLADSLPALG 180

Query: 177 IVGAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHR 236
           IV A+LGI+K MG++ + P +LG  IG +L GT +G++L+Y + NP   ++K        
Sbjct: 181 IVAAVLGIVKTMGSIDKPPSVLGGMIGSALVGTFMGVLLAYGIVNPFAGRLKQVIDADAA 240

Query: 237 LYIIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIV 276
           +Y +VK+ +IA ++G    + IE  R  +   ++P    V
Sbjct: 241 IYHVVKQIIIASLHGHPQPLVIEAARSGIAHKDQPGFAEV 280


>gi|296122829|ref|YP_003630607.1| MotA/TolQ/ExbB proton channel [Planctomyces limnophilus DSM 3776]
 gi|296015169|gb|ADG68408.1| MotA/TolQ/ExbB proton channel [Planctomyces limnophilus DSM 3776]
          Length = 287

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 77/287 (26%), Positives = 144/287 (50%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  IIG  +   C++GG+   GG+   LI P E++ + GA LG  ++    K++KD   S
Sbjct: 1   MFVIIGFIVVTGCVLGGYTWAGGHVEALIHPSEVLTIGGASLGAMLVMGSPKILKDLIKS 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           ++         +  Y D+ KL Y L+   +K      E H++DP+ S IF+  P + +++
Sbjct: 61  IIGALKGSPFNKKAYGDLFKLSYDLLKTARKDGLLALEPHLNDPHESKIFSKYPRLQKDH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
             TTF+CD +  ++  +    ++ +L+ ++I ++  E  +    ++   +++P  GIV A
Sbjct: 121 HFTTFLCDGLSSVVEASMSQEQLHDLLQKQIAVMEEEHHQAVGILAKSADAMPGFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGI+  MG +    + +G  +G +L GT LGI+ SY    PL +++      +   Y  
Sbjct: 181 VLGIVITMGAIDGPVEEIGHKVGAALVGTFLGILASYGFMAPLAARMDLLGKSEMDFYRT 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
               + A + GA P+  IE  R+V+    RP    + + + + +   
Sbjct: 241 TAAIIEAAIGGAAPKQIIEQARRVVCSEARPERVELEKMLKEADAAA 287


>gi|188592086|ref|YP_001796684.1| mota: chemotaxis protein; proton conductor component of motor,
           torque generator [Cupriavidus taiwanensis LMG 19424]
 gi|170938460|emb|CAP63447.1| MotA: chemotaxis protein; proton conductor component of motor,
           torque generator [Cupriavidus taiwanensis LMG 19424]
          Length = 287

 Score =  214 bits (544), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 98/268 (36%), Positives = 156/268 (58%)

Query: 18  FYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDTYCD 77
           +   GG+   L QP E+VI+AGA +G F+  N  K IK +  +L  +F      ++ Y D
Sbjct: 18  YAMTGGHMGALYQPAEVVIIAGAAIGAFIATNTGKAIKATARALPGLFKSSKYKKELYLD 77

Query: 78  VLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMIIVGN 137
           V+ LLY+L+   ++      E  I DP  S++F+  P +L +  +  F+ DY+RM++ GN
Sbjct: 78  VMSLLYVLLSKARREGILFLEKEIADPAASSVFSQYPRILSDPVVMEFLTDYLRMMVNGN 137

Query: 138 ARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQSPKI 197
             ++EIE LMD EI+   +E   P HA+S +G+ LPA GIV A++G++ A+G+    P  
Sbjct: 138 MNAFEIEALMDHEIETFRHEAEIPAHALSRVGDGLPAFGIVAAVMGVVHALGSADLPPAE 197

Query: 198 LGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIPQVA 257
           LG  I  ++ GT LGI+L+Y   +PL ++I+    +  ++Y  +K  L+A +NG  P VA
Sbjct: 198 LGALIAHAMVGTFLGILLAYGFISPLAARIELQVSENVKVYECIKVVLLASLNGYAPLVA 257

Query: 258 IEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           +E+GRKVL  + RPS   +   V +   
Sbjct: 258 VEFGRKVLYSTVRPSFLELDDHVREVKS 285


>gi|71906361|ref|YP_283948.1| chemotaxis motA protein [Dechloromonas aromatica RCB]
 gi|71845982|gb|AAZ45478.1| chemotaxis motA protein [Dechloromonas aromatica RCB]
          Length = 285

 Score =  213 bits (543), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 92/281 (32%), Positives = 155/281 (55%), Gaps = 1/281 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G  I +   +G +    G+   L  P E V + G  +G FV AN +KVIK +  +
Sbjct: 1   MFLIVGYVIILAAALGTYAI-HGSLLALWVPTEYVAIVGLTIGYFVAANNIKVIKATVAA 59

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  I       +  Y D L +L+ ++  ++K      E  I++P  S IF+  P ++ ++
Sbjct: 60  VPGILKGSKFNKAFYIDTLAMLFEILAKVRKEGLMSIEGDIENPDASPIFSKYPNLVHDH 119

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  F+ DY+RM++ GN  + EIE+LMD E++   +E  +P H +S +  ++PA GIV A
Sbjct: 120 HIMEFVTDYLRMMVGGNLNTVEIESLMDVELETHHHEAAEPGHVVSSIAGAVPAFGIVVA 179

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  MG++   P +LG  IG +L GT LGI++SY    P+   ++    +   +Y  
Sbjct: 180 VMGVVNVMGSVGSPPAVLGKMIGGALVGTFLGILISYGFVEPVAKLMEQKANEGSTIYKC 239

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
           +K  L+A M+G  PQVAIE+GRK +    RP    + +E+ 
Sbjct: 240 IKMVLLASMSGYAPQVAIEFGRKTIDSGSRPGFVELEEELK 280


>gi|149908743|ref|ZP_01897404.1| flagellar motor protein [Moritella sp. PE36]
 gi|149808285|gb|EDM68224.1| flagellar motor protein [Moritella sp. PE36]
          Length = 285

 Score =  213 bits (543), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 81/281 (28%), Positives = 151/281 (53%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   +GL + +LC+ GGF   GG   ++ QP E++I+ GAG+G  ++ANP  V+ +    
Sbjct: 1   MQKFVGLGVILLCVFGGFILAGGKLAVMWQPAELMIILGAGIGSMLIANPKYVLVELKNQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
               F  +A   +   ++L +++ LM  ++       + HI++   S++F     +  + 
Sbjct: 61  FFASFKKEADRGEVMKELLLVMHTLMEMVRNKGLKSIDEHIENWETSSLFLQYEHIHSDR 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FI D  RM+ +G   S+E+E++++ EI+ +  + LKP  A+   GE++P  GI+ A
Sbjct: 121 LLMHFITDNFRMMSMGKMSSHELEHVLESEIEALEDDLLKPSEALHTTGEAMPGFGILAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++GII  M +L     ++G  +G +L GT LGI   Y L  P+   + +    Q  L   
Sbjct: 181 VMGIIITMSSLDGPLMMIGLHVGAALVGTFLGIFFCYCLFEPIGESLAARVHNQLLLLTC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
           VK  ++A+++G  P ++++ GRK++    +P+   + Q + 
Sbjct: 241 VKTMMVAHISGKSPVLSVDSGRKLIDREIKPTFVEMEQWLN 281


>gi|115523170|ref|YP_780081.1| flagellar motor protein MotA [Rhodopseudomonas palustris BisA53]
 gi|115517117|gb|ABJ05101.1| chemotaxis protein [Rhodopseudomonas palustris BisA53]
          Length = 283

 Score =  213 bits (542), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 135/270 (50%), Positives = 190/270 (70%)

Query: 21  MGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDTYCDVLK 80
           MGG+  ++ QP+E VI+ G  LG +++ANP KV+ DSG ++++        Q  Y D+L 
Sbjct: 1   MGGHIGVIWQPWEFVIICGMALGTYIVANPWKVVLDSGTAVVQALTMAVPKQRHYLDLLG 60

Query: 81  LLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMIIVGNARS 140
           LL+ LM  ++   RNE E HIDDP +S IF + PTVL N  LT F+ DY R++++G+AR 
Sbjct: 61  LLHALMREVRNKGRNEVEAHIDDPASSEIFQNFPTVLANASLTGFVSDYFRLLVMGSARP 120

Query: 141 YEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQSPKILGT 200
           +EIE LMDEEI  I+  K+KPY ++  + E LPA+GIV A+LG+IKAMG L QSPK+LG 
Sbjct: 121 HEIEALMDEEIQTIVRSKMKPYSSMMMVAEGLPALGIVAAVLGVIKAMGALDQSPKLLGG 180

Query: 201 AIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIPQVAIEY 260
            IG +L GT  GI LSYSL  PL +++K+ R +Q RLY+IVK+ L+A+MNGA+PQ+AIE+
Sbjct: 181 FIGSALVGTFAGIFLSYSLVAPLAAKVKAVREQQCRLYVIVKQTLLAFMNGALPQIAIEH 240

Query: 261 GRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           GRK++  +ERPSI++V  E +     K A+
Sbjct: 241 GRKMIGPNERPSIDVVESETISGGPAKAAA 270


>gi|149184215|ref|ZP_01862533.1| flagellar motor protein MotA [Erythrobacter sp. SD-21]
 gi|148831535|gb|EDL49968.1| flagellar motor protein MotA [Erythrobacter sp. SD-21]
          Length = 287

 Score =  212 bits (541), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 93/285 (32%), Positives = 161/285 (56%), Gaps = 4/285 (1%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILI--QPFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  +IG+F+ ++ + GGF   GG+   ++   PFE++I+ GA +G  V  N L  +K  G
Sbjct: 1   MYAVIGIFVLLVMVFGGFVLSGGSLGPVLVAMPFEMLIIGGAAIGALVAGNSLDGLKALG 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
            ++ +IF      +  + D + L   LM  LK       E+H+DDP NST+F+  P +L+
Sbjct: 61  GAMGKIFKGPQHTKQDHIDAIALTTQLMRMLKNEGPVALESHLDDPANSTVFSEYPNLLK 120

Query: 119 NNELTTFICDYMRMIIV--GNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIG 176
           N  L   ICD + +I+V  G   ++ +E +MD  +    +E  +P H +  + ++LPA+G
Sbjct: 121 NKPLVALICDTLTLIVVSSGTLETHAVEEVMDNAMKTHFHEMHEPQHNLQTLSDALPALG 180

Query: 177 IVGAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHR 236
           IV A+LG++K MG++ Q P+ILG  IG +L GT LG++L+Y +  PL  ++K    +  +
Sbjct: 181 IVAAVLGVVKTMGSIDQPPEILGKMIGAALVGTFLGVLLAYGIVGPLAGRLKQVLEQDEQ 240

Query: 237 LYIIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
           ++  VK+ +IA ++G    + +E  R  L  + RP +  +   + 
Sbjct: 241 IFHAVKQVIIASLHGHPQPLVVESARSGLGHNVRPGLNELLDALR 285


>gi|296531731|ref|ZP_06894558.1| chemotaxis protein MotA [Roseomonas cervicalis ATCC 49957]
 gi|296267939|gb|EFH13739.1| chemotaxis protein MotA [Roseomonas cervicalis ATCC 49957]
          Length = 297

 Score =  212 bits (540), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 85/289 (29%), Positives = 161/289 (55%), Gaps = 2/289 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQP--FEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  I+G+    + + GG+   GG   +++     E++I+ G+G    ++   + ++  + 
Sbjct: 1   MIQIVGILGVFVAVFGGYLIAGGKMGVILGALGPELMIIGGSGFMTLLIGGDMALVTKTM 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
            S  ++F   +  +  + D+L LLY+L+   +K    + E HI+ P  S IF+  P +L 
Sbjct: 61  KSFGKVFKGPSWNRKDFSDLLCLLYLLLRTHQKEGAAKLEKHIEKPEASAIFSRYPRLLR 120

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           +  L+  ICD +R I + N   + +  +M+  I+    E +KP  AI  M ++ PA+GIV
Sbjct: 121 DPALSGLICDTLRTITLNNKDPHRVGEMMETAIEKRHSENIKPAKAIQTMADAFPALGIV 180

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG+IKAMG +S+SP++LG  IG +L GT LG+ LSY L  P++ ++K    ++ ++ 
Sbjct: 181 AAVLGVIKAMGAISESPEVLGRMIGAALVGTFLGVFLSYGLVGPMSGRLKLILEEERKML 240

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
            + +  + +Y+    PQ+ +E GR+ +P   +PS + + +++ +    K
Sbjct: 241 DVTRAVITSYLENLSPQICVEVGRQSVPSKLQPSFDQMEEQLREAGRVK 289


>gi|4928700|gb|AAD33690.1|AF136403_2 RpmA [Pseudomonas aeruginosa]
          Length = 283

 Score =  212 bits (540), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 89/274 (32%), Positives = 148/274 (54%), Gaps = 3/274 (1%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           MS IIG+ +    ++GGF   GG    +IQPFE++I+ GA LG F+ +NP          
Sbjct: 1   MSKIIGIIVVFASVLGGFLLSGGKIGAIIQPFEVLIIGGAALGAFLQSNPGSTFMVVLKK 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
             ++F  +   Q  Y +VL +LY ++   ++      E  I+DP  S IF+  P VL++ 
Sbjct: 61  APKMFSNR-FTQTYYLEVLGMLYEILNKSRREGMMAIEADIEDPAASPIFSKYPGVLKDE 119

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +T ++CDY+R++  GN   +E+E L D E+  +  +   P HA++ + ++LP  GIV A
Sbjct: 120 RMTAYVCDYLRIMSSGNMAPHELEGLFDMELSSLKEDLEHPSHAVTKVADALPGFGIVAA 179

Query: 181 ILGIIKAMGNL-SQSPKILGTAI-GVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
           +LGI+  M     +    +G  +      GT LGI+ +Y    PL   ++    ++  L+
Sbjct: 180 VLGIVITMAFAWRRQQAEIGHHVRRRPWWGTFLGILAAYGFVGPLAGALEHDAKEELNLF 239

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPS 272
             +K  L+A  +G  P +A+E+GRKVL  + RP+
Sbjct: 240 EAIKACLVASASGMPPSLAVEFGRKVLLPAHRPT 273


>gi|114571063|ref|YP_757743.1| flagellar motor protein MotA [Maricaulis maris MCS10]
 gi|114341525|gb|ABI66805.1| MotA/TolQ/ExbB proton channel [Maricaulis maris MCS10]
          Length = 290

 Score =  212 bits (539), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 81/270 (30%), Positives = 152/270 (56%), Gaps = 2/270 (0%)

Query: 20  AMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDTYCD 77
             GG+  ++++  PFE++++ GA +G F++ N  K +  +   L ++F         Y D
Sbjct: 20  LAGGHFDVIMKALPFEMMMIGGAAVGAFLIGNKPKTVFKTLGDLSKVFTGPKWKGQDYTD 79

Query: 78  VLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMIIVGN 137
           +L LL++L   +K       E+HI++P  STIFT  P +++++    FICD +RM+ +  
Sbjct: 80  LLSLLFLLTKTMKTKGVIALESHIENPTESTIFTRFPRIMKDHFAVDFICDTLRMMTMNL 139

Query: 138 ARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQSPKI 197
              +++E+ M+++++   +E   P HA+  M + LPA+GIV A+LG+IK MG +   P +
Sbjct: 140 EDPHQVEDAMEKQLEKHHHEAADPAHAMQTMADGLPALGIVAAVLGVIKTMGAIESPPAV 199

Query: 198 LGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIPQVA 257
           LG  IG +L GT LG+ ++Y    P  + +++   ++H  Y I++  L+A+++G   Q++
Sbjct: 200 LGGYIGGALVGTFLGVFIAYGFVGPFAAYMQAVYDEEHSFYKIIQDVLVAHLHGNAAQIS 259

Query: 258 IEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
           +E GR  +P   +PS   +   +       
Sbjct: 260 VEIGRGGVPSKMQPSFSELETALDAIPAEA 289


>gi|315121853|ref|YP_004062342.1| flagellar motor protein MotA [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495255|gb|ADR51854.1| flagellar motor protein MotA [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 270

 Score =  211 bits (537), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 218/270 (80%), Positives = 249/270 (92%)

Query: 21  MGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDTYCDVLK 80
           MGGN  ILIQPFEI+IV+GAGLGGF+MAN LKVIKDSGV++LEIFGYK++ ++ YCD+LK
Sbjct: 1   MGGNLSILIQPFEIIIVSGAGLGGFIMANSLKVIKDSGVAILEIFGYKSIEKEIYCDILK 60

Query: 81  LLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMIIVGNARS 140
           ++Y+LMY+LKK SR E ENHIDDP+NS+IFTSIPT+L NNELTTFICDY RM+I+GNA+S
Sbjct: 61  IMYVLMYSLKKISRTELENHIDDPHNSSIFTSIPTILSNNELTTFICDYFRMVIIGNAQS 120

Query: 141 YEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQSPKILGT 200
           +EIE LMDEEI+IILYEKLKPYHAIS+MGES PAIGIVGAILGIIKAMGNLSQSPKILG 
Sbjct: 121 HEIETLMDEEIEIILYEKLKPYHAISNMGESFPAIGIVGAILGIIKAMGNLSQSPKILGV 180

Query: 201 AIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIPQVAIEY 260
           AIG SLTGT+LGI+LSY +CNPLTSQI S RL+QHRLYIIVKK LIAYMNGAIPQVAIEY
Sbjct: 181 AIGASLTGTMLGILLSYCICNPLTSQIHSIRLRQHRLYIIVKKTLIAYMNGAIPQVAIEY 240

Query: 261 GRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           GRKVLPL ERPSIEIV QEVL+Y+++KK S
Sbjct: 241 GRKVLPLFERPSIEIVEQEVLRYSNHKKES 270


>gi|146305233|ref|YP_001185698.1| flagellar motor protein MotA [Pseudomonas mendocina ymp]
 gi|145573434|gb|ABP82966.1| MotA/TolQ/ExbB proton channel [Pseudomonas mendocina ymp]
          Length = 290

 Score =  211 bits (536), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 85/290 (29%), Positives = 159/290 (54%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++G  I + C++GG+    G   +L QP E+VI+ GAGLG  V+ NP +V+ +    
Sbjct: 1   MQKLLGALIIVGCVLGGYVMAHGELAMLWQPAEVVIIVGAGLGALVVGNPKEVLVEMCQQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  +F YK  G++    +L LLY L+  ++ G     + HI++P  S +F   P + +  
Sbjct: 61  IKGVFVYKRRGEEFQRQLLMLLYELLEMVEVGGLKVLDAHIEEPEQSELFAKYPLIRQEK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FI D  R++ +G   ++E+E  +++E++ + +  L+P  ++  +GE++P  GI+ A
Sbjct: 121 NLMAFIADNFRLMAMGKISAHELEGFLEQELEAMEHILLQPSRSLHKIGEAMPGFGILAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           I+GII  MGN+  S   +G  +  +L GT LGI + Y +  PL++ +      +      
Sbjct: 181 IMGIIITMGNIGGSVAEIGAHVAAALVGTFLGIFMCYCVMEPLSNAMSQRIKTELSALEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           V+  L+A++ G    +A++ GRK++    +P+ + +   V +Y   + A+
Sbjct: 241 VRTTLVAHVAGKPTLLAVDAGRKLIEQDVKPAFKQLETWVNRYEDERDAA 290


>gi|310659035|ref|YP_003936756.1| ytxd [Clostridium sticklandii DSM 519]
 gi|308825813|emb|CBH21851.1| YtxD [Clostridium sticklandii]
          Length = 260

 Score =  211 bits (536), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 55/270 (20%), Positives = 110/270 (40%), Gaps = 23/270 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           +STIIG+   ++ II      G +    + P  I+IV G  L   ++A P+  +KD    
Sbjct: 3   LSTIIGIVSGLILIIVSIMLNG-SIGAFLDPASIMIVVGGTLAATLVAFPIPQVKDIIKL 61

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
             + F  +         ++  +  L    +K      E   +                  
Sbjct: 62  TQKTFANRDSNPS---KIINDIITLANKARKEGLLSLEEATEALD--------------- 103

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   + +++ G      + NL++ E+D I             M  + P  G++G 
Sbjct: 104 --DEFLKKGLMLVVDG-TDPELVRNLLETELDFIEQRHKAGQGLFESMATAAPGFGMIGT 160

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G+I  +G+L   P  +G ++ V+L  TL G +++     P+ +++K    ++     I
Sbjct: 161 LIGLINMLGSLDD-PSTIGPSMSVALITTLYGSLIANLFFTPMANKLKVKSGEEILEREI 219

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSER 270
           + + L++   G  P++  E  +  LP S R
Sbjct: 220 MVEGLLSIQAGENPRIIEEKLKAFLPPSMR 249


>gi|323703349|ref|ZP_08114999.1| MotA/TolQ/ExbB proton channel [Desulfotomaculum nigrificans DSM
           574]
 gi|323531712|gb|EGB21601.1| MotA/TolQ/ExbB proton channel [Desulfotomaculum nigrificans DSM
           574]
          Length = 259

 Score =  210 bits (534), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 52/279 (18%), Positives = 110/279 (39%), Gaps = 22/279 (7%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           + T  G+   ++C++GGF   GG P  L+QP   +IV G  +G  V+A     +      
Sbjct: 3   IMTPAGILFAVICLVGGFILEGGEPQALLQPTAFMIVFGGTIGATVVAFSTSEVLSLPKL 62

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +      K      + + + L+  L    ++      ++ +D                  
Sbjct: 63  IKTAITKKLP---DFQETINLIVDLAEKARREGLLYLDSQLDTID--------------- 104

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   M++++ G      + ++++ EI           +     G   P +GI+G 
Sbjct: 105 --DPFLRKAMQLVVDG-TDPEMVRSILETEIYSAYERHQVGVNIFEAAGGYAPTMGIIGT 161

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  + NLS  P  LG AI ++   TL G+  +     P+  ++K+   K+  L  +
Sbjct: 162 VMGLVHVLANLSD-PDSLGPAIAMAFIATLYGVSSANIFWLPIGGKLKNLSKKELLLREM 220

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQE 279
           + + ++A   G  P +  E     +  +   +     + 
Sbjct: 221 MIEGILALQAGYNPIIIRERLNAFIKPNPNTAQTEEEEA 259


>gi|34498444|ref|NP_902659.1| flagellar motor protein MotA [Chromobacterium violaceum ATCC 12472]
 gi|34104299|gb|AAQ60658.1| chemotaxis lafT protein [Chromobacterium violaceum ATCC 12472]
          Length = 288

 Score =  210 bits (534), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 82/287 (28%), Positives = 154/287 (53%), Gaps = 3/287 (1%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  + G+ I ++C+ GGF   GG   I+ QP E++I+ GA LG  V+ NP  V+K+ G  
Sbjct: 1   MQQLFGILIVLVCVFGGFMLHGGVLSIIWQPTELLIICGAALGAVVLGNPPHVLKEMGGQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  +   K  G +     L L+Y L+    +      + H++ P  S +F   P VLEN 
Sbjct: 61  IKRVVVRKKQGAEFQRQQLLLMYELLITASR-GLKALDQHVEAPRQSPLFNRYPMVLENR 119

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +L  FI D  R++ +G   ++E+E ++D+E+D I  + ++P  ++  + E++P  GI+ A
Sbjct: 120 KLLAFIVDNFRLMAMGKINAHELEGVLDQELDAIHEQLMQPSKSLHKIAEAMPGFGILAA 179

Query: 181 ILGIIKAMGNLSQSPK--ILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
           +LGI+ AM  ++Q      +  ++  ++ GT +GI   Y + +PL++ +     ++   +
Sbjct: 180 VLGIVMAMNTVAQGASAGEIAASVAAAMVGTFIGIFFCYGVLDPLSNVMHQLVKEELSNF 239

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
             VK  L  +++G  P +AI+ GR+++ L+ +PS   +   +     
Sbjct: 240 ESVKVVLTTHVSGKPPLLAIDAGRRLVQLNTKPSFSQLESWINAMEG 286


>gi|120597322|ref|YP_961896.1| MotA/TolQ/ExbB proton channel [Shewanella sp. W3-18-1]
 gi|146294533|ref|YP_001184957.1| MotA/TolQ/ExbB proton channel [Shewanella putrefaciens CN-32]
 gi|120557415|gb|ABM23342.1| MotA/TolQ/ExbB proton channel [Shewanella sp. W3-18-1]
 gi|145566223|gb|ABP77158.1| MotA/TolQ/ExbB proton channel [Shewanella putrefaciens CN-32]
          Length = 285

 Score =  209 bits (533), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 83/281 (29%), Positives = 149/281 (53%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           MS ++GL I +  + GG+   GG    L QP EI+I+ GAG+G  ++ANP  V+K+    
Sbjct: 1   MSKLVGLLIILASVFGGYAWAGGALAALWQPAEILIIMGAGVGALIIANPQSVLKEMLEQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L E+F       + Y  +  L+  LM  ++       + H+++P  S+IF   P VL++ 
Sbjct: 61  LKELFNKGKEDPELYPQLFPLMGTLMAQIQSQGLKVLDEHLENPQQSSIFLMYPAVLKHP 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  F+ D +R+  +G    +++E++++EEI  I  ++L+P  A S +GE++P  GI+ A
Sbjct: 121 NVLQFLIDNLRVQSIGKISPHDLEHILEEEIHRIEEDRLRPSEAFSKVGEAMPGFGILAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGII  M N+     ++G  +  +L GT +GI   Y   +P+   ++    ++      
Sbjct: 181 VLGIIITMSNIDGPITMIGVKVAAALVGTFIGIFACYCFFDPMAKALEHLVDRKSAQLRC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
           +   L+ +  G  P +AI+ GRK +    RPS   + + + 
Sbjct: 241 IAAILVTFSKGKPPMMAIDAGRKQIQSENRPSFIELERWME 281


>gi|310816841|ref|YP_003964805.1| flagellar motor protein MotA [Ketogulonicigenium vulgare Y25]
 gi|308755576|gb|ADO43505.1| flagellar motor protein MotA [Ketogulonicigenium vulgare Y25]
          Length = 288

 Score =  209 bits (532), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 82/275 (29%), Positives = 152/275 (55%), Gaps = 6/275 (2%)

Query: 18  FYAMGGNPYILI--QPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDTY 75
           +   GG   I+I   PFE++I+ GA +G F++AN + ++K +  +L  +F       + Y
Sbjct: 18  YLLSGGKMGIVIAALPFEMMIIFGAAVGAFLLANSIGIVKATLKALPLVFRGARWKANDY 77

Query: 76  CDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMIIV 135
            D+L LL+ L+   +  +    E HI+ P  S+IF   P +L ++E  + ICD +R   +
Sbjct: 78  RDLLVLLFELIRLAR-ANPVALEEHIEQPRASSIFAQYPRILADHEAVSLICDTLRAAGM 136

Query: 136 GNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQSP 195
                 ++E ++++ ++   +  L+P HA+  M + LPA+GIV A+LG+IK M ++ + P
Sbjct: 137 NYDDPMQVEEVLEKRLEASRHHALQPVHALQTMADGLPALGIVAAVLGVIKTMSSIDEPP 196

Query: 196 KILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIPQ 255
            +LG  IG +L GT LG+ L+Y    P+ ++++S   +    Y ++++ L+A +    P 
Sbjct: 197 AVLGKMIGGALVGTFLGVFLAYGFVGPMAARLQSICDEDAHFYQLIREVLVANLYQHAPP 256

Query: 256 VAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           + IE GR+  P + RP    +    +    +K+A+
Sbjct: 257 LCIEVGRQSTPENLRPGFADLE---MVLKASKEAA 288


>gi|303248926|ref|ZP_07335173.1| chemotaxis protein MotA [Desulfovibrio fructosovorans JJ]
 gi|302489649|gb|EFL49585.1| chemotaxis protein MotA [Desulfovibrio fructosovorans JJ]
          Length = 288

 Score =  209 bits (532), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 91/287 (31%), Positives = 161/287 (56%), Gaps = 2/287 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  IIG+ I I CI+ GF    GN  +L+   P E++++ G  LG  V++ P  V+  + 
Sbjct: 1   MFAIIGILIVIGCILAGFILEKGNFDLLLSAAPPEMLMIGGGALGQLVLSAPKDVLGATF 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
              L IFG     +  Y ++L  L  L   +++      E  ++ P  S IF++     +
Sbjct: 61  KGALSIFGGMTTSKAYYLELLTTLSGLYMKIRREGLVAIEKDVERPAESPIFSNFAKNKK 120

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           N+E+ TFICD MR+    N  ++E E++MD +I+  ++E+L P HAIS   ++LP +GIV
Sbjct: 121 NHEVLTFICDTMRIFSTVNIEAHEFESIMDADIEATVHEELVPSHAISKTADALPGLGIV 180

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
             +LG++  MG +++  ++LG +IG +L GT LG++++Y    P+ + I+    +   + 
Sbjct: 181 ACVLGVVLTMGKINEPAEVLGHSIGAALVGTFLGVLMAYGFVAPIATNIEHRAKETEAIL 240

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           +  K +L A++ G  P VA+E GR+ +P+ +RP+ E + + +     
Sbjct: 241 LTAKASLTAFVGGNPPPVALEAGRRAIPIHKRPTFEELEEAIKISKG 287


>gi|239908608|ref|YP_002955350.1| chemotaxis protein MotA [Desulfovibrio magneticus RS-1]
 gi|239798475|dbj|BAH77464.1| chemotaxis protein MotA [Desulfovibrio magneticus RS-1]
          Length = 288

 Score =  209 bits (532), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 86/287 (29%), Positives = 159/287 (55%), Gaps = 2/287 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  I+G  I + CI+ GF    GN  +++   P E++++AG  LG FV+++P  V+  + 
Sbjct: 1   MFVILGTIIVLGCILSGFILEKGNFDLILSAAPPELLMIAGGALGAFVISSPKDVLSHTI 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
            S+  +FG     +  Y  +L  L  L   +++      E  ++ P  S IF+      +
Sbjct: 61  KSVFTVFGGMVTSKAYYTTLLVTLSGLYMKIRREGLVAIEKDVERPAESPIFSDFAKNKK 120

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           N+E+  FICD MR+    N  ++E +N+MD +I+   +E L P H+I  + + LPA+GIV
Sbjct: 121 NHEVLLFICDTMRIFSTVNIEAHEFDNIMDADIEATAHELLIPSHSIGKIADGLPALGIV 180

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
             +LG++  MG L++  ++LG +IG +L GT +G++L+Y    P+ + ++    +   + 
Sbjct: 181 ACVLGVVITMGKLNEPAEVLGHSIGAALVGTFMGVLLAYGFVAPIATNLEFRAKEIEHIL 240

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           ++ K +L +++ G  P VA+E GR+ +P+  RP+ E + + +     
Sbjct: 241 LVAKASLGSFVGGNPPPVALEAGRRAIPIHYRPTFEQLEEAIKASKG 287


>gi|283851001|ref|ZP_06368286.1| chemotaxis protein [Desulfovibrio sp. FW1012B]
 gi|283573647|gb|EFC21622.1| chemotaxis protein [Desulfovibrio sp. FW1012B]
          Length = 288

 Score =  209 bits (531), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 88/287 (30%), Positives = 160/287 (55%), Gaps = 2/287 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  I+G+ I + CI+ GF    GN  +++   P E++++ G  LG  V+++P  V+  + 
Sbjct: 1   MFAILGVVIVLGCILAGFIMEKGNFDLILSAAPPELLMIGGGALGALVLSSPKDVLGATF 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
              L IFG     +  Y ++L  L  L   +++      E  ++ P  S IF++     +
Sbjct: 61  KGALSIFGGMITSKAYYLELLTTLSGLYMKIRREGLVAIEKDVERPAESPIFSNFAKNKK 120

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           N+E+ TFICD MR+    N  ++E E +MD +I+  ++E L P H+I+ + ++LP +GIV
Sbjct: 121 NHEVLTFICDTMRIFSTVNIEAHEFETIMDADIEATVHEALIPAHSIAKVADALPGLGIV 180

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
             +LG++  MG +++  ++LG +IG +L GT LG++ +Y    P+ + I+    +   + 
Sbjct: 181 ACVLGVVLTMGKINEPAEVLGHSIGAALVGTFLGVLGAYGFVAPVATNIEYRAKETEAIL 240

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           +  K +L A++ G  P VA+E GR+ +P+ +RPS E + Q +     
Sbjct: 241 LTAKASLTAFVGGNPPPVALEAGRRAIPIHKRPSFEELEQAIKASKG 287


>gi|330501120|ref|YP_004377989.1| flagellar motor protein MotA [Pseudomonas mendocina NK-01]
 gi|328915406|gb|AEB56237.1| flagellar motor protein MotA [Pseudomonas mendocina NK-01]
          Length = 290

 Score =  209 bits (531), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 83/290 (28%), Positives = 157/290 (54%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++G  I + C++GG+    G   +L QP E++I+ GAG G  V+ANP  V+ +    
Sbjct: 1   MQKLLGALIIVACVLGGYVMAHGELAMLWQPAEVIIIVGAGFGALVVANPKDVLLEMLHQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  +F YK  G++    +L +LY L+  +  G     + HI++P  S +F   P + +  
Sbjct: 61  IKGVFVYKKRGEEFQRQLLMMLYELLEMVDVGGLKVLDAHIEEPEQSDLFAKYPLIRQEK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FI D  R++ +G   ++E+E  +++E++ + +  ++P  ++  +GE++P  GI+ A
Sbjct: 121 NLMAFIADNFRLMAMGKISAHELEGFLEQELEAMEHVLMQPSRSLHKIGEAMPGFGILAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ILGI+  MGN+  S   +G  +  +L GT LGI + Y +  PL+S +      +      
Sbjct: 181 ILGIVITMGNIGGSVAEIGAHVAAALVGTFLGIFMCYCVMEPLSSAMGQRIKTEMSALEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           V+  L+A++ G    +A++ GRK++    +P+ + +   V +Y   + A+
Sbjct: 241 VRTTLVAHVAGKPTLLAVDAGRKLIEQDVKPAFKQLEIWVNRYEDERDAA 290


>gi|311067882|ref|YP_003972805.1| flagellar motor protein MotA [Bacillus atrophaeus 1942]
 gi|310868399|gb|ADP31874.1| flagellar motor protein MotA [Bacillus atrophaeus 1942]
          Length = 271

 Score =  209 bits (531), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 57/289 (19%), Positives = 119/289 (41%), Gaps = 21/289 (7%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
           ++IIG+ +  + +  G    G +   L  P  I+I+    +   V+A P + IK      
Sbjct: 4   TSIIGIILAFVALSVGMVMKGVSLSALANPAAILIIIFGTISAVVIAFPSREIKKVPTLF 63

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
             +F  K   Q T   ++ +        ++      E  I++                  
Sbjct: 64  RVLF--KENKQLTVEQLIPMFSDWAQIARREGLLALEASIEEVD---------------- 105

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
              F+ + + M + G + +  I ++M EE++ +           +  G   P +G++GA+
Sbjct: 106 -DAFLKNGLSMAVDGQS-AEFIRDIMTEEVEAMEERHQTGASIFTQAGTYAPTLGVLGAV 163

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           +G+I A+ ++  +   LG AI  +   TLLGI   Y L +P  +++K    ++ +L  I+
Sbjct: 164 VGLIAALSHM-DNTDELGHAISAAFVATLLGIFTGYVLWHPFANKLKRKSKQEVKLREIM 222

Query: 242 KKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
            + +++ + G  P+V  +     LP  +R        E       ++ +
Sbjct: 223 IEGVLSVLEGQAPKVIEQKLLMYLPAKDRAKFAAQEGEAENGEKKEEEA 271


>gi|188586028|ref|YP_001917573.1| MotA/TolQ/ExbB proton channel [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|179350715|gb|ACB84985.1| MotA/TolQ/ExbB proton channel [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 266

 Score =  208 bits (530), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 48/286 (16%), Positives = 112/286 (39%), Gaps = 23/286 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++TIIGL   +  +IG  +  G N  I       +IV G  +   +++ P+        +
Sbjct: 3   IATIIGLIAGVFLLIGAVFLEG-NVDIFFNIPSALIVIGGTVAATLISYPINQFFSIVKT 61

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +   F  K++      + + LL  L    ++      E                      
Sbjct: 62  VQNAFKVKSMNP---TETINLLVNLAEKARREGLLALE-----------------DDVEE 101

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   +++++ G      + ++++ E+           +    MG   PA G+ G 
Sbjct: 102 MDDDFLKKGVQLVVDG-TDPELVRSILETELSFQEERHKIGQNIFRTMGTFSPAFGMSGT 160

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  + +L   P  +G  + ++L  TL G++ +  +  P+ ++++     +  L  +
Sbjct: 161 LIGLVSMLDDLDD-PDAIGPGMALALLTTLYGVVAANLIFLPIANKLEVKSNDEILLKEV 219

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHN 286
           + + +++   G  P++  E  +  L    R  I    +EV+  N  
Sbjct: 220 MLEGMLSIQAGENPRIVEEKLKAFLAPKSRDEIAEEDEEVVDANAE 265


>gi|254228818|ref|ZP_04922241.1| Flagellar motor component [Vibrio sp. Ex25]
 gi|262396463|ref|YP_003288316.1| Flagellar motor rotation protein MotA [Vibrio sp. Ex25]
 gi|151938765|gb|EDN57600.1| Flagellar motor component [Vibrio sp. Ex25]
 gi|262340057|gb|ACY53851.1| Flagellar motor rotation protein MotA [Vibrio sp. Ex25]
          Length = 267

 Score =  208 bits (530), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 72/267 (26%), Positives = 135/267 (50%)

Query: 19  YAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDTYCDV 78
              GGN   + QP E +I+ GA  G  ++ NP  V+K+    +           + Y ++
Sbjct: 1   MWAGGNLGAIWQPAEFLIIIGAAAGSLIIGNPPHVLKEMRRQVPATIKGPTEEHEYYMEL 60

Query: 79  LKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMIIVGNA 138
           + LL  L+   +       ++HI+ P  S++F + PT+ E++ L +FI D +R++ +G  
Sbjct: 61  MALLNNLLETARNRGYKFLDSHIESPEQSSMFLAYPTIAEDHRLISFITDNLRLMAMGQM 120

Query: 139 RSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQSPKIL 198
             +E+E L+++EI+ I  E L P  ++    E+LP  GI+ A+ GII  M  +  S  ++
Sbjct: 121 SPHELEGLLEQEIEAIQNEMLLPSRSLQRTAEALPGFGILAAVGGIIITMQAIDGSIAMI 180

Query: 199 GTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIPQVAI 258
           G  +  +L GT +GI   Y   +PL++ +     +    +  V+  L+AY+      +AI
Sbjct: 181 GYHVAAALVGTFIGIFGCYCGLDPLSNAMAQRVKRNMTAFECVRATLVAYVAKKPTLLAI 240

Query: 259 EYGRKVLPLSERPSIEIVAQEVLQYNH 285
           + GRK + L  +P+   + + + +   
Sbjct: 241 DAGRKHIQLDIKPTFNQMEKWLAEQEG 267


>gi|56551499|ref|YP_162338.1| flagellar motor protein MotA [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241761143|ref|ZP_04759232.1| flagellar motor protein MotA [Zymomonas mobilis subsp. mobilis ATCC
           10988]
 gi|260752894|ref|YP_003225787.1| flagellar motor protein MotA [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|56543073|gb|AAV89227.1| flagellar motor protein MotA [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241374762|gb|EER64223.1| flagellar motor protein MotA [Zymomonas mobilis subsp. mobilis ATCC
           10988]
 gi|258552257|gb|ACV75203.1| chemotaxis MotA protein [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
          Length = 287

 Score =  208 bits (530), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 79/279 (28%), Positives = 144/279 (51%), Gaps = 4/279 (1%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M   IG  I ++ + GGF   GG+   +++  P E++++ GA +G  V  N +  +K   
Sbjct: 1   MFAAIGFTILLVMVFGGFAITGGHLGPVLEAIPHELIVIGGASVGSVVAGNSMLELKLLL 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
                +F      ++ Y + + L+  LM  L+       E+H+++P +S  F   P +L 
Sbjct: 61  GGFKSVFKGPKFNKEDYQNTIFLVGKLMRTLRTEGPVALESHVENPESSAFFAEYPKLLT 120

Query: 119 NNELTTFICDYMRMIIV--GNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIG 176
           +  L + I D +R+++V  G      +E+++D  I     E   P   + ++ E+LPA G
Sbjct: 121 DKTLVSLITDTLRLVVVSSGTLDPNAVEDVIDNTIKTHHSETSLPADILQNLSEALPAFG 180

Query: 177 IVGAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHR 236
           IV A+LG++K MG++ Q P ILG  IG +L GT LG++L+Y +  P+ ++ ++       
Sbjct: 181 IVAAVLGVVKTMGSIDQPPPILGAMIGSALVGTFLGVLLAYGIVAPMANRCRAVIDSDAH 240

Query: 237 LYIIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEI 275
           +Y ++K+ +I+ M G    + IE  R  +P   +P    
Sbjct: 241 IYQVIKQMIISSMQGHPLPLVIEAARSDIPEENKPEFAE 279


>gi|134300282|ref|YP_001113778.1| MotA/TolQ/ExbB proton channel [Desulfotomaculum reducens MI-1]
 gi|134052982|gb|ABO50953.1| MotA/TolQ/ExbB proton channel [Desulfotomaculum reducens MI-1]
          Length = 260

 Score =  207 bits (528), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 56/279 (20%), Positives = 112/279 (40%), Gaps = 24/279 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           + T  G+    +C+I GF   GG+   L+ P   +IV G  LG  V+A   K +    + 
Sbjct: 3   IMTPAGILFAAVCLISGFLLEGGHVSALLAPTAFIIVVGGTLGATVVAFSTKEVLSVPIL 62

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L      K      + + + L+  L    ++      ++ +D                  
Sbjct: 63  LKTAMTKKVP---DFSETINLIVELAEKARREGLLYLDSQLDTIE--------------- 104

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   M++++ G      + ++++ E+           H     G   P +GI+G 
Sbjct: 105 --DPFLRKAMQLVVDG-TDPEMVRSILETEVYSAYERHQVGVHIFEGAGGYAPTMGIIGT 161

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  +GNLS  P  LG AI ++   TL G+  +     P+ +++K+   K+  L  +
Sbjct: 162 VMGLVHVLGNLSD-PDSLGPAIAMAFIATLYGVGSANVFWLPIGAKLKNLSKKELVLREM 220

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSE--RPSIEIVA 277
           + + ++A   G  P +  E     +   E  +P  +   
Sbjct: 221 MIEGILALQAGYNPTIIRERLNAFIKPGESKQPQADEGE 259


>gi|148554181|ref|YP_001261763.1| flagellar motor protein MotA [Sphingomonas wittichii RW1]
 gi|148499371|gb|ABQ67625.1| Flagellar motor component-like protein [Sphingomonas wittichii RW1]
          Length = 287

 Score =  207 bits (528), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 90/280 (32%), Positives = 151/280 (53%), Gaps = 4/280 (1%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M   IGL I    + GGF   GG+   ++   P E++I+ GA LG  V  N +K +K  G
Sbjct: 1   MFAGIGLVILFAMVFGGFAFTGGDLEPVLHAIPHEMLIIGGAALGAVVAGNSMKELKALG 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
               ++F     G+  Y DV+ L+  LM  L+       E HI+DP  ST+F   P +L+
Sbjct: 61  GGFAKVFKGPKYGKKDYLDVIFLVSTLMKKLRTEGPVALEPHIEDPKGSTLFAEYPKLLK 120

Query: 119 NNELTTFICDYMRMII--VGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIG 176
           ++ L   I D +R+++   G      +E++MD  +    ++++KP  A+ ++ +SLPA+G
Sbjct: 121 DDTLIHMITDTLRLVVISSGTLDPMAVEDVMDNALKTHHHDEIKPADAMQNLADSLPALG 180

Query: 177 IVGAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHR 236
           IV A+LG++K MG++ + P ILG  IG +L GT LG++L+Y +  P   + +        
Sbjct: 181 IVAAVLGVVKTMGSIDKPPAILGAMIGSALVGTFLGVLLAYGIVGPFAGRCRQVIEADGA 240

Query: 237 LYIIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIV 276
           +Y +VK+ +IA ++G    + IE  R  +    +P+   V
Sbjct: 241 IYGVVKQIIIASLHGHPLPLVIEAARSGITHVNQPAFADV 280


>gi|327478800|gb|AEA82110.1| flagellar motor protein MotA [Pseudomonas stutzeri DSM 4166]
          Length = 290

 Score =  207 bits (528), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 86/290 (29%), Positives = 159/290 (54%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++G FI I C++GG+    G+  +L QP E+VI+ GA LG  V+ NP +V+ +    
Sbjct: 1   MQKVLGAFIIIGCVLGGYAMANGDMRVLWQPAEVVIILGAALGSLVVGNPKEVLIEMLHQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  +F Y+  G++    +L LLY L+  +  G     ++HI++P  S +F   P +L+  
Sbjct: 61  IKGVFAYQRRGEEFQRQLLMLLYELLEMVDVGGLKVLDSHIEEPEQSDLFVRYPLILQEK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FI D  R++ +G   ++E+E  +++E++ + +  ++P  ++  +GE++P  GI+ A
Sbjct: 121 NLMAFIADNFRLMAMGKITAHELEGFLEQELEAMEHALMQPSRSLFKIGEAMPGFGILAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           I+GII  MG++  S   +G  +  +L GT LGI   Y L  PL++ +      +      
Sbjct: 181 IMGIIITMGSIGGSVAEIGAHVAAALVGTFLGIFFCYCLMEPLSNAMGQRVKTELSALEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           V+  L+A++ G    +A++ GRK++    +P+   +   V QY   + A+
Sbjct: 241 VRTTLVAHLAGKPTLLAVDAGRKLIEQDVKPAFRQLEVWVNQYEEERDAA 290


>gi|256830502|ref|YP_003159230.1| MotA/TolQ/ExbB proton channel [Desulfomicrobium baculatum DSM 4028]
 gi|256579678|gb|ACU90814.1| MotA/TolQ/ExbB proton channel [Desulfomicrobium baculatum DSM 4028]
          Length = 251

 Score =  207 bits (527), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 48/271 (17%), Positives = 117/271 (43%), Gaps = 25/271 (9%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++TIIG+ +    +I     +GG+ ++ +    ++IV G  +G  ++  PL+ +      
Sbjct: 3   LATIIGILVAFGLVIAA---LGGDGFLFLDFSSLLIVIGGTIGAVLVTYPLESVLGVARI 59

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           + + F  KA   D    ++         +++      E H+ +                 
Sbjct: 60  IKKTFMSKA---DDPTALIAQFSDYATRVRREGILSLEAHLKNI---------------- 100

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   +++ + G      I+ +M+ EI  +    LK    +   G   PA+G++G 
Sbjct: 101 -PDDFLRKGLQLTVDG-LDPQLIQEIMETEISCLEERHLKGAEILQTFGNLAPAMGMIGT 158

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  +  ++  P  +G A+ V+L  T  G +++  +  P+  ++++   ++  +  +
Sbjct: 159 VIGLVLMLKRMND-PSTIGPAMAVALLTTFYGAVMANLIFIPMAGKLRARSREEVLVRSM 217

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERP 271
           + + +++   G  P++  E     LP  ER 
Sbjct: 218 IVEGIMSISRGENPRILEEKLNSYLPPKERK 248


>gi|125974910|ref|YP_001038820.1| MotA/TolQ/ExbB proton channel [Clostridium thermocellum ATCC 27405]
 gi|256003833|ref|ZP_05428820.1| MotA/TolQ/ExbB proton channel [Clostridium thermocellum DSM 2360]
 gi|281418624|ref|ZP_06249643.1| MotA/TolQ/ExbB proton channel [Clostridium thermocellum JW20]
 gi|125715135|gb|ABN53627.1| MotA/TolQ/ExbB proton channel [Clostridium thermocellum ATCC 27405]
 gi|255992171|gb|EEU02266.1| MotA/TolQ/ExbB proton channel [Clostridium thermocellum DSM 2360]
 gi|281407708|gb|EFB37967.1| MotA/TolQ/ExbB proton channel [Clostridium thermocellum JW20]
 gi|316939121|gb|ADU73155.1| MotA/TolQ/ExbB proton channel [Clostridium thermocellum DSM 1313]
          Length = 279

 Score =  207 bits (527), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 49/281 (17%), Positives = 117/281 (41%), Gaps = 23/281 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++TIIGL + ++C+I      G +         ++I  G GL   +++  +         
Sbjct: 3   LATIIGLILGVICVIWSIMLDG-SLLSFWDFASVIITLGGGLCATLVSCKITEFAKIMKV 61

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            +++   K          +++L  L    ++      E+  ++  N              
Sbjct: 62  TVKVLRGKEPRPQD---TIRMLVELSLKARREGLLSLESEQENIDN-------------- 104

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   +++++ G      I + MD E++ +     K       M    PA G++G 
Sbjct: 105 ---DFLKQSLQLVVDG-VEPEVIVDTMDLELENMKARHDKGVSLFKTMAAQFPAWGMIGT 160

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G+IK + +L   P  +G+A+ V+L  T  G IL+  +CNP+ +++     ++ +   +
Sbjct: 161 LIGLIKLLESLDD-PSKIGSAMAVALVTTFYGSILANLICNPIATKLAEKSKEEIQEKKM 219

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
           + + +++   G  P++     +  L   ++   + +A +  
Sbjct: 220 IIEGVLSIQAGENPRILEHKLKTFLSPKQKLEYDKMANQAA 260


>gi|86356305|ref|YP_468197.1| flagellar motor protein MotA [Rhizobium etli CFN 42]
 gi|86280407|gb|ABC89470.1| chemotaxis motility protein [Rhizobium etli CFN 42]
          Length = 244

 Score =  207 bits (526), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 144/244 (59%), Positives = 187/244 (76%)

Query: 47  MANPLKVIKDSGVSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYN 106
           MANP+KV+KDSG +L E F +    +  Y D L +LY LM +L+  SRNE E HID+P  
Sbjct: 1   MANPMKVVKDSGKALAEAFKHAVPKERNYLDTLGVLYSLMRDLRTKSRNEIEAHIDNPAE 60

Query: 107 STIFTSIPTVLENNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAIS 166
           STIF   PTVL+N ELT FICDY+R+II+GNARS+EIE LMDEE++ I+++K+KPYHAI 
Sbjct: 61  STIFQQAPTVLKNKELTAFICDYVRLIIIGNARSHEIEALMDEELNTIMHDKMKPYHAIQ 120

Query: 167 HMGESLPAIGIVGAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQ 226
            MG+S PAIGIV A+LG+IKAM +++ SP++LG  IG +L GT LGI+LSY +C+PL SQ
Sbjct: 121 IMGDSFPAIGIVAAVLGVIKAMAHINDSPEVLGHLIGSALVGTFLGILLSYCVCSPLVSQ 180

Query: 227 IKSTRLKQHRLYIIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHN 286
           IK  R KQHRLY+IVK+ L+AYMNG++PQVA+EYGRK +   ERPSI+ V QE++     
Sbjct: 181 IKVVRNKQHRLYVIVKQTLLAYMNGSVPQVALEYGRKTISAYERPSIDAVEQEMMNPGGE 240

Query: 287 KKAS 290
            KA+
Sbjct: 241 NKAA 244


>gi|89100892|ref|ZP_01173741.1| flagellar motor protein [Bacillus sp. NRRL B-14911]
 gi|89084379|gb|EAR63531.1| flagellar motor protein [Bacillus sp. NRRL B-14911]
          Length = 264

 Score =  207 bits (526), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 58/280 (20%), Positives = 122/280 (43%), Gaps = 22/280 (7%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
           S++IG+ + I+ +  G    G +P  L+ P  I+I+    +    +A P+  +K      
Sbjct: 4   SSLIGVILAIIGVGVGMVLKGVHPSALVNPAAILIIIVGTIAAVTIAFPMNELKKVPKLF 63

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
             +F  K   Q    +++++        +K      E   ++                  
Sbjct: 64  GILF--KERKQMVPAELIRMFSEWAQLARKEGLLALEAKTNEIE---------------- 105

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
              F+ + + + + G + +  I +++ EEI+ +    L      +  G   P +G++GA+
Sbjct: 106 -DPFLKNGLSLAVDGQS-ADYIRDVLSEEIESMEERHLSGAAIFTQAGTYAPTLGVLGAV 163

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           +G+I A+G+++ +   LG AI  +   TLLGI   Y L +P  +++K    ++ +L  ++
Sbjct: 164 VGLIAALGDMT-NTDALGHAISAAFVATLLGIFTGYVLWHPFANKLKRKSKQESKLKYMM 222

Query: 242 KKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
            + +++ + G  P+V  +     LP  ER        EV 
Sbjct: 223 IEGVLSILEGEAPRVIEQKLASYLPSGERKQFLE-ESEVK 261


>gi|258592513|emb|CBE68822.1| Chemotaxis protein [NC10 bacterium 'Dutch sediment']
          Length = 288

 Score =  207 bits (526), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 81/271 (29%), Positives = 146/271 (53%), Gaps = 2/271 (0%)

Query: 20  AMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDTYCDVL 79
             GG   +LIQP E +I+ GA +GG ++A PLKV+K     ++ I     L +  Y +VL
Sbjct: 20  IEGGPIPVLIQPVEFLIIGGASIGGLLIAVPLKVLKILISQVMGIL-GSGLDKQAYLEVL 78

Query: 80  KLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMIIVGNAR 139
           ++++ L    K+      ++ +  P  S IF+   T  + +    F+CD +R+++ G   
Sbjct: 79  QVMHDLFTKAKREGFTAIDSDLASPDKSPIFSKYNTFTKQHHAMNFLCDSLRLVVDGAVD 138

Query: 140 SYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQSPKILG 199
             E++ +MD E+D    E  +    ++ +G+SLP +GIV A+LGI+  M  +   P+ +G
Sbjct: 139 PEELDAIMDIELDTHHEEGGQVPSILAKVGDSLPGLGIVAAVLGIVITMQAIDGPPEEIG 198

Query: 200 TAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIPQVAIE 259
             + V+L GT +GI+ SY +  PL+  ++     + +    +K  L+A+  GA P +A+E
Sbjct: 199 HKVAVALVGTFVGILASYGVVQPLSQSLEHQAQCEGKYLACIKTCLVAFARGAPPIIAVE 258

Query: 260 YGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           +GR+V+   +RPS + +          K+A+
Sbjct: 259 FGRRVIFSYDRPSNQEMESACK-GTPLKRAA 288


>gi|153956380|ref|YP_001397145.1| hypothetical protein CKL_3789 [Clostridium kluyveri DSM 555]
 gi|219856693|ref|YP_002473815.1| hypothetical protein CKR_3350 [Clostridium kluyveri NBRC 12016]
 gi|146349238|gb|EDK35774.1| MotA [Clostridium kluyveri DSM 555]
 gi|219570417|dbj|BAH08401.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 264

 Score =  207 bits (526), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 54/277 (19%), Positives = 110/277 (39%), Gaps = 20/277 (7%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           +S I+ L   +L + GGF   GG+   L+ P   +IV G  +G   ++ PL ++K     
Sbjct: 3   ISVILFLIFGLLALGGGFILDGGHLSALLGPTAAMIVFGGTIGAVGVSFPLDLLKRIPKM 62

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  +       +     ++     + Y  +K      E  I                 + 
Sbjct: 63  VKVMISPP---KTELPSLISYFKDVSYRTRKNGLLSLEGEIS---------------SDP 104

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FI   +++++ G      + ++++ E++       +        G   P +GIVG 
Sbjct: 105 NLDPFIKKGLQLVVDG-VDPQAVRSILELELESTSERHRQGAAVFQSAGGYSPTMGIVGT 163

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  +GNL + P  LG  I V+   TL GI  +  +  P+ +++     K+ +   +
Sbjct: 164 VMGLVHVLGNL-EDPSTLGPKIAVAFLATLYGIGAANLIWLPIANRLNVLDDKEVKEKTL 222

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVA 277
           + + ++    G  P    E  +  L   E    E + 
Sbjct: 223 IVEGILYIQEGINPNTIAEKLKSFLNKEELVRFEEMD 259


>gi|269792935|ref|YP_003317839.1| MotA/TolQ/ExbB proton channel [Thermanaerovibrio acidaminovorans
           DSM 6589]
 gi|269100570|gb|ACZ19557.1| MotA/TolQ/ExbB proton channel [Thermanaerovibrio acidaminovorans
           DSM 6589]
          Length = 262

 Score =  206 bits (525), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 51/273 (18%), Positives = 109/273 (39%), Gaps = 23/273 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++++IG  + ++ +IGG    GG+P   +    ++I  G  LG  +MANP++  K     
Sbjct: 3   LASVIGFLLALILVIGG-ILAGGDPGAFVDAPSLLITGGGTLGAAIMANPIERTKALPKI 61

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           + + F            +++ L       +       E                      
Sbjct: 62  IRKAFFN---DPIDLPGLIQTLVSFAEKARWEGLLALEEDAAQLD--------------- 103

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   +++++ G      +++++D EI ++             M E  PA G++G 
Sbjct: 104 --DPFLKKSIQLVVDG-TDPELVKSILDTEIGLLEERHGAGKAYFDTMAELAPAFGMLGT 160

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G+I  +GNL   P  LG  +  +L  T  G  ++  LC P + ++     ++     +
Sbjct: 161 LIGLILMLGNLDD-PDALGPGMATALITTFYGSFIANVLCIPTSKKLAYRSSQEVLAREL 219

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSI 273
           + + ++A   G  P++  E  +  L    R  +
Sbjct: 220 MVEGILAIQAGENPRIVEEKLKVFLSPDLRAKM 252


>gi|209965967|ref|YP_002298882.1| chemotaxis MotA protein [Rhodospirillum centenum SW]
 gi|209959433|gb|ACJ00070.1| chemotaxis MotA protein [Rhodospirillum centenum SW]
          Length = 286

 Score =  206 bits (524), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 97/282 (34%), Positives = 167/282 (59%), Gaps = 2/282 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M   IGLF    C+ GG+   GG   I+++  P E++I+ G+ +  F++AN   VIK S 
Sbjct: 1   MFPAIGLFGVFFCVFGGYIIFGGKIGIIVEALPKEVMIIGGSAVASFLIANSSHVIKKSM 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
             +  IFG     +  Y ++L LLY ++  +K       E HI+ P  S IF + P++++
Sbjct: 61  ADIKRIFGGARFHKKEYMELLSLLYQILKTMKTKGVLAIEQHIEKPMESNIFNAYPSIMK 120

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           +     FI DY+RM  +G    +E+E+LM++EI+   +E L   HA+  M +++PA+GIV
Sbjct: 121 DPFTIKFIADYLRMFSIGVDNPHEMESLMEQEIEKAKHEDLHSSHALQTMADAMPALGIV 180

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG+IK M ++++ P++LG  IG +L GT +GI LSY +  P+ S++K+   ++ + Y
Sbjct: 181 AAVLGVIKTMASINEPPEVLGKLIGGALVGTFMGIFLSYCIVAPIASRLKAITEEEMQFY 240

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEV 280
           ++++ A+ A++ G  PQV+IE  RK +P    P    + + +
Sbjct: 241 MVIQAAITAHLAGYAPQVSIEAARKKVPSDYMPDFNELEEAL 282


>gi|296282271|ref|ZP_06860269.1| flagellar motor protein MotA [Citromicrobium bathyomarinum JL354]
          Length = 287

 Score =  206 bits (524), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 87/285 (30%), Positives = 161/285 (56%), Gaps = 4/285 (1%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  IIG+ I ++ + GGF   GG    ++   P+E++I+ GA +G  +  N L  +K  G
Sbjct: 1   MYAIIGIVILLVLVFGGFVISGGAMGPVLHALPYEMMIIGGAAVGATIAGNSLAHLKAIG 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
            + ++IF      +  + D + L   LM  LK       E+H+++P NSTIF++ P +++
Sbjct: 61  GAFMKIFKGPQHDKQDHIDAIALTTQLMKVLKTDGPVALESHVNEPENSTIFSAYPNLMK 120

Query: 119 NNELTTFICDYMRMIIV--GNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIG 176
           N+ L + I D + +++V  G   ++ +E +MD  +    +E  +P HA+  + ++LPA+G
Sbjct: 121 NHALISLISDTLTLLVVSSGTLETHAVEEVMDNAMKTHFHELHEPQHALQTLADALPALG 180

Query: 177 IVGAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHR 236
           IV A+LG++K M ++ + P+ILG  IG +L GT LG++L+Y +  PL +++K    +  +
Sbjct: 181 IVAAVLGVVKTMSSIDKPPEILGEMIGSALVGTFLGVLLAYGMVGPLATRLKQVIEQDEQ 240

Query: 237 LYIIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
           ++  VK+ +IA + G    + +E  R  L  + RP +  +   + 
Sbjct: 241 IFHAVKQVIIASLYGHPQPLVVESARSSLGHTVRPGLTELLDALR 285


>gi|85710172|ref|ZP_01041237.1| flagellar motor protein [Erythrobacter sp. NAP1]
 gi|85688882|gb|EAQ28886.1| flagellar motor protein [Erythrobacter sp. NAP1]
          Length = 287

 Score =  205 bits (521), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 84/285 (29%), Positives = 154/285 (54%), Gaps = 4/285 (1%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILI--QPFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M   IG+ + I+ + GGF   GG    ++   P E++++ GA +G  ++ N +  IK  G
Sbjct: 1   MFAAIGIIVLIVMVFGGFTLAGGALGPILAALPLEMMMIGGAAIGAVLIGNSMHEIKLLG 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
             + ++F       + + D + L   LM  L+       E+H+ DP NS IF+  P +  
Sbjct: 61  KGVAKVFKGPKFTNEDHIDAIALTSKLMKVLRSDGAVALESHVTDPANSAIFSEYPRLQS 120

Query: 119 NNELTTFICDYMRMIIV--GNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIG 176
           +  +   ICD + +++V  G+  ++ IE+++D  I   L+E  +P H I  + ++ PA+G
Sbjct: 121 DPVVVDMICDPLTLMVVSSGSLDTHAIEDVIDNAIKTQLHEMEEPAHTIQSLADAFPALG 180

Query: 177 IVGAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHR 236
           IV A+LG+IK MG + Q P+ILG  IG +L GT LG++L+Y    P+ S++K       +
Sbjct: 181 IVAAVLGVIKTMGAIDQPPEILGKMIGAALVGTFLGVLLAYGFAGPMASRLKQVNTHDQQ 240

Query: 237 LYIIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
           ++  +K+ +++ ++G    + +E  R  LP + RP +  +   + 
Sbjct: 241 IFHSIKQVIVSSLHGYPQPLVLEAARSGLPPAHRPKLTDLLDTMR 285


>gi|162147456|ref|YP_001601917.1| flagellar motor protein MotA [Gluconacetobacter diazotrophicus PAl
           5]
 gi|209545565|ref|YP_002277794.1| flagellar motor protein MotA [Gluconacetobacter diazotrophicus PAl
           5]
 gi|161786033|emb|CAP55615.1| putative chemotaxis protein motA (Motility protein A)
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|209533242|gb|ACI53179.1| putative chemotaxis protein MotA (motility protein A)
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 293

 Score =  205 bits (521), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 91/288 (31%), Positives = 155/288 (53%), Gaps = 2/288 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M  I GL   +LC+   F A GG    LI   PFE++ + GA +G FVM N  + +K   
Sbjct: 1   MLFIGGLVFVLLCVFASFVASGGALAPLIMSMPFELLTILGAAVGIFVMGNSKEALKHVP 60

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
             L  +       +  Y D+L LLY  M   +       E HI++P++S IF   P + +
Sbjct: 61  GDLRLVLAGPRHDKAAYLDLLVLLYRFMRLAQAKGDMALEEHIENPHDSAIFAMSPRIRD 120

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           +      ICDY+R+  +    +Y+++ +M  E+   L E+L     +  + ++LPA+GIV
Sbjct: 121 DKTTCNLICDYLRLTSLNIENAYQMDEVMSRELKKNLTEQLHTAKCLQSIADALPALGIV 180

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
            A+LG+IK M ++S+ P +LG  IG +L GT LG++LSY +  PL ++++   ++  R +
Sbjct: 181 AAVLGVIKTMASISKPPAVLGAMIGGALVGTFLGVLLSYGVVAPLAARMRDVVMQDSRYH 240

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHN 286
            +++  L+ ++ G+ PQV  E GRK +P    PS   +   + + ++ 
Sbjct: 241 DLIRIVLVTHLQGSPPQVCAEIGRKDIPHIFMPSFSELDMALTESSNP 288


>gi|258513970|ref|YP_003190192.1| MotA/TolQ/ExbB proton channel [Desulfotomaculum acetoxidans DSM
           771]
 gi|257777675|gb|ACV61569.1| MotA/TolQ/ExbB proton channel [Desulfotomaculum acetoxidans DSM
           771]
          Length = 260

 Score =  205 bits (521), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 60/271 (22%), Positives = 111/271 (40%), Gaps = 22/271 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++ +IG+   +L ++ GF   GG+   LIQ    +IV G   G  V    ++ +K     
Sbjct: 3   LAVLIGVVGGLLSLVLGFMWEGGHVGSLIQKTAALIVFGGTFGATVACFSVQDLKVIPQI 62

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L      K   +     ++  +  L    ++      E+ I    N              
Sbjct: 63  LKNALTVKLPEESE---IIDQIVDLADQARREGLLYLEDQISSMDN-------------- 105

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   ++++I G   +  + N+M+ EI  +              G   P +GI+G 
Sbjct: 106 ---EFLKKGIQLVIDG-TEAELVRNIMETEIISLEERNEVGASFFEAAGGFAPTMGIIGT 161

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  +GN+   P  LG  I V+   TL G+  +  L  PL ++IK+   K+  +  +
Sbjct: 162 VMGLVHVLGNMDD-PTTLGPKIAVAFIATLYGVASANVLYLPLGAKIKNVSKKEVIIKEL 220

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERP 271
           V + +IA   G  P +  E     L  ++RP
Sbjct: 221 VMEGVIALQGGNNPLLIRERLNAYLNPNKRP 251


>gi|167574626|ref|ZP_02367500.1| flagellar motor protein MotA [Burkholderia oklahomensis C6786]
          Length = 283

 Score =  205 bits (521), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 83/280 (29%), Positives = 152/280 (54%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  +IG+F+ +  + GGF   GG    + QP EI+I+ GA  G  VM NP  V+ + GV 
Sbjct: 1   MQLVIGIFLVLGGVFGGFILHGGALSSIWQPTEILIILGAASGALVMGNPRSVLIEMGVQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           + ++   K  G +   ++L +LY L+  ++ G     + H+++P  S +F   P +L   
Sbjct: 61  IKKVIARKGNGTEFQRELLLMLYELLEMVRDGGLKALDQHVEEPRESELFQKYPMILAQP 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +L  FI D  R++ +G    +E+E+++D+E++ I  E ++P  ++S + E++P  GI+ A
Sbjct: 121 QLIAFIVDNFRLMAMGRITQHELESMLDQELEAIESELMRPSRSLSKVAEAMPGFGILAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGI+  M N+  +   +G  +  ++ GT +GI+L Y +  PL S +      +   +  
Sbjct: 181 VLGIVTTMANIGGNVSDIGLQVAAAMVGTFIGILLCYGVLEPLASAMVHRVNSEISAFEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEV 280
           VK  L A + G    +A++ GRK++ L  +PS   +   +
Sbjct: 241 VKVVLCAQVAGKPTLLAVDAGRKLIQLDVKPSFSKLESWI 280


>gi|90422601|ref|YP_530971.1| flagellar motor protein MotA [Rhodopseudomonas palustris BisB18]
 gi|90104615|gb|ABD86652.1| chemotaxis protein [Rhodopseudomonas palustris BisB18]
          Length = 281

 Score =  204 bits (520), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 138/269 (51%), Positives = 190/269 (70%)

Query: 21  MGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDTYCDVLK 80
           MGG+  ++ QP+E VI+ G  LG +++ANP KV+ D+GV++++        Q  Y D+L 
Sbjct: 1   MGGHIGVIWQPWEFVIIGGMALGTYIVANPWKVVVDTGVAVVQALTMAVPQQRHYLDLLG 60

Query: 81  LLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMIIVGNARS 140
           LL+ LM  ++   RNE E HIDDP +S IF + PTVL N  + +FICDY R+II+G+AR 
Sbjct: 61  LLHSLMREVRNKGRNEVEGHIDDPASSEIFGNFPTVLANEAMVSFICDYFRLIIMGSARP 120

Query: 141 YEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQSPKILGT 200
           +EIE LMDEEI+ I+  KLKPY ++  + E LPA+GIV A+LG+IKAMG L QSPK+LG 
Sbjct: 121 HEIEALMDEEIETIVRSKLKPYSSMMMVAEGLPALGIVAAVLGVIKAMGALDQSPKLLGG 180

Query: 201 AIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIPQVAIEY 260
            IG +L GT  GI LSY L  PL +++KS R +Q R+YIIVK+ L+A+MNGA+PQ+AIE+
Sbjct: 181 FIGSALVGTFAGIFLSYGLVAPLAAKVKSVRERQCRMYIIVKQTLLAFMNGALPQIAIEH 240

Query: 261 GRKVLPLSERPSIEIVAQEVLQYNHNKKA 289
           GRK++   ERPSI++V  E +     K A
Sbjct: 241 GRKMIGPGERPSIDVVENETISGGAAKAA 269


>gi|312110142|ref|YP_003988458.1| MotA/TolQ/ExbB proton channel [Geobacillus sp. Y4.1MC1]
 gi|311215243|gb|ADP73847.1| MotA/TolQ/ExbB proton channel [Geobacillus sp. Y4.1MC1]
          Length = 263

 Score =  204 bits (520), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 59/277 (21%), Positives = 119/277 (42%), Gaps = 21/277 (7%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
           ++IIG+ + I+ +  G Y  G +P +LI P  I+I+    +    +A P + IK      
Sbjct: 4   TSIIGIILGIVAVGVGMYLKGVHPSVLINPAAILIILVGTMASVTVAFPTREIKKVPKLF 63

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
             +F  K     T   ++ +        ++      E  +D+                  
Sbjct: 64  GVLF--KEQNIPTIEQLIPMFVDWANIARREGLLALEAKLDEID---------------- 105

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
              F+ + + M I G  +   I ++M EEI+ +           S  G   P +G++GA+
Sbjct: 106 -DPFLRNGLSMAIDGQTQ-DFIRDVMTEEIEAMEERHEANAAIFSQAGTYAPTLGVLGAV 163

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           +G+I A+ N+  +   +G AI  +   TLLGI   Y L +P  ++++    ++ ++  ++
Sbjct: 164 IGLIAALSNM-DNISEIGKAISAAFVATLLGIFTGYVLWHPFANKLRRKSKEEAKIRQVM 222

Query: 242 KKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQ 278
            + +++ + G  P+   +     LP +ER  I    +
Sbjct: 223 IEGVLSILEGQAPRTIEQKLASYLPATERKKIIEQGE 259


>gi|221635438|ref|YP_002523314.1| chemotaxis protein PomA [Thermomicrobium roseum DSM 5159]
 gi|221157783|gb|ACM06901.1| chemotaxis protein PomA [Thermomicrobium roseum DSM 5159]
          Length = 267

 Score =  204 bits (519), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 50/272 (18%), Positives = 109/272 (40%), Gaps = 24/272 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++TI+G+ +    +I  F   GG+   LI     +I+ G   G  + +  LK +      
Sbjct: 3   LATILGIVLGFGALILAFVMEGGHLSSLIGITAYMIIFGGTFGATLTSYGLKDMLGLPKL 62

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +++         D    +++ +  L    ++      ENH                    
Sbjct: 63  IMKAIKTP---PDRRAVLVEEIVKLAEIARRDGLLALENH-------------------P 100

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   + +++ G   +   E ++  +++ +     + Y     MG   P +GI+G 
Sbjct: 101 IEDPFLKKGIMLVVDG-TDAELTEQILWADVEAMEQRHARGYGIFQTMGGFAPTMGIIGT 159

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  + +L   P+ LG AI V+   TL G+  +  L  PL +++K    ++     +
Sbjct: 160 VMGLVHVLSSLKD-PESLGPAIAVAFLATLYGVATANLLWLPLHNKLKLRSKEEVAERQL 218

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPS 272
           + + ++    G  P++  E     LP   R +
Sbjct: 219 IIEGILGIQAGENPRMLREKLLVHLPPQARAT 250


>gi|296135639|ref|YP_003642881.1| MotA/TolQ/ExbB proton channel [Thiomonas intermedia K12]
 gi|295795761|gb|ADG30551.1| MotA/TolQ/ExbB proton channel [Thiomonas intermedia K12]
          Length = 247

 Score =  204 bits (519), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 56/264 (21%), Positives = 107/264 (40%), Gaps = 22/264 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           + ++IG+ + +  I+ G    GG+   +IQ    +IV G   G  ++  PLKV   S   
Sbjct: 3   ILSVIGVVVALGSILLGQLLEGGHISSIIQGTAFLIVIGGTTGATMLQFPLKVFIRSLKM 62

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  I       +    + +K +       +K      E  I+                  
Sbjct: 63  LPWIVLPP---KGDPQETIKQILEWSDTARKNGLLALEAMIESV---------------- 103

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   ++M++ G     +I + +++EI  + +   +        G   P +GI+GA
Sbjct: 104 -PDPFVKKGLQMLVDG-TDPEKIRSTLEQEIGAVEHHDNQAAKVYESSGGYAPTVGILGA 161

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+I  M NL+  P  LG  I V+   T+ G+  +     P+ +++KS    + +L  +
Sbjct: 162 VLGLIHVMENLAD-PSKLGGGIAVAFVATVYGVGSANLFFLPVANKLKSIVHNRAKLQEM 220

Query: 241 VKKALIAYMNGAIPQVAIEYGRKV 264
               L+A   G  P++     +  
Sbjct: 221 QVDGLVAIAEGENPRIIEGRLQSY 244


>gi|16078433|ref|NP_389252.1| flagellar motor protein MotA [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|221309233|ref|ZP_03591080.1| flagellar motor protein MotA [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|221313561|ref|ZP_03595366.1| flagellar motor protein MotA [Bacillus subtilis subsp. subtilis
           str. NCIB 3610]
 gi|221318483|ref|ZP_03599777.1| flagellar motor protein MotA [Bacillus subtilis subsp. subtilis
           str. JH642]
 gi|221322756|ref|ZP_03604050.1| flagellar motor protein MotA [Bacillus subtilis subsp. subtilis
           str. SMY]
 gi|127247|sp|P28611|MOTA_BACSU RecName: Full=Motility protein A; AltName: Full=Chemotaxis protein
           MotA
 gi|143207|gb|AAA22602.1| motility protein A [Bacillus subtilis]
 gi|2633740|emb|CAB13242.1| motility protein A; MotA component of the stator flagellum complex
           [Bacillus subtilis subsp. subtilis str. 168]
          Length = 270

 Score =  204 bits (519), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 57/288 (19%), Positives = 120/288 (41%), Gaps = 21/288 (7%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
           +++IG+ +  + +  G    G +   L  P  I+I+    +   V+A P K IK      
Sbjct: 4   TSLIGIILAFVALSVGMVLKGVSFSALANPAAILIIIAGTISAVVIAFPTKEIKKVPTLF 63

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
             +F  K   Q T  +++ +        ++      E  I+D                  
Sbjct: 64  RVLF--KENKQLTIEELIPMFSEWAQLARREGLLALEASIEDVD---------------- 105

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
              F+ + + M + G + +  I ++M EE++ +           +  G   P +G++GA+
Sbjct: 106 -DAFLKNGLSMAVDGQS-AEFIRDIMTEEVEAMEDRHQAGAAIFTQAGTYAPTLGVLGAV 163

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           +G+I A+ ++  +   LG AI  +   TLLGI   Y L +P  +++K    ++ +L  ++
Sbjct: 164 IGLIAALSHM-DNTDELGHAISAAFVATLLGIFTGYVLWHPFANKLKRKSKQEVKLREVM 222

Query: 242 KKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKA 289
            + +++ + G  P+V  +     LP  +R       +        ++A
Sbjct: 223 IEGVLSVLEGQAPKVIEQKLLMYLPAKDRLKFAEQGEAQNGEKKEEEA 270


>gi|295399257|ref|ZP_06809239.1| MotA/TolQ/ExbB proton channel [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|294978723|gb|EFG54319.1| MotA/TolQ/ExbB proton channel [Geobacillus thermoglucosidasius
           C56-YS93]
          Length = 263

 Score =  204 bits (519), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 59/277 (21%), Positives = 120/277 (43%), Gaps = 21/277 (7%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
           ++IIG+ + I+ +  G Y  G +P +LI P  I+I+    +    +A P + IK      
Sbjct: 4   TSIIGIILGIVAVGVGMYLKGVHPSVLINPAAILIILVGTMASVTVAFPTREIKKVPKLF 63

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
             +F  K     T  +++ +        ++      E  +D+                  
Sbjct: 64  GVLF--KEQNIPTIEELIPMFVDWANIARREGLLALEAKLDEID---------------- 105

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
              F+ + + M I G  +   I ++M EEI+ +           S  G   P +G++GA+
Sbjct: 106 -DPFLRNGLSMAIDGQTQ-DFIRDVMTEEIEAMEERHEANAAIFSQAGTYAPTLGVLGAV 163

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           +G+I A+ N+  +   +G AI  +   TLLGI   Y L +P  ++++    ++ ++  ++
Sbjct: 164 IGLIAALSNM-DNISEIGKAISAAFVATLLGIFTGYVLWHPFANKLRRKSKEEAKIRQVM 222

Query: 242 KKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQ 278
            + +++ + G  P+   +     LP +ER  I    +
Sbjct: 223 IEGVLSILEGQAPRTIEQKLASYLPATERKKIIEQGE 259


>gi|226950065|ref|YP_002805156.1| chemotaxis MotA protein [Clostridium botulinum A2 str. Kyoto]
 gi|226842087|gb|ACO84753.1| chemotaxis MotA protein [Clostridium botulinum A2 str. Kyoto]
          Length = 270

 Score =  204 bits (518), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 53/276 (19%), Positives = 111/276 (40%), Gaps = 22/276 (7%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           + T IGL +    +I G    G N  +      + I  G  L   ++  P+   K   V 
Sbjct: 6   ILTPIGLVLCFGLVIWGMATGGSNLKVFWDLASVFITIGGSLTAMLITYPIDEFKRLFVV 65

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +++ F        +  DV++    L    ++      E+ I++                 
Sbjct: 66  IVQTF---KYNGMSNIDVIQNFVDLSRKARREGLLSLEDAINNL---------------- 106

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               ++   +RM++ G      I ++M+ EID +          +   G   PA G++G 
Sbjct: 107 -TDDYMKKGLRMVVDG-IEPETIRDIMELEIDEMEKRHKSGADMLKTWGGYSPAFGMIGT 164

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G+I+ + NL+ S   + + +G +L  T  G +++  + NP+ + +      +     +
Sbjct: 165 LIGLIQMLANLTDS-STIASGMGKALITTFYGSVMANMVFNPMGANLMFKSGVEATTREM 223

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIV 276
           V + ++A  +G  P++  E     L  +ER +   V
Sbjct: 224 VLEGVLAIQSGVNPRIMEEKLVSYLSPTERLAYSKV 259


>gi|301643538|ref|ZP_07243581.1| flagellar motor protein MotA [Escherichia coli MS 146-1]
 gi|301078089|gb|EFK92895.1| flagellar motor protein MotA [Escherichia coli MS 146-1]
          Length = 265

 Score =  204 bits (518), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 81/257 (31%), Positives = 135/257 (52%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+GL + + C+ GG++  GG    + QP E++I+ GAG G  ++ NP  V+K+    
Sbjct: 1   MQKILGLLVVLGCVFGGYFEAGGQLVAIWQPAEMIIILGAGFGAMIIGNPKHVLKEIAHQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  +   K LG +    +L  LY L+  ++ G     + HI+ P  STIF   P VL   
Sbjct: 61  IKGVISKKQLGPEFQRQLLMCLYELLEMVQNGGLRMLDQHIEQPEESTIFQKYPLVLTQK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L TFI D  R++ +G   ++E+E ++D+E+D      L P  ++    E++P  GI  A
Sbjct: 121 RLVTFIADNFRLMAMGKIDAHELEGILDQELDTAEESLLTPSRSLQRTAEAMPGFGICAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGII  M ++  S  ++G  +  +L GT LG+ + Y L +PL + ++     +H L   
Sbjct: 181 VLGIIITMQSIDGSIALIGLKVAAALVGTFLGVFICYCLMDPLANAMEQQARAEHSLLEC 240

Query: 241 VKKALIAYMNGAIPQVA 257
           V+  L+A   G    +A
Sbjct: 241 VRTVLVAQAGGKPTLLA 257


>gi|309388828|gb|ADO76708.1| MotA/TolQ/ExbB proton channel [Halanaerobium praevalens DSM 2228]
          Length = 270

 Score =  204 bits (518), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 55/289 (19%), Positives = 117/289 (40%), Gaps = 23/289 (7%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++TI+GL      I G    +GGN  + I     ++V G  L G +++   + +K+    
Sbjct: 3   LATIVGLIAG-AVIFGSVALLGGNVGVFISVQSALVVFGGTLAGVMISYTFEDLKNVPNL 61

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
               F    L  +    V++ L       ++      E+                   + 
Sbjct: 62  FRVSFQDDNLESE---HVIENLVNFAEKARREGLLALEDD-----------------ASK 101

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   +++++ G      + N+++ ++  +     K     + MGE  PA G+VG 
Sbjct: 102 MEDEFLQKGIQLVVDG-TDPELVRNILETKLTFLQERHAKGRGIFATMGELAPAFGMVGT 160

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G+I+ +  L   P  LG  + V+L  TL G +L+  +  PL+  +K+    +  +  +
Sbjct: 161 LIGLIQMLSQLDD-PDQLGGGMAVALITTLYGALLANWIFIPLSKNLKTQSDHEIHVKEV 219

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKA 289
           + + +++   G  P++  E     L   E+  +E    E  +    + A
Sbjct: 220 IIEGILSIQAGENPRIVKEKLHAFLSEGEKQEVESRIGETGEVGAGENA 268


>gi|126442576|ref|YP_001061207.1| flagellar motor protein MotA [Burkholderia pseudomallei 668]
 gi|134280848|ref|ZP_01767558.1| chemotaxis protein MotA [Burkholderia pseudomallei 305]
 gi|254182926|ref|ZP_04889519.1| chemotaxis LafT protein [Burkholderia pseudomallei 1655]
 gi|254299721|ref|ZP_04967170.1| chemotaxis LafT protein [Burkholderia pseudomallei 406e]
 gi|125657183|gb|ABN48671.1| chemotaxis MotA protein [Burkholderia pseudomallei]
 gi|126222067|gb|ABN85572.1| chemotaxis protein MotA [Burkholderia pseudomallei 668]
 gi|134247870|gb|EBA47954.1| chemotaxis protein MotA [Burkholderia pseudomallei 305]
 gi|157809337|gb|EDO86507.1| chemotaxis LafT protein [Burkholderia pseudomallei 406e]
 gi|184213460|gb|EDU10503.1| chemotaxis LafT protein [Burkholderia pseudomallei 1655]
          Length = 283

 Score =  204 bits (518), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 84/282 (29%), Positives = 148/282 (52%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   IG+ +   C+ GGF   GG    + QP EI+I++GA  G  VM NP  V+ + G  
Sbjct: 1   MQLAIGILLVFGCVFGGFVLHGGALSSIWQPTEILIISGAAAGALVMGNPRSVLSEMGSQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  +   K+ G +   ++L +LY L+  ++ G     + H+++P  S +F   P +L   
Sbjct: 61  IKHVIARKSNGVEFQRELLLMLYELLETVRDGGLKALDQHVEEPRESDLFRKYPMILAQP 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FI D  R++ +G    +E+E ++D+E++ I  E ++P  ++S + ES+P  GI+ A
Sbjct: 121 RLIAFIVDNFRLMAMGRITQHELEGMLDQELEAIESELMQPSRSLSKIAESMPGFGILAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGI+  M N+  S   +G  +  ++ GT +GI+L Y +  PL S +             
Sbjct: 181 VLGIVTTMANIGGSVSEIGLQVAAAMVGTFIGILLCYGVLEPLASAMVHRVKSDMSALEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQ 282
           VK  L A + G    +A++ GRK++ L  +PS   +   +++
Sbjct: 241 VKVVLCAQVAGKPTLLAVDAGRKLIQLDVKPSFSKLESWIME 282


>gi|83717992|ref|YP_438355.1| flagellar motor protein MotA [Burkholderia thailandensis E264]
 gi|167614801|ref|ZP_02383436.1| flagellar motor protein MotA [Burkholderia thailandensis Bt4]
 gi|83651817|gb|ABC35881.1| chemotaxis MotA protein [Burkholderia thailandensis E264]
          Length = 283

 Score =  204 bits (518), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 84/282 (29%), Positives = 148/282 (52%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M   IG+ +   C+ GGF   GG    + QP EI+I++GA  G  VM NP  V+ + G  
Sbjct: 1   MQLAIGILLVFGCVFGGFVLHGGALSSIWQPTEILIISGAAAGALVMGNPRSVLSEMGSQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  +   K+ G +   ++L +LY L+  ++ G     + H+++P  S +F   P +L   
Sbjct: 61  IKHVIARKSNGVEFQRELLLMLYELLETVRDGGLKALDQHVEEPKESDLFRKYPMILAQP 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FI D  R++ +G    +E+E ++D+E++ I  E ++P  ++S + ES+P  GI+ A
Sbjct: 121 RLIAFIVDNFRLMAMGRITQHELEGMLDQELEAIESELMQPSRSLSKIAESMPGFGILAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGI+  M N+  S   +G  +  ++ GT +GI+L Y +  PL S +             
Sbjct: 181 VLGIVTTMANIGGSVSEIGLQVAAAMVGTFIGILLCYGVLEPLASAMVHRVKSDMSALEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQ 282
           VK  L A + G    +A++ GRK++ L  +PS   +   +++
Sbjct: 241 VKVVLCAQVAGKPTLLAVDAGRKLIQLDVKPSFSKLESWIME 282


>gi|224825767|ref|ZP_03698871.1| MotA/TolQ/ExbB proton channel [Lutiella nitroferrum 2002]
 gi|224601991|gb|EEG08170.1| MotA/TolQ/ExbB proton channel [Lutiella nitroferrum 2002]
          Length = 287

 Score =  204 bits (518), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 78/283 (27%), Positives = 151/283 (53%), Gaps = 3/283 (1%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++G+ I + C+ GGF   GG+ +++ QP E++I+ GA +G  V+ NP  V+ + G  
Sbjct: 1   MQQLLGIGIVLGCVFGGFMLGGGSFHVIWQPVELLIICGAAIGAIVLGNPKHVLLEMGGQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  +   K  G +    +L L+Y L+           + H++ P  S +F   P VL+  
Sbjct: 61  IKRVVLRKKHGAEFQRQLLLLMYELLITA-SQGLKALDEHVEAPRQSPLFNRYPLVLQQP 119

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +L  FI D  R++ +G   ++E+E ++D+EID I  E  +P  ++  +GE++P  GI+ A
Sbjct: 120 KLLAFIVDNFRLMAMGKISAHELEGVLDQEIDAIHEELNQPSKSLHKIGEAMPGFGILAA 179

Query: 181 ILGIIKAMGNLSQSPK--ILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
           +LGI+  M ++        +   +G ++ GT +GI   Y + +PL++ +     ++   +
Sbjct: 180 VLGIVMTMNSVGNGATTGEIAEKVGAAMVGTFIGIFFCYGVLDPLSNVMHQQVKEELSNF 239

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
             VK  +  + +G  P +AI+ GR+++ L+ +PS   +   + 
Sbjct: 240 ESVKVVITTHASGKPPLLAIDAGRRLVQLNTKPSFSQLESWIN 282


>gi|187778758|ref|ZP_02995231.1| hypothetical protein CLOSPO_02353 [Clostridium sporogenes ATCC
           15579]
 gi|187772383|gb|EDU36185.1| hypothetical protein CLOSPO_02353 [Clostridium sporogenes ATCC
           15579]
          Length = 270

 Score =  204 bits (518), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 52/276 (18%), Positives = 109/276 (39%), Gaps = 22/276 (7%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           + T IGL +    +I G    G N  +      + I  G  L   ++  P+   K   V 
Sbjct: 6   ILTPIGLVLCFGLVIWGMSTGGSNLKVFWDLASVFITIGGSLTAMLITYPIDEFKRLFVV 65

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +++ F    +       V++    L    ++      E+ I++                 
Sbjct: 66  IVQTFKDNGMSNID---VIQNFVDLSRKARREGLLSLEDAINNL---------------- 106

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               ++   +RM++ G      I  +M+ EID +          +   G   PA G++G 
Sbjct: 107 -TDDYMKKGLRMVVDG-IEPETIREIMELEIDEMEKRHKSGADMLKTWGGYSPAFGMIGT 164

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G+I+ + NL+ S   + + +G +L  T  G +++  + NP+ + +      +     +
Sbjct: 165 LIGLIQMLANLTDS-STIASGMGKALITTFYGSVMANMVFNPMGANLMFKSGVEATTREM 223

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIV 276
           V + ++A  +G  P++  E     L  +ER +   V
Sbjct: 224 VLEGVLAIQSGVNPRIMEEKLVSYLSPTERQAYSKV 259


>gi|42524630|ref|NP_970010.1| flagellar motor protein MotA [Bdellovibrio bacteriovorus HD100]
 gi|39576840|emb|CAE78069.1| flagellar motor protein [Bdellovibrio bacteriovorus HD100]
          Length = 265

 Score =  204 bits (518), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 77/257 (29%), Positives = 140/257 (54%)

Query: 31  PFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDTYCDVLKLLYILMYNLK 90
           P E++I+ GA LG +++ANP+KVIK      ++    K   +  Y ++L++++ L    +
Sbjct: 9   PLELMIIGGAALGAYIIANPMKVIKAGFKMSIKAMTAKGPQKQDYVELLQMMFQLFQAFR 68

Query: 91  KGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMIIVGNARSYEIENLMDEE 150
           K      E HI++P  S IF + P+ + N+    F+CD M++ +      Y++++L+D +
Sbjct: 69  KEGPQGIEKHIEEPDKSDIFKAYPSFMHNHHAVHFLCDTMKITLSAEMSPYDVDDLLDAD 128

Query: 151 IDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQSPKILGTAIGVSLTGTL 210
           I  I +E+    HA+  + +  P +GIV A+LGI+K M +L+   + +G  +  +L GT+
Sbjct: 129 IKAIHHEEHMAVHAVQTVADGFPGLGIVAAVLGIVKTMAHLTDGVEKIGALVASALVGTM 188

Query: 211 LGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIPQVAIEYGRKVLPLSER 270
           LG+  +Y L  P  +++ +    + R    +K A++A   GA P V +EY R+ +   ER
Sbjct: 189 LGVFGAYGLIGPTATKMGADIDAEGRYLGCIKAAMVALQRGAPPIVCVEYARRSIMPEER 248

Query: 271 PSIEIVAQEVLQYNHNK 287
           PS E V +   +     
Sbjct: 249 PSFEEVDKATKEIKKAA 265


>gi|321315124|ref|YP_004207411.1| flagellar motor protein MotA [Bacillus subtilis BSn5]
 gi|320021398|gb|ADV96384.1| flagellar motor protein MotA [Bacillus subtilis BSn5]
          Length = 270

 Score =  204 bits (518), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 57/288 (19%), Positives = 120/288 (41%), Gaps = 21/288 (7%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
           +++IG+ +  + +  G    G +   L  P  I+I+    +   V+A P K IK      
Sbjct: 4   TSLIGIILAFVALSVGMVLKGVSFSALANPAAILIIIAGTISAVVIAFPTKEIKKVPALF 63

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
             +F  K   Q T  +++ +        ++      E  I+D                  
Sbjct: 64  RVLF--KENKQLTIEELIPMFSEWAQLARREGLLALEASIEDVD---------------- 105

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
              F+ + + M + G + +  I ++M EE++ +           +  G   P +G++GA+
Sbjct: 106 -DAFLKNGLSMAVDGQS-AEFIRDIMTEEVEAMEDRHQAGAAIFTQAGTYAPTLGVLGAV 163

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           +G+I A+ ++  +   LG AI  +   TLLGI   Y L +P  +++K    ++ +L  ++
Sbjct: 164 IGLIAALSHM-DNTDELGHAISAAFVATLLGIFTGYVLWHPFANKLKRKSKQEVKLREVM 222

Query: 242 KKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKA 289
            + +++ + G  P+V  +     LP  +R       +        ++A
Sbjct: 223 IEGVLSVLEGQAPKVIEQKLLMYLPAKDRLKFAEQGEAQNGEKKEEEA 270


>gi|296329694|ref|ZP_06872179.1| flagellar motor protein MotA [Bacillus subtilis subsp. spizizenii
           ATCC 6633]
 gi|305674091|ref|YP_003865763.1| motility protein A; MotA component of the stator flagellum complex
           [Bacillus subtilis subsp. spizizenii str. W23]
 gi|296153192|gb|EFG94056.1| flagellar motor protein MotA [Bacillus subtilis subsp. spizizenii
           ATCC 6633]
 gi|305412335|gb|ADM37454.1| motility protein A; MotA component of the stator flagellum complex
           [Bacillus subtilis subsp. spizizenii str. W23]
          Length = 270

 Score =  203 bits (517), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 57/288 (19%), Positives = 121/288 (42%), Gaps = 21/288 (7%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
           +++IG+ +  + +  G    G +   L  P  I+I+    +   V+A P K IK      
Sbjct: 4   TSLIGIILAFVALSVGMVLKGVSFSALANPAAILIIIAGTISAVVIAFPTKEIKKVPALF 63

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
             +F  K   Q T  +++ +        ++      E  I+D                  
Sbjct: 64  RVLF--KENKQLTIEELIPMFSEWAQLARREGLLALEASIEDVD---------------- 105

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
             TF+ + + M + G + +  I ++M EE++ +           +  G   P +G++GA+
Sbjct: 106 -DTFLKNGLSMAVDGQS-AEFIRDIMTEEVEAMEDRHQAGAAIFTQAGTYAPTLGVLGAV 163

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           +G+I A+ ++  +   LG AI  +   TLLGI   Y L +P  +++K    ++ +L  ++
Sbjct: 164 IGLIAALSHM-DNTDELGHAISAAFVATLLGIFTGYVLWHPFANKLKRKSKQEVKLREVM 222

Query: 242 KKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKA 289
            + +++ + G  P+V  +     +P  +R       +        ++A
Sbjct: 223 IEGVLSVLEGQAPKVIEQKLLMYIPAKDRLKFAEQGEAQNGEKKEEEA 270


>gi|170737029|ref|YP_001778289.1| MotA/TolQ/ExbB proton channel [Burkholderia cenocepacia MC0-3]
 gi|169819217|gb|ACA93799.1| MotA/TolQ/ExbB proton channel [Burkholderia cenocepacia MC0-3]
          Length = 290

 Score =  203 bits (517), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 86/292 (29%), Positives = 157/292 (53%), Gaps = 6/292 (2%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I G+ I + C+ GGF  MGG+   L QP E++IV G+ +G  V+ N   V+ D G  
Sbjct: 1   MQQIFGILIVLGCVFGGFTFMGGDFRKLWQPVELLIVVGSAVGALVLGNSRHVLVDMGKQ 60

Query: 61  LLEIFGYKAL--GQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
           L ++ G +     ++     L ++Y L+   +       +NH+++P+ S +F   P VL+
Sbjct: 61  LRKVMGRRKRTANKELQRQQLLVMYELLNIGR--DLKALDNHVENPHESRLFQRYPLVLQ 118

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
             EL TFI D +R++ +G   S+E+E+++++E+  I      P  ++  + E++P  GIV
Sbjct: 119 GPELLTFIVDNLRLMAMGKISSHELESVLEQELVAIQENIELPSRSLKKISEAMPGFGIV 178

Query: 179 GAILGIIKAMGNLSQ--SPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHR 236
            A+LG++ AMG L    S   L   +  ++ GTL+GI   Y + +P+++ IK     +  
Sbjct: 179 AAVLGVVIAMGGLGDGASAAELAENVAAAMIGTLIGIFFCYGVLDPVSNLIKQAMKAEMS 238

Query: 237 LYIIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
               +K  L+A+  G  P +AI+ GR+++  + +PS   +   + Q +  ++
Sbjct: 239 EMECMKVILVAFAGGKPPLLAIDAGRRMMQPACKPSFAQLEGWIGQLDAGRE 290


>gi|260892161|ref|YP_003238258.1| MotA/TolQ/ExbB proton channel [Ammonifex degensii KC4]
 gi|260864302|gb|ACX51408.1| MotA/TolQ/ExbB proton channel [Ammonifex degensii KC4]
          Length = 265

 Score =  203 bits (517), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 58/281 (20%), Positives = 122/281 (43%), Gaps = 24/281 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++T+IG+ + I C++ GF   GG    L+ P   +I+ G  LG  +       I     +
Sbjct: 3   IATLIGITVGIACLLLGFVLEGGTVAQLLAPSSFIIIFGGTLGATMAGFSFHEIAVVPKA 62

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  IF ++ + +     +++ L  L    ++      EN++ +  +              
Sbjct: 63  LRVIFFHRPIDERA---LIEQLVSLAEKARREGLLYLENYLKEIES-------------- 105

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   +++++ G      ++++M+ E+  +           +  G   P +GI+G 
Sbjct: 106 ---PFLRKGIQLVVDG-TEPELVKSIMETELYAMQERHRIAQEIFNQAGGYAPTMGIIGT 161

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G+I  + +LS SP+ LG AI ++ T TL G+  +  +  P+ +++K+   K+   + I
Sbjct: 162 VMGLIHVLSHLS-SPEALGPAIAMAFTATLYGVSSANLIFYPIAARLKNLSAKEELAHRI 220

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSI--EIVAQE 279
           + + L+A   G  P +  E     L    R     E   + 
Sbjct: 221 MLEGLLALQAGNNPILIRERLTAFLSPKYRKQAGTEEGEEA 261


>gi|312879596|ref|ZP_07739396.1| MotA/TolQ/ExbB proton channel [Aminomonas paucivorans DSM 12260]
 gi|310782887|gb|EFQ23285.1| MotA/TolQ/ExbB proton channel [Aminomonas paucivorans DSM 12260]
          Length = 264

 Score =  203 bits (516), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 56/285 (19%), Positives = 112/285 (39%), Gaps = 23/285 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           + T+IG  +  + +IGG    GG P   +    I+I  G  LG  +MANPL+  K     
Sbjct: 3   LGTVIGFLLANILVIGG-ILAGGEPMAFVDIPSILITGGGTLGAAIMANPLERTKALPKI 61

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           + + F            +++ L       ++      E                      
Sbjct: 62  VRKAFFA---DPIDLTGLIQTLVSFAEKARREGLLALEED-----------------AGQ 101

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   +++++ G      +++++D EI ++             M E  PA G++G 
Sbjct: 102 LDDEFMRKSIQLVVDG-TDPELVKSILDTEIGLLEERHAAAKSMFDIMAELAPAFGMLGT 160

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G+I  +GNL   P  LG  +  +L  T  G  ++  LC P++ ++     ++     +
Sbjct: 161 LIGLILMLGNLDD-PDALGPGMATALITTFYGSYIANVLCIPISKKLAYRSSQEILSREL 219

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           + + +++   G  P++  E  +  L  + R  +E   QE      
Sbjct: 220 MVEGILSIQAGENPRIVEEKLKVFLSPTMRAKMEEKKQEAQGGAA 264


>gi|225164038|ref|ZP_03726323.1| MotA/TolQ/ExbB proton channel [Opitutaceae bacterium TAV2]
 gi|224801344|gb|EEG19655.1| MotA/TolQ/ExbB proton channel [Opitutaceae bacterium TAV2]
          Length = 289

 Score =  203 bits (516), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 84/288 (29%), Positives = 148/288 (51%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M+ +IG  + +   +GGF   GGNP +L+   E V++ G  LG  ++A+P  V++D    
Sbjct: 1   MTILIGALVVLSATLGGFMLAGGNPLVLLHLSEYVVIIGVALGLLIIASPPAVMRDIIRK 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           + E    + + ++ Y D+LKLLY L    ++      E H+  P  S IF   PT   + 
Sbjct: 61  VGEAIRGRRMSREDYFDLLKLLYELFVLGRRNGLIALEEHVSAPEQSAIFQKYPTFALDA 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           E   F+ + +R +I G  +  ++E L+  E+     E   P H +  +G+SLP IGIV A
Sbjct: 121 ERREFLMNALRPVIDGRIKPDQLEELLGAELRAKAEEAEHPVHLLQLVGDSLPGIGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGII  M +++  P+++G  +  +LTGTLLG+  +Y   NP+ +++K   +   +    
Sbjct: 181 VLGIINTMASIADGPEVVGLRVAAALTGTLLGVFFAYGFVNPMANRVKLNNITNQQYLRC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
           +  +++ +  G  P  ++E  R+ L  S +P  E +   +       K
Sbjct: 241 IMISVVGFAKGLAPITSVEVARRSLNSSVQPGAEELESTLKSMPAPGK 288


>gi|78043109|ref|YP_359810.1| chemotaxis motA protein [Carboxydothermus hydrogenoformans Z-2901]
 gi|77995224|gb|ABB14123.1| chemotaxis motA protein [Carboxydothermus hydrogenoformans Z-2901]
          Length = 267

 Score =  203 bits (516), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 56/287 (19%), Positives = 117/287 (40%), Gaps = 23/287 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           +  ++G+ I    ++ GF   GG    L+ P   +I+ G  +G  ++A   + +      
Sbjct: 3   IMVVLGVVIAFTSLVTGFLMEGGTISALVAPSAALIIFGGTIGASIIAFSTEEVLAIPKY 62

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
              +   K L +    +V+K +  L    ++      EN + +                 
Sbjct: 63  FKIMLFQKPLNE---LEVVKQIVSLAQKARREGLLALENDLPNIK--------------- 104

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   +++I+ G        ++++ EI  I              G   P +GI+G 
Sbjct: 105 --DDFLRRGLQLIVDG-TDPELFRSILENEIYAIAERHRAGAEFFEAAGGYAPTMGIIGT 161

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  +G LS +P+ LG AI ++ T TL G+  +  L  P ++++K+   K+  +  +
Sbjct: 162 VMGLVHVLGQLS-TPEKLGPAIAMAFTATLYGVSSANILWLPFSAKLKNLSKKELLVREM 220

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERP-SIEIVAQEVLQYNHN 286
           + + L++   G  P +  E  R  L    R  S+     E+ +    
Sbjct: 221 MLEGLVSLQEGHNPMLIEEKLRSFLKPKLREQSLREGKGELNEAASA 267


>gi|148266089|ref|YP_001232795.1| MotA/TolQ/ExbB proton channel [Geobacter uraniireducens Rf4]
 gi|146399589|gb|ABQ28222.1| MotA/TolQ/ExbB proton channel [Geobacter uraniireducens Rf4]
          Length = 256

 Score =  203 bits (516), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 60/268 (22%), Positives = 107/268 (39%), Gaps = 22/268 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++TIIGL +    +IGG    GG+   ++QP   +IV G   G   ++ PLK I  +   
Sbjct: 3   IATIIGLVLGFGAVIGGQVLEGGHVSAILQPTAALIVLGGTFGATFVSFPLKNILQALKD 62

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
             ++       ++    V+K +       ++      E                      
Sbjct: 63  SRKVLFPP---KEDPEGVIKNIINYAAKARRNGLISLEQE-----------------AQT 102

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
              +F    + +++ G     ++   M+ E+                 G   P IGI+GA
Sbjct: 103 VKDSFTKKGISLVVDG-IDPQKLRETMEIELASFEEHAKASAEVFEAAGGFAPTIGIIGA 161

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+I  M NLS S   LG  I V+   T+ G++ +  +C P+++++K    +      +
Sbjct: 162 VLGLIHVMNNLSDS-SKLGAGIAVAFVATIYGLMTANIICIPISTKLKLRLKEAILQKEM 220

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLS 268
           V + LIA  NG  P    +  R  +P  
Sbjct: 221 VIEGLIAIQNGENPHFIEQKLRAYMPDD 248


>gi|168182735|ref|ZP_02617399.1| chemotaxis protein MotA [Clostridium botulinum Bf]
 gi|237796092|ref|YP_002863644.1| chemotaxis MotA protein [Clostridium botulinum Ba4 str. 657]
 gi|182674180|gb|EDT86141.1| chemotaxis protein MotA [Clostridium botulinum Bf]
 gi|229261249|gb|ACQ52282.1| chemotaxis protein MotA [Clostridium botulinum Ba4 str. 657]
          Length = 270

 Score =  203 bits (516), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 51/276 (18%), Positives = 110/276 (39%), Gaps = 22/276 (7%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           + T IGL +    +I G    G +  +      + I  G  L   ++  P+   K   V 
Sbjct: 6   ILTPIGLVLCFGLVIWGMATGGSSLKVFWDLASVFITIGGSLTAMLITYPIDEFKRLFVV 65

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +++ F    +       V++    L    ++      E+ I++                 
Sbjct: 66  IVQTFKDNGMSNID---VIQNFVDLSRKARREGLLSLEDAINNL---------------- 106

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               ++   +RM++ G      I ++M+ EID +          +   G   PA G++G 
Sbjct: 107 -TDDYMKKGLRMVVDG-IEPETIRDIMELEIDEMEKRHKSGADMLKTWGGYSPAFGMIGT 164

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G+I+ + NL+ S   + + +G +L  T  G +++  + NP+ + +      +     +
Sbjct: 165 LIGLIQMLANLTDS-STIASGMGKALITTFYGSVMANMVFNPMGANLMFKSGVEATTREM 223

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIV 276
           V + ++A  +G  P++  E     L  +ER +   V
Sbjct: 224 VLEGVLAIQSGVNPRIMEEKLVSYLSPTERLAYSKV 259


>gi|288573019|ref|ZP_06391376.1| MotA/TolQ/ExbB proton channel [Dethiosulfovibrio peptidovorans DSM
           11002]
 gi|288568760|gb|EFC90317.1| MotA/TolQ/ExbB proton channel [Dethiosulfovibrio peptidovorans DSM
           11002]
          Length = 264

 Score =  202 bits (515), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 53/275 (19%), Positives = 115/275 (41%), Gaps = 23/275 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++TIIGL ++++ ++GG    GG     +    ++I  G  +G  +MANP+  IK  G  
Sbjct: 3   LATIIGLSLSLILVVGGIV-AGGEAAAFVNLPSMLITIGGTMGAVIMANPMDRIKKLGKI 61

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
               F  +         +++ +       ++      E    +                 
Sbjct: 62  TRIAFFSQTP---DLVSLVQTIVSFAEKARREGLLALEADASELD--------------- 103

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   +++++ G      ++ ++D EI ++             MGE  PA G++G 
Sbjct: 104 --DEFLAKSIQLVVDG-TDPELVKAILDTEISVLEERHASNKGMFDTMGELFPAFGMLGT 160

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G+I  + NL   P  LG  + V+L  T  G  ++     P ++++ +   ++  +  +
Sbjct: 161 LIGLIAMLRNLDD-PGSLGPGMAVALITTFYGSFMANIFALPTSAKLAARSSEETVVREL 219

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEI 275
           + + ++A   G  P++  E  +  LP  +R  +E 
Sbjct: 220 MVEGVLAIQAGENPRIVEEKLKVFLPPEQRKELEE 254


>gi|322806982|emb|CBZ04552.1| flagellar motor rotation protein MotA [Clostridium botulinum H04402
           065]
          Length = 270

 Score =  202 bits (515), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 51/276 (18%), Positives = 110/276 (39%), Gaps = 22/276 (7%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           + T IGL +    +I G    G +  +      + I  G  L   ++  P+   K   V 
Sbjct: 6   ILTPIGLVLCFGLVIWGMATGGSSLKVFWDLASVFITIGGSLTAMLITYPIDEFKRLFVV 65

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +++ F    +       V++    L    ++      E+ I++                 
Sbjct: 66  IVQTFKDNGMSNID---VIQNFVDLSRKARREGLLSLEDAINNL---------------- 106

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               ++   +RM++ G      I ++M+ EID +          +   G   PA G++G 
Sbjct: 107 -TDDYMKKGLRMVVDG-IEPETIRDIMELEIDEMEKRHKSGADMLKTWGGYSPAFGMIGT 164

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G+I+ + NL+ S   + + +G +L  T  G +++  + NP+ + +      +     +
Sbjct: 165 LIGLIQMLANLTDS-STIASGMGKALITTFYGSVMANMVFNPMGANLMFKSGVEATTREM 223

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIV 276
           V + ++A  +G  P++  E     L  +ER +   V
Sbjct: 224 VLEGVLAIQSGVNPRIMEEKLVSYLSPTERLAYNKV 259


>gi|148974249|ref|ZP_01811782.1| MotA/TolQ/ExbB proton channel [Vibrionales bacterium SWAT-3]
 gi|145965946|gb|EDK31194.1| MotA/TolQ/ExbB proton channel [Vibrionales bacterium SWAT-3]
          Length = 290

 Score =  202 bits (515), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 76/281 (27%), Positives = 130/281 (46%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  +IG+ + +  I GGF  +GG    + +  EI+I+ GA     +M+     +K     
Sbjct: 1   MQKLIGIVVVLSVIFGGFIFLGGKFEFIFKLSEIIIIFGAAFASLLMSTTSSTLKLMVQQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +   F      +D Y  +L L++ L+   +  +    + H+++P +S IF   P + ++ 
Sbjct: 61  VGIAFRSTPYNKDYYQQLLSLMFELINTARVKNIKALDIHVENPESSKIFAKYPRITKDA 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
             T FI D  R +I G    + +E  ++EEI+ +  E  KP   +    E++P +GI+ A
Sbjct: 121 LTTQFIIDSFRQVITGKQSQHLLEAFLEEEIEHLEDEYTKPSEKLHATAEAMPGLGILAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++GII  M  L      +G  I  +L GT  G+   Y +  P++S IK     Q    + 
Sbjct: 181 VMGIILTMQGLDGEISEIGKNIAGALVGTFTGVFGCYCVLGPMSSSIKDVSENQLAPLLC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
           VK  L AY  G    +    GRK +    +PS   + + V 
Sbjct: 241 VKSILSAYAQGQSAHMCANAGRKNIETRYKPSFVELEKAVE 281


>gi|297529304|ref|YP_003670579.1| MotA/TolQ/ExbB proton channel [Geobacillus sp. C56-T3]
 gi|297252556|gb|ADI26002.1| MotA/TolQ/ExbB proton channel [Geobacillus sp. C56-T3]
          Length = 263

 Score =  202 bits (515), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 61/269 (22%), Positives = 118/269 (43%), Gaps = 21/269 (7%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
           ++IIG+ + ++ +  G Y  G +P +LI P  I+I+        ++A P+K IK      
Sbjct: 4   TSIIGIILGVIAVGLGMYFKGVSPAVLINPAAILIILVGTAAAVIIAFPMKEIKKVPKLF 63

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
             IF           +++ L        ++      E  ++D                  
Sbjct: 64  KIIFTEPPTPSID--ELIPLFVDWANIARREGLLALEAKLNDID---------------- 105

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
              F+ + + M I G  +   I ++M EEI  +           +  G   P +G++GA+
Sbjct: 106 -DPFLRNGLSMAIDGQTQ-EFIRDVMTEEIVAMEERHEANAAIFTQAGTYAPTLGVLGAV 163

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           +G+I A+GN+  +   LG AI  +   T+LGI   Y L +P  ++++    ++ R+  I+
Sbjct: 164 VGLIAALGNM-DNISELGHAISAAFVATMLGIFTGYVLWHPFANKLRRKSKEEARVRYIM 222

Query: 242 KKALIAYMNGAIPQVAIEYGRKVLPLSER 270
            + +++ + G  P++  +     LP SER
Sbjct: 223 VEGVLSILEGQAPRMIEQKLASYLPESER 251


>gi|167567202|ref|ZP_02360118.1| flagellar motor protein MotA [Burkholderia oklahomensis EO147]
          Length = 281

 Score =  202 bits (515), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 82/277 (29%), Positives = 151/277 (54%)

Query: 4   IIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLE 63
           +IG+F+ +  + GGF   GG    + QP EI+I+ GA  G  VM NP  V+ + GV + +
Sbjct: 2   VIGIFLVLGGVFGGFILHGGALSSIWQPTEILIILGAASGALVMGNPRSVLIEMGVQIKK 61

Query: 64  IFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELT 123
           +   K  G +   ++L +LY L+  ++ G     + H+++P  S +F   P +L   +L 
Sbjct: 62  VIARKGNGTEFQRELLLMLYELLEMVRDGGLKALDQHVEEPRESELFQKYPMILAQPQLI 121

Query: 124 TFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILG 183
            FI D  R++ +G    +E+E+++D+E++ I  E ++P  ++S + E++P  GI+ A+LG
Sbjct: 122 AFIVDNFRLMAMGRITQHELESMLDQELEAIESELMRPSRSLSKVAEAMPGFGILAAVLG 181

Query: 184 IIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKK 243
           I+  M N+  +   +G  +  ++ GT +GI+L Y +  PL S +      +   +  VK 
Sbjct: 182 IVTTMANIGGNVSDIGLQVAAAMVGTFIGILLCYGVLEPLASAMVHRVNSEISAFECVKV 241

Query: 244 ALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEV 280
            L A + G    +A++ GRK++ L  +PS   +   +
Sbjct: 242 VLCAQVAGKPTLLAVDAGRKLIQLDVKPSFSKLESWI 278


>gi|304413522|ref|ZP_07394995.1| flagellar motor component [Candidatus Regiella insecticola LSR1]
 gi|304284365|gb|EFL92758.1| flagellar motor component [Candidatus Regiella insecticola LSR1]
          Length = 285

 Score =  202 bits (514), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 79/286 (27%), Positives = 150/286 (52%), Gaps = 1/286 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++GL I + C+IGG+   GG      QP EI+I+ GAG+G  ++ANP  V+ +    
Sbjct: 1   MQKLLGLIIIMFCVIGGYLMSGGIMSSFWQPGEIIIILGAGMGAMILANPKYVLVEMWQQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  +        +    +L L  + +  + +G   + + HI+ P NST+F   P +L++ 
Sbjct: 61  IKSVVSKNQYTLEFQQQLLLLYEL-LEMVDEGGLKKLDEHIEIPENSTLFQKYPLILKHK 119

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L TFI D  R++ +G    +E+E ++++E+  +  + L P  ++    E++P  GI  A
Sbjct: 120 GLVTFISDNFRLMAMGKINEHELEGILEQELGAVEEQLLVPSRSMQRTAEAMPGFGICAA 179

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGII  M ++  S  ++G  +  +L GT LG+ + Y   +PL + ++    K+   +  
Sbjct: 180 VLGIIITMQSIDGSIALIGIKVAAALIGTFLGVFICYCFMDPLANAMEQEMKKRLSFFEC 239

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHN 286
           V+  L+ ++ G    +A++ GRK+LPL  +P+   +   + +    
Sbjct: 240 VRIVLVNHVAGKPSLLAVDSGRKMLPLDNKPTFATLDSWINKMEGA 285


>gi|291483904|dbj|BAI84979.1| flagellar motor protein MotA [Bacillus subtilis subsp. natto
           BEST195]
          Length = 269

 Score =  202 bits (513), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 58/288 (20%), Positives = 120/288 (41%), Gaps = 22/288 (7%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
           +++IG+ +  + +  G    G +   L  P  I+I+    +   V+A P K IK      
Sbjct: 4   TSLIGIILAFVALSVGMVLKGVSFSALANPAAILIIIAGTISAVVIAFPTKEIKKVPALF 63

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
             +F  K   Q T  +++ +        ++      E  I+D                  
Sbjct: 64  RVLF--KENKQLTIEELIPMFSEWAQLARREGLLALEASIEDVD---------------- 105

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
              F+ + + M + G + +  I ++M EE++ +           +  G   P +G++GA+
Sbjct: 106 -DAFLKNGLSMAVDGQS-AEFIRDIMTEEVEAMEDRHQAGAAIFTQAGTYAPTLGVLGAV 163

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           +G+I A+ ++  +   LG AI  +   TLLGI   Y L +P  +++K    ++ +L  ++
Sbjct: 164 IGLIAALSHM-DNTDELGHAISAAFVATLLGIFTGYVLWHPFANKLKRKSKQEVKLREVM 222

Query: 242 KKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKA 289
            + +++ + G  P+V  +     LP  +R        E       ++A
Sbjct: 223 IEGVLSVLEGQAPKVIEQKLLMYLPAKDRLKFAE-QGEAQNGEKKEEA 269


>gi|182412225|ref|YP_001817291.1| MotA/TolQ/ExbB proton channel [Opitutus terrae PB90-1]
 gi|177839439|gb|ACB73691.1| MotA/TolQ/ExbB proton channel [Opitutus terrae PB90-1]
          Length = 287

 Score =  202 bits (513), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 88/281 (31%), Positives = 142/281 (50%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  +IG  I     IGGF   GG+P +L+   E V++ G   G  V+A+P  V+K     
Sbjct: 1   MLILIGGLIVFASAIGGFMLAGGSPVLLLHASEFVVILGIAAGVLVIASPGHVLKHIVHK 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +      +  G+  + D+LKLLY +    ++      E H+ +P  S IF   P+VL + 
Sbjct: 61  VKGCIVSQNAGRQEFFDLLKLLYEIFMVGRRNGLIALEEHVMEPEKSVIFKRYPSVLNHA 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +   F+ + ++ +I G  +  ++E LM+ EID    E   P H +  +G+SLP IGIV A
Sbjct: 121 DRLEFLVNGLKPVIDGKIKPDQLEELMEAEIDAKSEEWDHPVHVLQLVGDSLPGIGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGII  M  ++  P+++G  +  +LTGTLLGI  +Y   NPL ++IK            
Sbjct: 181 VLGIINTMAAIADGPEMVGKKVAAALTGTLLGIFFAYGFVNPLANRIKFNNAADLLCLRC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
           + +A+  +  G  P  A+E  R+ L  S +P    +   + 
Sbjct: 241 IMQAVAGFAKGLAPLTAVEIARRSLDSSVQPGANELEVALK 281


>gi|288962675|ref|YP_003452969.1| chemotaxis protein [Azospirillum sp. B510]
 gi|288914941|dbj|BAI76425.1| chemotaxis protein [Azospirillum sp. B510]
          Length = 295

 Score =  202 bits (513), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 110/277 (39%), Positives = 172/277 (62%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  + GL      ++GGFYAMGG   +L QP EIVI+ GAG+GGF +AN   V++D+  +
Sbjct: 1   MRLMFGLIAVFASVLGGFYAMGGRMAVLWQPVEIVIIIGAGIGGFAIANSPAVLRDTLRA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  I   +A  ++ Y D++ L+Y L+   K    ++ E  ID P  S +FT  P VL  +
Sbjct: 61  VAAIARGRATPKNDYLDMIALVYGLLRVAKSKGMSQIEADIDKPAESPLFTQYPNVLRYD 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
              +F+CDY+R+I +G    +++E+LM EE++ +  E  +   A+ ++ ++LPA+GIV A
Sbjct: 121 RCISFLCDYLRLIALGQDNPHDLESLMAEELETLGRELNQVPKALQNLADALPALGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+I AMG +S++P++LG  IG +LTGT LG++LSY +  P+ S  +  R  +  +Y  
Sbjct: 181 VLGVINAMGAISEAPEVLGRMIGGALTGTFLGVLLSYGMVGPIASAARQRRESELNMYFC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVA 277
           +K AL AY+ G+ PQV  EY RKVL    +PS+  V 
Sbjct: 241 IKAALCAYLRGSPPQVCAEYARKVLYTDIQPSLAEVE 277


>gi|148380610|ref|YP_001255151.1| chemotaxis MotA protein [Clostridium botulinum A str. ATCC 3502]
 gi|153933911|ref|YP_001384896.1| chemotaxis MotA protein [Clostridium botulinum A str. ATCC 19397]
 gi|153934553|ref|YP_001388365.1| chemotaxis MotA protein [Clostridium botulinum A str. Hall]
 gi|148290094|emb|CAL84213.1| putative chemotaxis MotA protein [Clostridium botulinum A str. ATCC
           3502]
 gi|152929955|gb|ABS35455.1| chemotaxis protein MotA [Clostridium botulinum A str. ATCC 19397]
 gi|152930467|gb|ABS35966.1| chemotaxis protein MotA [Clostridium botulinum A str. Hall]
          Length = 270

 Score =  202 bits (513), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 52/276 (18%), Positives = 110/276 (39%), Gaps = 22/276 (7%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           + T IGL +    II G    G +  +      + I  G  L   ++  P+   K   V 
Sbjct: 6   ILTPIGLVLCFGLIIWGMATGGSSLKVFWDLASVFITIGGSLTAMLITYPIDEFKRLFVV 65

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +++ F    +       V++    L    ++      E+ I++                 
Sbjct: 66  IVQTFKDNGMSNID---VIQNFVDLSRKARREGLLSLEDAINNL---------------- 106

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               ++   +RM++ G      I ++M+ EID +          +   G   PA G++G 
Sbjct: 107 -TDDYMKKGLRMVVDG-IEPETIRDIMELEIDEMEKRHKSGADMLKTWGGYSPAFGMIGT 164

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G+I+ + NL+ S   + + +G +L  T  G +++  + NP+ + +      +     +
Sbjct: 165 LIGLIQMLANLTDS-STIASGMGKALITTFYGSVMANMVFNPMGANLMFKSGVEATTREM 223

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIV 276
           V + ++A  +G  P++  E     L  +ER +   V
Sbjct: 224 VLEGVLAIQSGVNPRIMEEKLVSYLSPTERLAYNKV 259


>gi|294339808|emb|CAZ88171.1| Motility protein A [Thiomonas sp. 3As]
          Length = 247

 Score =  202 bits (513), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 56/264 (21%), Positives = 107/264 (40%), Gaps = 22/264 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           + TI+G+ + +  I+ G    GG+   +IQ    +IV G   G  ++  PLKV   S   
Sbjct: 3   ILTIVGVVVALGSILLGQMLEGGHISSIIQGTAFLIVMGGTTGAVMLQFPLKVFIRSLKM 62

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +       +    + +K +       +K      E  I+                  
Sbjct: 63  LPWMVLPP---KGDPQETIKQILEWSDTARKNGLLALEAMIESV---------------- 103

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   ++M++ G     +I + +++EI  + +   +        G   P +GI+GA
Sbjct: 104 -PDPFVKKGLQMLVDG-TDPEKIRSTLEQEIGAVEHHDTQAAKVYESSGGYSPTVGILGA 161

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+I  M NL+  P  LG  I V+   T+ G+  +     P+ +++KS    + +L  +
Sbjct: 162 VLGLIHVMENLAD-PSKLGGGIAVAFVATVYGVGAANLFFLPVANKLKSIVHNRAKLQEM 220

Query: 241 VKKALIAYMNGAIPQVAIEYGRKV 264
               L+A   G  P++     +  
Sbjct: 221 QVDGLVAIAEGENPRIIEGRLQSY 244


>gi|296134256|ref|YP_003641503.1| MotA/TolQ/ExbB proton channel [Thermincola sp. JR]
 gi|296032834|gb|ADG83602.1| MotA/TolQ/ExbB proton channel [Thermincola potens JR]
          Length = 257

 Score =  202 bits (513), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 50/272 (18%), Positives = 109/272 (40%), Gaps = 22/272 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           +++I+G+   +L ++GGF A  G+   L+     +IV G  +G  V +  ++ IK     
Sbjct: 3   LTSILGIIFGLLSLVGGFVAEKGHVSSLLAGSAALIVFGGTIGATVASFKMEDIKSIPAL 62

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F           +++  L       ++      E    +                 
Sbjct: 63  LRIVFKEHKY---EVNELIVTLVGFAEKARREGLLSLERETANIE--------------- 104

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   +++++ G      + ++++ +I+ +              G   P +GI+G 
Sbjct: 105 --DDFLRQGIQLVVDG-TDPALVRDILETQIEFMDQRHKIGADIFESAGGYAPTMGIIGT 161

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  +GNLS  P+ LG AI  +   TL G+  +  L  P+  ++K    ++  +  +
Sbjct: 162 VMGLVHVLGNLSD-PESLGPAIASAFIATLYGVSSANILWLPMGHKLKLKSKQERFIKEV 220

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPS 272
             + +++   G  P +  E  R  L    R  
Sbjct: 221 ALEGILSIQAGDNPSIVGEKLRAFLSAKVRKE 252


>gi|168180923|ref|ZP_02615587.1| chemotaxis MotA protein [Clostridium botulinum NCTC 2916]
 gi|182668370|gb|EDT80349.1| chemotaxis MotA protein [Clostridium botulinum NCTC 2916]
          Length = 270

 Score =  201 bits (512), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 51/276 (18%), Positives = 110/276 (39%), Gaps = 22/276 (7%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           + T IGL +    +I G    G +  +      + I  G  L   ++  P+   K   V 
Sbjct: 6   ILTPIGLVLCFGLVIWGMATGGSSLKVFWDLASVFITIGGSLTAMLITYPIDEFKRLLVV 65

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +++ F    +       V++    L    ++      E+ I++                 
Sbjct: 66  IVQTFKDNGMSNID---VIQNFVDLSRKARREGLLSLEDAINNL---------------- 106

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               ++   +RM++ G      I ++M+ EID +          +   G   PA G++G 
Sbjct: 107 -TDDYMKKGLRMVVDG-IEPETIRDIMELEIDEMEKRHKSGADMLKTWGGYSPAFGMIGT 164

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G+I+ + NL+ S   + + +G +L  T  G +++  + NP+ + +      +     +
Sbjct: 165 LIGLIQMLANLTDS-STIASGMGKALITTFYGSVMANMVFNPMGANLMFKSGVEATTREM 223

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIV 276
           V + ++A  +G  P++  E     L  +ER +   V
Sbjct: 224 VLEGVLAIQSGVNPRIMEEKLVSYLSPTERLAYNKV 259


>gi|170755265|ref|YP_001782269.1| chemotaxis MotA protein [Clostridium botulinum B1 str. Okra]
 gi|169120477|gb|ACA44313.1| chemotaxis protein MotA [Clostridium botulinum B1 str. Okra]
          Length = 270

 Score =  201 bits (512), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 53/276 (19%), Positives = 110/276 (39%), Gaps = 22/276 (7%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           + T IGL +    II G    G N  +      + I  G  L   ++  P+   K   V 
Sbjct: 6   ILTPIGLVLCFGLIIWGMATGGSNLKVFWDLASVFITIGGSLTAMLITYPIDEFKRLLVV 65

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +++ F    +       V++    L    ++      E+ I++                 
Sbjct: 66  IVQTFKDNGMSNID---VIQNFVDLSRKARREGLLSLEDAINNL---------------- 106

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               ++   +RM++ G      I ++M+ EID +          +   G   PA G++G 
Sbjct: 107 -TDDYMKKGLRMVVDG-IEPETIRDIMELEIDEMEKRHKSGADMLKTWGGYSPAFGMIGT 164

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G+I+ + NL+ S   + + +G +L  T  G +++  + NP+ + +      +     +
Sbjct: 165 LIGLIQMLANLTDS-STIASGMGKALITTFYGSVMANMVFNPMGANLMFKSGVEATTREM 223

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIV 276
           V + ++A  +G  P++  E     L  +ER +   V
Sbjct: 224 VLEGVLAIQSGVNPRIMEEKLVSYLSPTERLAYNKV 259


>gi|222053742|ref|YP_002536104.1| MotA/TolQ/ExbB proton channel [Geobacter sp. FRC-32]
 gi|221563031|gb|ACM19003.1| MotA/TolQ/ExbB proton channel [Geobacter sp. FRC-32]
          Length = 256

 Score =  201 bits (511), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 60/267 (22%), Positives = 108/267 (40%), Gaps = 22/267 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           +++IIGL +    +IGG    GG+   +IQP   +IV G  +G   ++ PL  I ++   
Sbjct: 3   IASIIGLILGFGAVIGGQILEGGHVSAIIQPTAALIVLGGTIGATFVSFPLANILNALKD 62

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
             ++        +    V+K +       ++      E                      
Sbjct: 63  ARKVLFPPKDDPEA---VIKNIINYAAKARRNGLISLEQE-----------------AQT 102

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
              +F    + +++ G     ++   M+ E++                G   P IGI+GA
Sbjct: 103 VKDSFTKKGISLVVDG-IDPQKLRETMEIELNSFEEHAKASAEVFEAAGGFAPTIGIIGA 161

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+I  M NLS S   LG  I V+   T+ G++ +  +C P+++++K    +      +
Sbjct: 162 VLGLIHVMNNLSDS-SKLGAGIAVAFVATIYGLMTANIICIPISTKLKLRLKEAILQKEM 220

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPL 267
           V + LIA  NG  P    +  R  LP 
Sbjct: 221 VIEGLIAIQNGENPHFIEQKLRAYLPE 247


>gi|311031290|ref|ZP_07709380.1| flagellar motor protein MotP [Bacillus sp. m3-13]
          Length = 271

 Score =  201 bits (511), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 55/284 (19%), Positives = 114/284 (40%), Gaps = 24/284 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGG--NPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M T IGL + +  I+ G     G       +     +IV G  LG  ++   LK +K   
Sbjct: 6   MLTPIGLILGLAMILFGIINNSGLSGASSFLHFPSFLIVIGGTLGALLITFNLKELKVMP 65

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
             +   F  +    +   ++++    L    ++      E  ++D               
Sbjct: 66  TVIKAAFSRQE---NELPNLIQTFVRLSDRARREGLLALEAELEDVE------------- 109

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
                 FI   + + + G      I ++M+ EI  +    +K    +   G+  P+ G++
Sbjct: 110 ----DDFIKKGVLLAVDG-VEPEVIHDIMNAEISAMEERHMKGRSILEKAGDYAPSWGMI 164

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
           G ++G++  + NL+  P  LG  + +++  TL G +L+  +  P+ S++ +   K+  L 
Sbjct: 165 GTLIGLVLMLKNLND-PTTLGPNMAIAILTTLYGTLLANLVFLPMASKLANKTEKEVFLK 223

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQ 282
            I+ + +I   +G  P++  E     L   +R   +    E L+
Sbjct: 224 QIIIEGVIGVQSGQNPKILEEKLSAFLSNQDRERKDEAVAETLE 267


>gi|170758802|ref|YP_001787973.1| chemotaxis MotA protein [Clostridium botulinum A3 str. Loch Maree]
 gi|169405791|gb|ACA54202.1| chemotaxis protein MotA [Clostridium botulinum A3 str. Loch Maree]
          Length = 270

 Score =  201 bits (511), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 52/276 (18%), Positives = 110/276 (39%), Gaps = 22/276 (7%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           + T IGL +    II G    G +  +      + I  G  L   ++  P+   K   V 
Sbjct: 6   ILTPIGLVLCFGLIIWGMATGGSSLKVFWDLASVFITIGGSLTAMLITYPIDEFKRLLVV 65

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +++ F    +       V++    L    ++      E+ I++                 
Sbjct: 66  IVQTFKDNGMSNID---VIQNFVDLSRKARREGLLSLEDAINNL---------------- 106

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               ++   +RM++ G      I ++M+ EID +          +   G   PA G++G 
Sbjct: 107 -TDDYMKKGLRMVVDG-IEPETIRDIMELEIDEMEKRHKSGADMLKTWGGYSPAFGMIGT 164

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G+I+ + NL+ S   + + +G +L  T  G +++  + NP+ + +      +     +
Sbjct: 165 LIGLIQMLANLTDS-STIASGMGKALITTFYGSVMANMVFNPMGANLMFKSGVEATTREM 223

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIV 276
           V + ++A  +G  P++  E     L  +ER +   V
Sbjct: 224 VLEGVLAIQSGVNPRIMEEKLVSYLSPTERLAYNKV 259


>gi|153939356|ref|YP_001391953.1| chemotaxis MotA protein [Clostridium botulinum F str. Langeland]
 gi|152935252|gb|ABS40750.1| chemotaxis MotA protein [Clostridium botulinum F str. Langeland]
 gi|295319972|gb|ADG00350.1| chemotaxis MotA protein [Clostridium botulinum F str. 230613]
          Length = 270

 Score =  201 bits (510), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 52/276 (18%), Positives = 110/276 (39%), Gaps = 22/276 (7%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           + T IGL +    II G    G +  +      + I  G  L   ++  P+   K   V 
Sbjct: 6   ILTPIGLVLCFGLIIWGMATGGSSLKVFWDLASVFITIGGSLTAMLITYPIDEFKRLLVV 65

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +++ F    +       V++    L    ++      E+ I++                 
Sbjct: 66  IVQTFKDNGMSNID---VIQNFVDLSRKARREGLLSLEDAINNL---------------- 106

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               ++   +RM++ G      I ++M+ EID +          +   G   PA G++G 
Sbjct: 107 -TDDYMKKGLRMVVDG-IEPETIRDIMELEIDEMEKRHKSGADMLKTWGGYSPAFGMIGT 164

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G+I+ + NL+ S   + + +G +L  T  G +++  + NP+ + +      +     +
Sbjct: 165 LIGLIQMLANLTDS-STIASGMGKALITTFYGSVMANMVFNPMGANLMFKSGVEATTREM 223

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIV 276
           V + ++A  +G  P++  E     L  +ER +   V
Sbjct: 224 VLEGVLAIQSGVNPRIMEEKLVSYLSPTERLAYNKV 259


>gi|289523563|ref|ZP_06440417.1| chemotaxis protein PomA [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
 gi|289503255|gb|EFD24419.1| chemotaxis protein PomA [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
          Length = 245

 Score =  201 bits (510), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 49/265 (18%), Positives = 109/265 (41%), Gaps = 22/265 (8%)

Query: 14  IIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQD 73
           ++ G    GG+    I    ++IV G  LGG +++NP K +   G  L + F  ++    
Sbjct: 1   MVAGGIVAGGDTGAFINLPSLLIVVGGALGGTILSNPWKRVLSLGQILKKAFFSESP--- 57

Query: 74  TYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMI 133
               +++ +       ++      E+  +                      F+   ++++
Sbjct: 58  ELISIVQTMVSFAEKARREGLLSLEDDAEQLD-----------------DPFMRKSIQLV 100

Query: 134 IVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQ 193
           + G      +++++D EI ++               E  PA G++G ++G+I+ +GNL+ 
Sbjct: 101 VDG-TDPELVKSILDTEIGLLEERHAGNKFMFDTFAELAPAFGMLGTLIGLIQMLGNLND 159

Query: 194 SPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAI 253
            P  LG  + V+L  T  G +++     P+  ++     ++     +V + ++A   G  
Sbjct: 160 -PDALGPGMAVALITTFYGSMMANIFGIPIARKLTVRTQEEVMTREMVVEGILAIQAGEN 218

Query: 254 PQVAIEYGRKVLPLSERPSIEIVAQ 278
           P++  E  +  LP   R + E   +
Sbjct: 219 PRLVEERLKVFLPPKFREAFEEKEE 243


>gi|150390476|ref|YP_001320525.1| MotA/TolQ/ExbB proton channel [Alkaliphilus metalliredigens QYMF]
 gi|149950338|gb|ABR48866.1| MotA/TolQ/ExbB proton channel [Alkaliphilus metalliredigens QYMF]
          Length = 262

 Score =  201 bits (510), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 54/270 (20%), Positives = 112/270 (41%), Gaps = 23/270 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++TIIG+ + +  ++ G  A G +    +Q   ++IV G      ++A PL+ + D+   
Sbjct: 3   IATIIGIIVGLGFVVMGITADG-DIAGFLQLSSMLIVFGGTFSATLVAYPLQQVLDTIKI 61

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           + + F      +     ++K +  L    +K      E   +                  
Sbjct: 62  VSKAFSN---NKVDPGSIIKSIIELANVARKEGLLALEEAAEGINE-------------- 104

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   + +I+ G      + NL++ E+  I          +  MG   PA G+VG 
Sbjct: 105 ---DFLQKGVMLIVDG-TDPELVRNLLETELAFIEERHQGGQGLLEMMGALAPAFGMVGT 160

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G+I  + +L   P  +G  + V+L  T  G +++  +  PL +++K    ++     I
Sbjct: 161 LIGLINLLRDLDD-PASIGPNMSVALLTTFYGALMANLIFIPLANKLKLRSREEILRKEI 219

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSER 270
           + + L++   G  P++  E  +  LP   R
Sbjct: 220 MVEGLLSIQAGENPRIIEEKLKAFLPPKLR 249


>gi|319653377|ref|ZP_08007477.1| flagellar motor protein [Bacillus sp. 2_A_57_CT2]
 gi|317394861|gb|EFV75599.1| flagellar motor protein [Bacillus sp. 2_A_57_CT2]
          Length = 264

 Score =  200 bits (509), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 60/274 (21%), Positives = 119/274 (43%), Gaps = 21/274 (7%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
           +TIIG+ + I+ +  G    G +P +LI P  I+I+         +A P   IK      
Sbjct: 4   TTIIGVILGIIAVGVGMVFKGVSPSVLINPAAILIIILGTAAAVAIAFPTNEIKRVPKLF 63

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
             +F  + L      +++K+        +K      E   ++  N               
Sbjct: 64  GILFKEEKLM--NPAEMIKMFSDWAQLARKEGLLALEVKTNEIEN--------------- 106

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
             TF+ + + + + G + +  I +++ EEI+ +           S  G   P++G++GA+
Sbjct: 107 --TFLKNGLSLAVDGQS-ADYIRDVLSEEIEAMEERHQAGAQIFSQAGTYAPSLGVLGAV 163

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           +G+I A+GN+  +   LG AI  +   TLLGI   Y   +P  +++K    ++ ++  ++
Sbjct: 164 IGLIAALGNMEDT-TSLGHAISAAFVATLLGIFTGYVFWHPFANKLKRKSKQEAKIKSMM 222

Query: 242 KKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEI 275
            + +++ + G  P+V  +     LP  ER     
Sbjct: 223 IEGILSILEGEAPRVIEQKLASYLPAGERRKFLE 256


>gi|212638650|ref|YP_002315170.1| flagellar motor protein MotA [Anoxybacillus flavithermus WK1]
 gi|212560130|gb|ACJ33185.1| Flagellar motor protein A [Anoxybacillus flavithermus WK1]
          Length = 304

 Score =  200 bits (508), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 57/272 (20%), Positives = 118/272 (43%), Gaps = 21/272 (7%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
           +++IGL + I+ +  G    G +P +LI P  I+I+         +A P K I       
Sbjct: 42  TSLIGLILGIIAVGVGMVFKGVSPSVLINPAAILIILLGTAAAVTIAFPTKEISKVPKLF 101

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
             IF      +    +++ L        ++      E  + +                  
Sbjct: 102 GVIFKEPKTPK--IEELIPLFVEWANIARREGLLALEAKVAEID---------------- 143

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
              F+ + + + I G ++   I ++M EEI+ +    L      +  G   P +G++GA+
Sbjct: 144 -DPFLRNGLSLAIDGQSQ-EFIRDVMTEEIEAMEERHLANATIFTQAGTYAPTLGVLGAV 201

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           +G+I A+ ++S   + LG AI  +   TL+GI   Y L +P  +++K    ++ ++  ++
Sbjct: 202 VGLIAALQDMSD-IERLGHAISAAFVATLMGIFTGYVLWHPFANKLKRKSKEEIKVRQVM 260

Query: 242 KKALIAYMNGAIPQVAIEYGRKVLPLSERPSI 273
            + +++ + G  P+   +     LP+SER  +
Sbjct: 261 IEGVLSIIEGQAPRAIEQKLASYLPMSERQKL 292


>gi|134298232|ref|YP_001111728.1| flagellar motor protein MotA [Desulfotomaculum reducens MI-1]
 gi|134050932|gb|ABO48903.1| MotA/TolQ/ExbB proton channel [Desulfotomaculum reducens MI-1]
          Length = 268

 Score =  200 bits (508), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 67/289 (23%), Positives = 118/289 (40%), Gaps = 24/289 (8%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
           STIIGLF+ I  I  G    G +   L  P  I+I+         +A P+  +K     L
Sbjct: 4   STIIGLFLGITAISVGMVLKGAHLSSLWNPAAIMIIFVGTAASLFIAFPMSELKKIPRLL 63

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
                   L      +V+     L    ++      E+ ++                   
Sbjct: 64  KITLQEPKLMAK--REVVNTFVALASTARREGLLSLESQLESID---------------- 105

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
              ++   M+MII G + +  ++ +M+EEI              +  G   P +G++GA+
Sbjct: 106 -DPYLRGGMQMIIDG-SDAEFVKFVMEEEIYATEERHRSGALIFTQAGTYAPTLGVLGAV 163

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           +G+I A+GNLS   + LG +I  +   TLLGI   Y L +P+ +++K    K+  +  ++
Sbjct: 164 VGLIAALGNLSD-IEKLGHSIAAAFVATLLGIFSGYVLWHPIANKLKRISKKEMEIKQMI 222

Query: 242 KKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
            + ++A   G  P    +     L  SER S +    E       ++A+
Sbjct: 223 VEGVLAIQTGRSPIAIEQQLLVYLSPSERSSSKE---EAENDGKAQRAA 268


>gi|167463461|ref|ZP_02328550.1| MotA [Paenibacillus larvae subsp. larvae BRL-230010]
          Length = 265

 Score =  200 bits (508), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 59/269 (21%), Positives = 113/269 (42%), Gaps = 22/269 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++T++GL I +  +IGGF   GG+   L+ P  ++IV G  +G  V++ P  V+K    +
Sbjct: 3   LATLLGLIIGLGALIGGFLWDGGHLSSLVIPSAMLIVFGGTIGAVVVSFPGSVLKKIPKA 62

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L   F           + +  +  +    ++      E                      
Sbjct: 63  LGIAFKPANTNP---IETIDDIVDMATIARREGVLALEQR-----------------AQE 102

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+ D + M++ G         +++ E+D I  +           G   P +GI+G 
Sbjct: 103 HPNEFLRDGLMMVVDG-TDPELTRQILELEMDSIEQQNEGMTKMFESAGGYSPTMGIIGT 161

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G+I  +GNL + P  LG AI V+ T TL G++ +  +  P+ ++I+    +Q     +
Sbjct: 162 VMGLIHVLGNL-EDPSALGPAIAVAFTATLYGVMAANVIYLPIGNKIRIRSKEQISQMEL 220

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSE 269
           + + ++A   G  PQ+  +     L   E
Sbjct: 221 MLEGILALQAGENPQLIKKKLTSFLNEKE 249


>gi|298530632|ref|ZP_07018034.1| MotA/TolQ/ExbB proton channel [Desulfonatronospira thiodismutans
           ASO3-1]
 gi|298510006|gb|EFI33910.1| MotA/TolQ/ExbB proton channel [Desulfonatronospira thiodismutans
           ASO3-1]
          Length = 253

 Score =  200 bits (508), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 51/272 (18%), Positives = 108/272 (39%), Gaps = 23/272 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           +ST++G+ I            GG+P + I     +IV G  +G  ++  PL  +      
Sbjct: 3   ISTVLGIVIAFGLFATSITL-GGSPAVFINFPAALIVLGGTIGATMVNYPLGHVLGLVGV 61

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +   F  K    +    + +         ++      E  I +                 
Sbjct: 62  IKHAFMKKV---EDPASITEQFIQYANKARREGILSLEPVIKEVD--------------- 103

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               ++   +++ + G      I+ +M+ EI  I          +  MG   PA+G++G 
Sbjct: 104 --DPYLKKGLQLTVDGM-EPQTIQEIMETEISHIEDRHQTGADILGAMGAFAPAMGMIGT 160

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           I+G++  + +L   P  +G A+ ++L  T  G+IL+  L  P++ ++K+   ++  +  +
Sbjct: 161 IIGLVLMLQDLDD-PAAIGPAMAIALITTFYGVILANVLFVPMSGKLKTRSKEEILVKEM 219

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPS 272
           + + ++    G  P++  E     LP   R S
Sbjct: 220 MLEGILCISKGENPRIIEEKFNSYLPPKIRRS 251


>gi|254444187|ref|ZP_05057663.1| transporter, MotA/TolQ/ExbB proton channel family protein
           [Verrucomicrobiae bacterium DG1235]
 gi|198258495|gb|EDY82803.1| transporter, MotA/TolQ/ExbB proton channel family protein
           [Verrucomicrobiae bacterium DG1235]
          Length = 286

 Score =  200 bits (508), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 86/286 (30%), Positives = 145/286 (50%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  IIG  I +   +G F   GG+  +L  P EI+ + G  LG  V+  P  V+  +  +
Sbjct: 1   MFVIIGSLIVLGATVGAFIWSGGSLILLWHPPEILAIGGISLGVAVICAPKDVLIHTVHA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +L         +D Y D++K++Y L    ++      + H+  P +S+IF + P+ L + 
Sbjct: 61  ILGALKGAGPSKDDYLDLMKVMYELFMLGRRNGLLALDEHVSSPESSSIFQNYPSFLADK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +  TF+C  +R II G  +  ++E L+  EID   +    P + +  +G+SLP IGIV A
Sbjct: 121 DKVTFLCSALRPIIDGKIKPDQLEPLLKAEIDAKKHAAHGPINVLHLLGDSLPGIGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++GII  M  L Q   ++G  I  +L+GT LGI ++Y   NPL + I+     +   YI 
Sbjct: 181 VMGIILTMSVLDQGVMVIGGKISAALSGTFLGIFVAYGFINPLCNVIEFGNEAEETYYIC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHN 286
           + +++ A+  G  P +A+E  R+ L  S  PS + +   +      
Sbjct: 241 MSRSIGAFARGLAPIMAVELARRSLEASMVPSADDLENILKSSTGG 286


>gi|317151981|ref|YP_004120029.1| MotA/TolQ/ExbB proton channel [Desulfovibrio aespoeensis Aspo-2]
 gi|316942232|gb|ADU61283.1| MotA/TolQ/ExbB proton channel [Desulfovibrio aespoeensis Aspo-2]
          Length = 253

 Score =  200 bits (508), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 45/268 (16%), Positives = 107/268 (39%), Gaps = 23/268 (8%)

Query: 3   TIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLL 62
           T+IG+ ++   ++      G +  I I      IV G  LG  ++  PL  +      + 
Sbjct: 5   TVIGIVLSFGLVVAA-ILSGSSLIIFISVPSFFIVIGGTLGAAMVNYPLSYVIGLVGVIK 63

Query: 63  EIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNEL 122
             F            ++          ++      E  I +                   
Sbjct: 64  NTFFSSLESPRE---IIDRFKDYANRARREGILSLEPLIKEID----------------- 103

Query: 123 TTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAIL 182
             ++   +++ + G      I+ +++ E+  +          ++ +G   PA+G++G ++
Sbjct: 104 DDYMRKGLQLTVDG-LEPQTIQEILETEVSYLSERHATGADVVAVLGTLAPAMGMIGTVV 162

Query: 183 GIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVK 242
           G+++ +  +S  P  +G A+ V+L  TL G +L+  + NP+  ++K+   ++  L  ++ 
Sbjct: 163 GLVQMLQTMSD-PSTIGPAMAVALLTTLYGAMLANLVFNPMAGKLKARSKEEILLREMIM 221

Query: 243 KALIAYMNGAIPQVAIEYGRKVLPLSER 270
           + +++   G  P++  E     LP  +R
Sbjct: 222 EGILSISKGENPRIIEEKLNSYLPPKDR 249


>gi|213584596|ref|ZP_03366422.1| flagellar motor protein MotA [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-0664]
          Length = 247

 Score =  200 bits (508), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 83/240 (34%), Positives = 135/240 (56%)

Query: 49  NPLKVIKDSGVSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNST 108
           N  K IK +  ++  +F      +  Y D+L LLY LM   ++      E  I++P  S 
Sbjct: 1   NNGKAIKGTMKAIPLLFRRSKYTKSMYMDLLALLYRLMAKSRQQGMFSLERDIENPKESE 60

Query: 109 IFTSIPTVLENNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHM 168
           IF S P +L +  +  FI DY+R+II GN  ++EIE LMDEEI+    E   P ++++ +
Sbjct: 61  IFASYPRILADAVMLDFIVDYLRLIISGNMNTFEIEALMDEEIETHESEAEVPANSLAMV 120

Query: 169 GESLPAIGIVGAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIK 228
           G+SLPA GIV A++G++ A+ +  +    LG  I  ++ GT LGI+L+Y   +PL + ++
Sbjct: 121 GDSLPAFGIVAAVMGVVHALASADRPAAELGALIAHAMVGTFLGILLAYGFISPLATVLR 180

Query: 229 STRLKQHRLYIIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
               +  ++   VK  L++ +NG  P +A+E+GRK L  SERPS   + + V    +  +
Sbjct: 181 QKSAETTKMMQCVKITLLSNLNGYAPPIAVEFGRKTLYSSERPSFIELEEHVRAVRNPNQ 240


>gi|326386938|ref|ZP_08208552.1| flagellar motor protein MotA [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326208618|gb|EGD59421.1| flagellar motor protein MotA [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 287

 Score =  199 bits (507), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 86/281 (30%), Positives = 152/281 (54%), Gaps = 4/281 (1%)

Query: 5   IGLFITILCIIGGFYAMGGNPYILIQ--PFEIVIVAGAGLGGFVMANPLKVIKDSGVSLL 62
           IG+ + I+ + GGF   GG    +++  P E++I+ GA +G  +  N L  +K  G  L 
Sbjct: 5   IGIVVLIVMVFGGFAFTGGALGPVMEAIPHELLIIGGAAIGATITGNSLHELKGIGAGLG 64

Query: 63  EIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNEL 122
           ++F      +  + D + L   LM  L+       E+H+ DP  STIF   P +L N  L
Sbjct: 65  KVFKGPKHNKQDHVDAIVLSTKLMKILRSDGPVALESHVTDPKTSTIFAEFPRILGNKAL 124

Query: 123 TTFICDYMRMIIV--GNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            + ICD + +I+V  G    + +E++MD  +    +E+ +  HA+  + ++LPA+GIV A
Sbjct: 125 VSLICDTLTLIVVSSGTLEVHAVEDVMDHAMKTHFHEESEAQHALQGLSDALPALGIVAA 184

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG++K MG++ + P ILG  IG +L GT +GI+L+Y +  PL  ++K    +   ++  
Sbjct: 185 VLGVVKTMGSIDKPPTILGAMIGSALVGTFMGILLAYGIVAPLAGRLKQVLDQDEMIFQA 244

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
           VK+ ++A ++G    + +E  R  L  + RP +  +   + 
Sbjct: 245 VKQVIVASLHGWPQPLVVESARSGLGHAFRPGLSELLDALR 285


>gi|307824076|ref|ZP_07654303.1| flagellar motor protein MotA [Methylobacter tundripaludum SV96]
 gi|307734860|gb|EFO05710.1| flagellar motor protein MotA [Methylobacter tundripaludum SV96]
          Length = 282

 Score =  199 bits (507), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 92/285 (32%), Positives = 144/285 (50%), Gaps = 3/285 (1%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I G  I  + I+GGF   GG+P +L QPFE VI+ GA +G FV  N + VIK +   
Sbjct: 1   MLVIAGYLILSISIMGGFIGGGGHPGVLFQPFEFVIIIGAAVGAFVCGNSMSVIKAAISQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
                      ++ Y ++L   Y +    +K      E+ IDDP +S +FT  P +L ++
Sbjct: 61  ATATLKGTKYNKEYYLELLLCFYAITTKTRKEGLLSLESIIDDPKSSPVFT--PRILGDH 118

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FICD +R+I+ G    Y +E LMD+E++    E   P  AI ++ + LPA GIV A
Sbjct: 119 HLLEFICDNLRLIVTG-VEVYALEELMDQELETHHEEAHAPVKAIQNLADGLPAFGIVAA 177

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  M ++   P  LG  I  +L GT LGI+L+Y    P+ + +         +Y  
Sbjct: 178 VMGVVHTMESVGIPPSELGKLIAAALVGTFLGILLAYGFIGPVGAVMSERFEASGNVYKC 237

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
            +K L+    G  P +  EY R ++  S RP    + +++     
Sbjct: 238 AQKGLLCCAKGVSPAMTAEYMRTMIASSMRPGFLELEEQLRANKG 282


>gi|269836611|ref|YP_003318839.1| MotA/TolQ/ExbB proton channel [Sphaerobacter thermophilus DSM
           20745]
 gi|269785874|gb|ACZ38017.1| MotA/TolQ/ExbB proton channel [Sphaerobacter thermophilus DSM
           20745]
          Length = 268

 Score =  199 bits (506), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 57/267 (21%), Positives = 109/267 (40%), Gaps = 24/267 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++TIIGL + +  ++  F   GG+   L+     +IV G   G  + ++ L   K     
Sbjct: 3   LATIIGLILGVAALVVAFILEGGHLTSLLGITAFMIVFGGTFGATIASHSLDDAKRIPSL 62

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +L  F      +     ++  L  L    ++      E+ + D                 
Sbjct: 63  ILRAFKAPPDRRRM---LIDELVTLAEVARRDGLLALEDRVID----------------- 102

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   + +++ G         +++ +I+ +     + Y   S MG   P +GI+G 
Sbjct: 103 --DPFLQRAVTLVVDG-TDPEVTRAVLESDIEAMEARHARGYGMFSTMGGFAPTMGIIGT 159

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G+I  + NLS SP  LG AI V+   TL G+  +  +  P+ +++K    ++     I
Sbjct: 160 VMGLIHVLSNLS-SPDELGPAIAVAFLATLYGVASANLIWIPIGNKLKYRSQQEADERWI 218

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPL 267
           V + ++    G  P+V  E     LP 
Sbjct: 219 VVEGVMGLQAGDNPRVLREKLTATLPP 245


>gi|149191180|ref|ZP_01869438.1| MotA/TolQ/ExbB proton channel [Vibrio shilonii AK1]
 gi|148835018|gb|EDL51997.1| MotA/TolQ/ExbB proton channel [Vibrio shilonii AK1]
          Length = 288

 Score =  199 bits (506), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 77/281 (27%), Positives = 130/281 (46%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  +IG+ I +  I GGF  +GG    + +  EI+I+ GA     +M+     +K     
Sbjct: 1   MQKLIGIVIVLSVIFGGFIFLGGKFEFIFKLSEIIIIFGAAFASLLMSTTSATMKLMAQQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +   F      +D Y  +L L++ L+   +  +    + H+++P +S IF+  P +  + 
Sbjct: 61  VGIAFRSTPYNKDYYQQLLSLMFELINTARVQNIKALDIHVENPDSSKIFSKYPKITSDA 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
             T FI D  R +I G    + +E  ++EEI+ +  E  KP   +    E++P +GI+ A
Sbjct: 121 LTTQFIIDSFRQVITGKQSQHVLEAFLEEEIEHLEDEYTKPSEKLHATAEAMPGLGILAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++GII  M  L      +G  I  +L GT  G+   Y +  P++S IK     Q    + 
Sbjct: 181 VMGIILTMQGLDGEISEIGQNIAGALVGTFTGVFGCYCVLGPMSSSIKDVSENQLAPLLC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
           VK  L AY  G    +    GRK +    +PS   + + V 
Sbjct: 241 VKSILSAYAQGQSAHMCANAGRKNIETRYKPSFVELEKAVE 281


>gi|56421065|ref|YP_148383.1| flagellar motor protein MotA [Geobacillus kaustophilus HTA426]
 gi|56380907|dbj|BAD76815.1| motility protein A (flagellar motor rotation) [Geobacillus
           kaustophilus HTA426]
          Length = 263

 Score =  199 bits (506), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 62/269 (23%), Positives = 117/269 (43%), Gaps = 21/269 (7%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
           +++IG+ + ++ +  G Y  G +P +LI P  I+I+        V+A P   IK      
Sbjct: 4   TSVIGIILGVIAVGLGMYFKGVSPAVLINPAAILIILVGTAAAVVIAFPTHEIKKVPKLF 63

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
             IF        T   ++ L        ++      E  +DD                  
Sbjct: 64  KVIFTES--TTPTVEQLIPLFVDWANIARREGLLALEAKLDDID---------------- 105

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
              F+ + + M I G  +   I ++M EEI  +           S  G   P +G++GA+
Sbjct: 106 -DPFLRNGLSMAIDGQTQ-EFIRDVMTEEIVAMEERHEANAAIFSQAGTYAPTLGVLGAV 163

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           +G+I A+GN+ ++   LG AI  +   T+LGI   Y L +P  ++++    ++ R+  I+
Sbjct: 164 IGLIAALGNM-ENIAELGKAISAAFVATMLGIFTGYVLWHPFANKLRRKSKEEARVRYIM 222

Query: 242 KKALIAYMNGAIPQVAIEYGRKVLPLSER 270
            + +++ + G  P++  +     LP +ER
Sbjct: 223 IEGVLSILEGQAPRMIEQKLASYLPENER 251


>gi|119947182|ref|YP_944862.1| MotA/TolQ/ExbB proton channel [Psychromonas ingrahamii 37]
 gi|119865786|gb|ABM05263.1| MotA/TolQ/ExbB proton channel [Psychromonas ingrahamii 37]
          Length = 287

 Score =  199 bits (506), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 91/287 (31%), Positives = 159/287 (55%), Gaps = 1/287 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  + GL   + C+ GGF  +GGN  +L +P EI+I+ GAG G  ++ +    +      
Sbjct: 1   MIRLAGLVFIMFCLFGGFMIVGGNLKLLWKPTEILIIFGAGSGALIVGSSKNCLILITSQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKK-GSRNETENHIDDPYNSTIFTSIPTVLEN 119
           L ++F      ++ Y  +L L Y LM   K        E+H++D  NS+IF   P VL N
Sbjct: 61  LKDVFTVNPYSKEFYRQLLSLHYQLMRVKKMPSGAKVLESHVEDYENSSIFNQYPLVLRN 120

Query: 120 NELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVG 179
           + L  FI D  RM I     ++EI+  ++ EI++I  E L+P  A+  + +SLP +G++G
Sbjct: 121 DLLVHFIVDNFRMTISSLVAAHEIDATLESEIEVITSELLEPAVALKKLADSLPGLGVLG 180

Query: 180 AILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYI 239
           A++GII  M ++     ++G+ I  +L GT LG+   Y L +PL+  +KS  +K    + 
Sbjct: 181 AVMGIILTMQSIDTDIAMIGSNIATALIGTFLGVFGCYCLFDPLSCAVKSNVMKSIVPFE 240

Query: 240 IVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHN 286
           +VK+ L+A+++   P ++I+ GR+ + + E+P+ +I+ +   Q +  
Sbjct: 241 VVKQILVAHVSNRSPLLSIDSGRRAIEIDEKPAFKIIEEWADQLDKP 287


>gi|253702422|ref|YP_003023611.1| MotA/TolQ/ExbB proton channel [Geobacter sp. M21]
 gi|251777272|gb|ACT19853.1| MotA/TolQ/ExbB proton channel [Geobacter sp. M21]
          Length = 254

 Score =  199 bits (505), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 60/265 (22%), Positives = 103/265 (38%), Gaps = 22/265 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           +STIIG+ + I  + GG    G +   LIQP   +IV G       ++ PL  +  +   
Sbjct: 3   LSTIIGILLGIGAVFGGAALEGLHMSALIQPTAAIIVLGGTAAATFVSYPLPTLLTAVKD 62

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L ++F       +    V+K +       ++      E                      
Sbjct: 63  LRKVFIPPNEDPE---GVIKNIINYAAKARRNGLISLEQE-----------------AQT 102

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
              +F    + +++ G     ++   M+ E+                 G   P IGI+GA
Sbjct: 103 VKDSFTKKGISLVVDG-IDPQKLRETMEIELGSFEAHAKGSAEVFESAGGFAPTIGIIGA 161

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+I  M NLS  P  LG  I V+   T+ G++++   C P  +++K    ++     +
Sbjct: 162 VLGLIHVMSNLSD-PSKLGGGIAVAFVATIYGLMVANIFCIPFGTKLKHRLKEELLQKEM 220

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVL 265
           V + LIA  NG  P    +  R  L
Sbjct: 221 VIEGLIAIQNGENPHFIEQKLRAYL 245


>gi|322421652|ref|YP_004200875.1| MotA/TolQ/ExbB proton channel [Geobacter sp. M18]
 gi|320128039|gb|ADW15599.1| MotA/TolQ/ExbB proton channel [Geobacter sp. M18]
          Length = 254

 Score =  199 bits (505), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 57/265 (21%), Positives = 103/265 (38%), Gaps = 22/265 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           +STIIG+ + +  + GG    G +   LIQP   +IV G      +++ P+  +  +   
Sbjct: 3   LSTIIGIALGLFAVFGGAALEGLHMSALIQPTAAMIVLGGTAAATIVSFPVPTLLAAVKD 62

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           + ++F       +    V+K +       ++      E                      
Sbjct: 63  VKKVFMPPKDDPE---GVIKNIINYAAKARRNGLISLEQE-----------------AQT 102

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
              +F    + +++ G     ++   M+ E+                 G   P IGI+GA
Sbjct: 103 VKDSFTKKGISLVVDG-IDPQKLRETMEIELSSFESHAKHSAEVFEAAGGFAPTIGIIGA 161

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+I  M NLS  P  LG  I V+   T+ G++ +   C P  +++K    ++     +
Sbjct: 162 VLGLIHVMSNLSD-PSKLGGGIAVAFVATIYGLMTANIFCIPFGTKLKCRLKEELLQKEM 220

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVL 265
           V + LIA  NG  P    +  R  L
Sbjct: 221 VIEGLIAIQNGENPHFIEQKLRAYL 245


>gi|163789639|ref|ZP_02184077.1| MotA/TolQ/ExbB proton channel [Carnobacterium sp. AT7]
 gi|159875171|gb|EDP69237.1| MotA/TolQ/ExbB proton channel [Carnobacterium sp. AT7]
          Length = 269

 Score =  199 bits (505), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 51/285 (17%), Positives = 105/285 (36%), Gaps = 29/285 (10%)

Query: 4   IIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLE 63
           IIGL +    II       GN    I    +VI  G      +++ PLK IK     L  
Sbjct: 8   IIGLILGFGLIIWS-ITSSGNIASFIDTPSLVITLGGSFSAILISFPLKSIKTLPSILKT 66

Query: 64  IFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELT 123
           +          Y ++++    L    +       E  I+   N                 
Sbjct: 67  LVLDPNPN---YNELIETFASLSRKARSQGILAIEEDIEQQDN----------------- 106

Query: 124 TFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILG 183
             +   ++M++ G      + ++M+   + I              GE  PA G++G ++G
Sbjct: 107 ELMVSGLQMVVDG-LEPETVRDIMEITTENIEKRHSVGQDIFLKWGEMAPAYGMIGTLIG 165

Query: 184 IIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKK 243
           +I  +G L   P  +G  +  +L  T  G  L+  +  P+ S +++  +++ +   ++ +
Sbjct: 166 LIIMLGELDD-PSTIGVGMATALITTFYGSFLANLVFIPIASNLQNQTIEEMKFCEMIIE 224

Query: 244 ALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKK 288
            +++   G  P+V  +  +  LP       E     + +    ++
Sbjct: 225 GVLSLQAGENPRVIEQKLKGYLP------FENKEDAMKEAAKIQQ 263


>gi|302037672|ref|YP_003797994.1| flagellar motor protein MotA [Candidatus Nitrospira defluvii]
 gi|300605736|emb|CBK42069.1| Flagellar motor protein MotA [Candidatus Nitrospira defluvii]
          Length = 256

 Score =  199 bits (505), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 61/270 (22%), Positives = 109/270 (40%), Gaps = 22/270 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++TI+G+ I I  I+GG    GG+   ++Q    +IV G  +G   + NPL V+  S   
Sbjct: 3   IATILGVVIAIGSILGGQALEGGHVGSVLQLTAFIIVMGGTIGACCVQNPLSVVLKSISM 62

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +                 +  +  L    +K      E  I D +               
Sbjct: 63  VSLALTNP---PHDVKGTITQILDLANVSRKQGLLALEGKIKDLH--------------- 104

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F    +++I+ G      ++ +++ E++    E +         G   P +GI+GA
Sbjct: 105 --DPFFKKGIQLIVDG-TDPKLLQEILEIEVEHHEEEGVHAAKVWEAAGGYAPTVGILGA 161

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+I  M NL+  P  LG  I V+   T+ G+  +     P+ +++K    ++  L  +
Sbjct: 162 VLGLIHVMENLAD-PSKLGGGIAVAFVATVYGVGAANLFFLPIGNKMKFKLKEEAGLRTM 220

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSER 270
           V   L+    G  P++  E     LP  ER
Sbjct: 221 VIMGLVGLAQGENPRLLQEKLESFLPPHER 250


>gi|294498804|ref|YP_003562504.1| chemotaxis protein MotA [Bacillus megaterium QM B1551]
 gi|295704126|ref|YP_003597201.1| chemotaxis protein MotA [Bacillus megaterium DSM 319]
 gi|294348741|gb|ADE69070.1| chemotaxis protein MotA [Bacillus megaterium QM B1551]
 gi|294801785|gb|ADF38851.1| chemotaxis protein MotA [Bacillus megaterium DSM 319]
          Length = 264

 Score =  198 bits (504), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 64/277 (23%), Positives = 123/277 (44%), Gaps = 21/277 (7%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
           ++ IGL + I  +I G +  G NP +L  P  I+I+    +G  V+A P   IK      
Sbjct: 4   TSFIGLILGIASLIVGMFFKGVNPSVLGNPAAILIIIVGTVGAVVIAFPSNEIKRVPKLF 63

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
             +F  + + Q    D++ +       ++K      E  I D                  
Sbjct: 64  GVLFKEQKMLQ--PVDLVSMFSEWGQVVRKEGLLSLEAQIIDVD---------------- 105

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
              F+ + + + I G + +  I +++ EEID +           +  G   P +G++GA+
Sbjct: 106 -DPFLKNGLNLAIDGQS-ADYIRDVLSEEIDAMEERHQTGASIFALAGTYAPTLGVLGAV 163

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           +G+I A+GN+  +   LG AI  +   TLLGI   Y L +P  +++K     + ++  ++
Sbjct: 164 IGLIAALGNMEDT-DTLGHAISAAFVATLLGIFTGYVLWHPFANKLKRKSKHEVKVKYMM 222

Query: 242 KKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQ 278
            + +++ + G  P+V  +     LP +ER  +   ++
Sbjct: 223 IEGVLSLLEGETPKVIEQKLASYLPTAERKKLLQESE 259


>gi|239906205|ref|YP_002952944.1| chemotaxis protein MotA [Desulfovibrio magneticus RS-1]
 gi|239796069|dbj|BAH75058.1| chemotaxis protein MotA [Desulfovibrio magneticus RS-1]
          Length = 281

 Score =  198 bits (504), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 84/281 (29%), Positives = 148/281 (52%), Gaps = 1/281 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  ++GL + I  +  G+   GG   +L+QP E VI+ GA LG  ++ +    +      
Sbjct: 1   MIVMVGLLVVIASVCLGYLMEGGVFAVLVQPAEWVIIIGAALGAMLVGSTRNALTLIVKG 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L +      +G+D Y + L  L  L+  +++      E  I+ P  S IF     + ++ 
Sbjct: 61  LPKALFPAHIGRDHYLEALACLARLLGKIRREGLMSIEGDIEHPETSPIFAKATLLSKDK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               FICD MR+ +V    + E+E LMD ++  I  +   P H +  + ESLP +GIV A
Sbjct: 121 AALAFICDTMRVYLVSG-DAQELEQLMDLDLAAIHLQASSPAHNLGKVAESLPGLGIVAA 179

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG++  MG +SQ P++LG +IG +L GT LG++L Y    PL   +++  +++   + +
Sbjct: 180 VLGVVLTMGKISQPPEVLGHSIGAALVGTFLGVLLCYGFVGPLAGNLENQAMERQTYFSV 239

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
           ++  +     GA P +A+EYGR+ +P + RP+   +  ++ 
Sbjct: 240 IRAVIAGAARGATPLIAVEYGRRAIPEALRPNFADLEGQLK 280


>gi|261418452|ref|YP_003252134.1| flagellar motor protein MotA [Geobacillus sp. Y412MC61]
 gi|319767587|ref|YP_004133088.1| MotA/TolQ/ExbB proton channel [Geobacillus sp. Y412MC52]
 gi|261374909|gb|ACX77652.1| MotA/TolQ/ExbB proton channel [Geobacillus sp. Y412MC61]
 gi|317112453|gb|ADU94945.1| MotA/TolQ/ExbB proton channel [Geobacillus sp. Y412MC52]
          Length = 263

 Score =  198 bits (504), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 63/269 (23%), Positives = 118/269 (43%), Gaps = 21/269 (7%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
           +++IG+ + ++ +  G Y  G +P +LI P  I+I+        V+A P + IK      
Sbjct: 4   TSVIGIILGVIAVGLGMYFKGVSPAVLINPAAILIILVGTAAAVVIAFPTQEIKKVPKLF 63

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
             IF        T   ++ L        ++      E  +DD                  
Sbjct: 64  KVIFTES--TTPTVEQLIPLFVDWANIARREGLLALEAKLDDID---------------- 105

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
              F+ + + M I G  +   I ++M EEI  +           S  G   P +G++GA+
Sbjct: 106 -DPFLRNGLSMAIDGQTQ-EFIRDVMTEEIVAMEERHEANAAIFSQAGTYAPTLGVLGAV 163

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           +G+I A+GN+ ++   LG AI  +   T+LGI   Y L +P  ++++    ++ R+  I+
Sbjct: 164 IGLIAALGNM-ENIAELGKAISAAFVATMLGIFTGYVLWHPFANKLRRKSKEEARVRYIM 222

Query: 242 KKALIAYMNGAIPQVAIEYGRKVLPLSER 270
            + +++ + G  P++  +     LP SER
Sbjct: 223 IEGVLSILEGQAPRMIEQKLASYLPESER 251


>gi|158320523|ref|YP_001513030.1| MotA/TolQ/ExbB proton channel [Alkaliphilus oremlandii OhILAs]
 gi|158140722|gb|ABW19034.1| MotA/TolQ/ExbB proton channel [Alkaliphilus oremlandii OhILAs]
          Length = 261

 Score =  198 bits (504), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 54/280 (19%), Positives = 110/280 (39%), Gaps = 23/280 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++TI+G+FI +  +I G    G + +  I    I I  G  +   ++  PL+ +  +   
Sbjct: 3   LATILGIFIGMFFVIQGITQEG-SIWNFIDMSSIYITFGGMIAATLVGFPLQNVLAAFKI 61

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
             + F  KA   D    ++  +  L    +K      E                      
Sbjct: 62  GGKAFFNKA---DDPKAIIAQINTLANIARKEGLLALEEASGQIDE-------------- 104

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+     +I+ G      + NL++ E+  I             +G + PA G+VG 
Sbjct: 105 ---PFLKKGAMLIVDG-TDPELVRNLLETELSFIEERHRNGQAIFEALGANAPAFGMVGT 160

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  +  L   P  +G ++ V+L  T  G + +  +  P+ +++K    ++     I
Sbjct: 161 LIGLVNMLKKLDD-PSAIGPSMAVALITTFYGSLFANLIFLPMATKLKLKSREEILRKEI 219

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEV 280
           + + L++   G  P++  E  +  LP  ER +     + V
Sbjct: 220 MVEGLLSIQAGENPRIIEEKLKAFLPPKERENYNSKQEGV 259


>gi|149183514|ref|ZP_01861941.1| flagellar motor protein MotA [Bacillus sp. SG-1]
 gi|148848786|gb|EDL63009.1| flagellar motor protein MotA [Bacillus sp. SG-1]
          Length = 266

 Score =  197 bits (502), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 54/276 (19%), Positives = 112/276 (40%), Gaps = 21/276 (7%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
           +++IG+ + +  +  G    G     L+    I+I+    +G   +A P   IK      
Sbjct: 4   TSLIGVILGVFAVGVGMVLKGVPVDKLMNLPAILIIIFGTIGAVTIAFPTSEIKRVPKLF 63

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
             +F  K        +++ +        ++      E                       
Sbjct: 64  GVLF--KENTLQEPKELITMFSEWADLARREGLLALEAKTSGIE---------------- 105

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
              F+ + M + + G   +  I ++++EEID +           +  G   P +G++GA+
Sbjct: 106 -DPFLKNGMGLAVDGQ-NADYIRDVLNEEIDAMEERHQAGALIFTQAGTYAPTLGVLGAV 163

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           +G+I A+G + +    LG AI  +   TLLGI   Y L +P  +++K    ++ ++ +++
Sbjct: 164 VGLIAALGYM-EDISKLGEAISAAFVATLLGIFTGYVLWHPFANKLKRKSKQEVKIKVMM 222

Query: 242 KKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVA 277
            + +++ + G  P+V  +     LP SER  I    
Sbjct: 223 IEGVLSIIEGEAPRVIEQKLASYLPASERKRIMEEE 258


>gi|197120113|ref|YP_002140540.1| chemotaxis protein MotA [Geobacter bemidjiensis Bem]
 gi|197089473|gb|ACH40744.1| chemotaxis MotA protein [Geobacter bemidjiensis Bem]
          Length = 254

 Score =  197 bits (502), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 59/265 (22%), Positives = 103/265 (38%), Gaps = 22/265 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           +STIIG+ + I  + GG    G +   L+QP   +IV G      +++ PL  +  +   
Sbjct: 3   LSTIIGILLGIGAVFGGAALEGLHMSALMQPTAAIIVLGGTAAATIVSYPLPTLLTALKD 62

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L ++F       +    V+K +       ++      E                      
Sbjct: 63  LKKVFMPPNEDPE---GVIKNIINYAAKARRNGLISLEQE-----------------AQT 102

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
              +F    + +++ G     ++   M+ E+                 G   P IGI+GA
Sbjct: 103 VKDSFTKKGISLVVDG-IDPQKLRETMEIELGSFEAHAKGSAEVFESAGGFAPTIGIIGA 161

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+I  M NLS  P  LG  I V+   T+ G++ +   C P  +++K    ++     +
Sbjct: 162 VLGLIHVMSNLSD-PSKLGGGIAVAFVATIYGLMTANIFCIPFGTKLKHRLKEELLQKEM 220

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVL 265
           V + LIA  NG  P    +  R  L
Sbjct: 221 VIEGLIAIQNGENPHFIEQKLRAYL 245


>gi|300853353|ref|YP_003778337.1| chemotaxis protein [Clostridium ljungdahlii DSM 13528]
 gi|300433468|gb|ADK13235.1| chemotaxis protein [Clostridium ljungdahlii DSM 13528]
          Length = 264

 Score =  197 bits (501), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 59/281 (20%), Positives = 110/281 (39%), Gaps = 20/281 (7%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           +S +I     I  +  GF   GGNP  L      VIV G   G   ++ PL V+K     
Sbjct: 3   ISVVIFTIFGIAAVTAGFVMDGGNPTALFGGAAAVIVFGGTFGAVALSFPLDVLKRVPKI 62

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
              IF  +        D++     + Y  +K      E  I +               + 
Sbjct: 63  FKVIFNPRKAS---LVDLILYFKDVSYKTRKNGLLSLEGEISN---------------DP 104

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FI   +++++ G      + ++++ E++       +        G   P +GI+G 
Sbjct: 105 NLDPFIKKGLQLVVDG-VDPQAVRDILELELESTSERHKQGASVFESAGGYGPTMGIIGT 163

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  +G+L+ +   LG  IG +   TL GI  +  L  PL +++K    K+ +   +
Sbjct: 164 VMGMVHILGSLTDTAS-LGGKIGSAFLATLYGIGSANLLWLPLGNRLKQQDEKEVKEKTL 222

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
           + +A++    G  P    E  +  L   E    E +  +  
Sbjct: 223 IIEAILYIQEGINPNTIAEKLKGFLNKQELAKYEGMDGKAE 263


>gi|326791533|ref|YP_004309354.1| MotA/TolQ/ExbB proton channel [Clostridium lentocellum DSM 5427]
 gi|326542297|gb|ADZ84156.1| MotA/TolQ/ExbB proton channel [Clostridium lentocellum DSM 5427]
          Length = 260

 Score =  197 bits (501), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 47/274 (17%), Positives = 108/274 (39%), Gaps = 22/274 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           +STIIGL   I+ ++       G   + I    ++IV G  +    ++ P+    +   +
Sbjct: 3   ISTIIGLVSGIVFVLISIVLGDGRIMLFIDYPSMLIVFGGIISALFVSYPIPKFLEGLKT 62

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
              +F  + +      +V+  +  L  + +K      E                  +   
Sbjct: 63  GKHVFSKQEIDP---TEVISKINELALSARKEGLLALEE-----------------IAQG 102

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   + +I+ G   +  + ++++ EI  +             + E  PA G++G 
Sbjct: 103 MDDPFLQKGILLIVDG-TDAELLRSILETEIAFVENRHKDNQKFWDSIAELGPAWGMIGT 161

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G+I  + NL+  P  LG  + V+L  T  G +++  +  P+++++      +     +
Sbjct: 162 LIGLIIMLDNLND-PSTLGPKMAVALVTTFYGSMIANLVATPISNKLSLRSNDEILHKQV 220

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIE 274
           + + L++   G  P+V  E  +  L    R   +
Sbjct: 221 MVEGLLSIQAGENPRVIEEKLKAFLSPGTRKVFD 254


>gi|229543004|ref|ZP_04432064.1| MotA/TolQ/ExbB proton channel [Bacillus coagulans 36D1]
 gi|229327424|gb|EEN93099.1| MotA/TolQ/ExbB proton channel [Bacillus coagulans 36D1]
          Length = 267

 Score =  197 bits (501), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 61/278 (21%), Positives = 122/278 (43%), Gaps = 21/278 (7%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
           S+IIG+ + ++ I  G    G +P +L+ P  ++I+        ++  P+  +K     L
Sbjct: 4   SSIIGVILGVVAIGTGMVLKGVSPAVLVNPAALLIILAGTAASVIIGFPMSELKKVPKLL 63

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
             IF  + L      ++++         ++      E  +D+                  
Sbjct: 64  KIIFTEQKLMSTE--EMIRFFSDWAQTARREGLLALEARLDEVD---------------- 105

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
              F+ + + + I G + +  I +++ EEI+ +           S  G   P +G++GA+
Sbjct: 106 -DAFLKNGLSLAIDGQS-AEYIRDVLSEEIEAMEERHQMGAAIFSQAGTYAPTLGVLGAV 163

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           LG+I A+GN+S + ++LG AI  +   TLLGI   Y L +P  +++K     + +   I+
Sbjct: 164 LGLIAALGNMSDT-EVLGHAISAAFVATLLGIFTGYVLWHPFANKLKRKSKNEAKNKEIM 222

Query: 242 KKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQE 279
            + +++ + G  P+V  +     LP  ER  +     E
Sbjct: 223 LEGILSILAGESPRVIEQKLASYLPNEERIRLMEEITE 260


>gi|239827802|ref|YP_002950426.1| flagellar motor protein MotA [Geobacillus sp. WCH70]
 gi|239808095|gb|ACS25160.1| MotA/TolQ/ExbB proton channel [Geobacillus sp. WCH70]
          Length = 263

 Score =  197 bits (501), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 59/270 (21%), Positives = 114/270 (42%), Gaps = 21/270 (7%)

Query: 13  CIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQ 72
            +  G Y  G NP +LI P  I+I+    +    +A P + IK        +F  K    
Sbjct: 15  AVGVGMYFKGVNPSVLINPAAILIIIVGTIASVTIAFPTREIKKVPKLFGVLF--KEQNI 72

Query: 73  DTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRM 132
            T  +++ L        ++      E  +D+                     F+ + + M
Sbjct: 73  PTIEELIPLFVDWANVARREGLLALEAKLDEID-----------------DPFLRNGLSM 115

Query: 133 IIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLS 192
            I G  +   I ++M EEI+ +           S  G   P +G++GA++G+I A+GN+ 
Sbjct: 116 AIDGQTQ-DFIRDVMTEEIEAMEERHEANAAIFSQAGTYAPTLGVLGAVIGLISALGNI- 173

Query: 193 QSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGA 252
            +   LG AI  +   TLLGI   Y L +P  ++++    ++ ++  ++ + +++ + G 
Sbjct: 174 DNISELGKAISAAFVATLLGIFTGYVLWHPFANKLRRKSKEEAKIRRVMIEGVLSILEGQ 233

Query: 253 IPQVAIEYGRKVLPLSERPSIEIVAQEVLQ 282
            P+   +     LP +ER  I    ++  +
Sbjct: 234 APRTIEQKLASYLPETERKKIVEQGEKRNE 263


>gi|332981442|ref|YP_004462883.1| MotA/TolQ/ExbB proton channel [Mahella australiensis 50-1 BON]
 gi|332699120|gb|AEE96061.1| MotA/TolQ/ExbB proton channel [Mahella australiensis 50-1 BON]
          Length = 267

 Score =  197 bits (501), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 51/269 (18%), Positives = 107/269 (39%), Gaps = 23/269 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++TI GL   I  I  G      N         I+I  G  +   +++ PL  + ++   
Sbjct: 3   IATIAGLIAGIAFIAIGILLN-ANLLTYYDLPSIMITLGGTIASTLISYPLSNVLNTLGI 61

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  +F  K        D++     L    ++      E                      
Sbjct: 62  IKNVFFVKRQNPKEIMDII---LNLANTARREGLLALEEAAYQLD--------------- 103

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   + +I+ G      ++N+M+ E++ I     + +  +  MG   PA G++G 
Sbjct: 104 --DPFMRKGILLIVDG-TDPELVKNIMETELNYIEERHKQGWGLLETMGNYAPAFGMIGT 160

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G+I  + NL+  P  +G  + V++T T  G +L+  +  P+  ++K    ++  L  +
Sbjct: 161 LIGLINMLRNLND-PDTIGPNMAVAITTTFYGSVLANLIFLPMAQKLKVRSAEEMLLKEL 219

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSE 269
           V + +++   G  P++  E  +  LP   
Sbjct: 220 VLEGVLSIQAGENPRIIEEKLKAFLPPKL 248


>gi|116329295|ref|YP_799015.1| endoflagellar motor protein [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116330098|ref|YP_799816.1| endoflagellar motor protein [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
 gi|116122039|gb|ABJ80082.1| Endoflagellar motor protein [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116123787|gb|ABJ75058.1| Endoflagellar motor protein [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
          Length = 260

 Score =  197 bits (501), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 50/269 (18%), Positives = 105/269 (39%), Gaps = 22/269 (8%)

Query: 3   TIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLL 62
           T++G     + +I G  + G +P  L     I+I  G    G +MA P +     G    
Sbjct: 5   TVVGFGAACVLMIFGIISAGLSPLDLFDVPSILITFGGATAGTIMAVPWESTLAVGKVTQ 64

Query: 63  EIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNEL 122
           ++F  +        +++K L       ++      E+ +                 N   
Sbjct: 65  KVFKTEKH---DLIELIKTLVSFSEKARREGLLALEDDV-----------------NELP 104

Query: 123 TTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAIL 182
             F+   + +++ G      + N+M+ E+  I            + G   PA G++G ++
Sbjct: 105 DEFLRKGITLVVDG-TDPELVRNIMETEMGNIASRHNNGKAWWENWGALAPAFGMIGTLI 163

Query: 183 GIIKAMGNLS-QSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           G+++ + NL    P  +GT +  +L  TL G + +     P+  ++      +  +  I+
Sbjct: 164 GLVQMLKNLGSGDPSAIGTGMAAALITTLYGSMGANMFAIPVMKKLMRKSEDELTIKQIM 223

Query: 242 KKALIAYMNGAIPQVAIEYGRKVLPLSER 270
            +  ++  +G  P++  +     LP SER
Sbjct: 224 IEGTLSIQSGDNPRIVKDKLSSFLPPSER 252


>gi|89100105|ref|ZP_01172974.1| flagellar motor protein [Bacillus sp. NRRL B-14911]
 gi|89085195|gb|EAR64327.1| flagellar motor protein [Bacillus sp. NRRL B-14911]
          Length = 272

 Score =  197 bits (500), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 58/277 (20%), Positives = 111/277 (40%), Gaps = 24/277 (8%)

Query: 2   STIIGLFITILCIIGGFYAMGG--NPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGV 59
            T IGLFI    ++ G    GG       + P  ++I+ G  + G +++ PL+ IK S  
Sbjct: 7   LTPIGLFIGFAMLVFGIMTNGGFSGFLSFVDPASMLIILGGLISGLLVSFPLRDIKHSFT 66

Query: 60  SLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLEN 119
            + + F      +    +++ +   L    ++      E  I+                 
Sbjct: 67  VVRQSFSN---DEKNLAEIIDVFVKLSDKARREGLLSLETEIEQME-------------- 109

Query: 120 NELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVG 179
                FI   + + + G      I ++M+ EI  +     K    +   GE  PA G++G
Sbjct: 110 ---DPFIRKGVLLAVDG-LEPDVINDIMNAEIAAMEERHRKGRSILEKAGEYAPAWGMIG 165

Query: 180 AILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYI 239
            ++G++  + NL+  P  LG  + ++L  TL G +L+  +  P+ +++     K+  L  
Sbjct: 166 TLIGLVLMLKNLND-PASLGPNMAIALLTTLYGSLLANLVFLPMAAKLLLKTEKEVFLKQ 224

Query: 240 IVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIV 276
           IV + ++    G  P++  E     L   ER      
Sbjct: 225 IVIEGVLGVQAGQNPRLLEEKLGAFLSAQERKEKYEA 261


>gi|147678454|ref|YP_001212669.1| flagellar motor component [Pelotomaculum thermopropionicum SI]
 gi|146274551|dbj|BAF60300.1| flagellar motor component [Pelotomaculum thermopropionicum SI]
          Length = 262

 Score =  197 bits (500), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 47/270 (17%), Positives = 109/270 (40%), Gaps = 22/270 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           +++++GL I ++ ++  F   GG+   L++P   +IV G  +G  +++     +      
Sbjct: 3   LTSLVGLAIAVVSLVAAFVLDGGHIMALLKPTAALIVFGGTIGATIVSFSFNELAAVPRL 62

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
              I   K         +++ +  L   +++      EN +                   
Sbjct: 63  FKVILFQKLP---DEVALIEQIVGLADKVRREGLLYLENQLPQIG--------------- 104

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   +++++ G      +  +M+ E+  I              G   P +GI+G 
Sbjct: 105 --DAFMRKGIQLVVDG-TDPELVRRIMETEMYAIQERHHSSASIFEAAGGYAPTMGILGT 161

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  + NL +SP+ LG +I ++   TL G+  +     P+  ++K+   K+  L  +
Sbjct: 162 VMGLVHVLSNL-ESPETLGPSIALAFIATLYGVGSANVFWLPIADKLKNMSKKEIMLREM 220

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSER 270
           + + +++   G  P +  E     L    R
Sbjct: 221 MLEGIMSIQAGYNPILIRERLTAFLKPKGR 250


>gi|332702328|ref|ZP_08422416.1| MotA/TolQ/ExbB proton channel [Desulfovibrio africanus str. Walvis
           Bay]
 gi|332552477|gb|EGJ49521.1| MotA/TolQ/ExbB proton channel [Desulfovibrio africanus str. Walvis
           Bay]
          Length = 253

 Score =  197 bits (500), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 49/271 (18%), Positives = 103/271 (38%), Gaps = 23/271 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++TIIGL +    ++ G         I I     VIV G  +G  ++  P+  +      
Sbjct: 3   LATIIGLVLAFGLVVAGIMMN-STLLIYIDIPSAVIVLGGTIGAALVNYPIGHMMSVLKV 61

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
             +              ++          ++      E  + +                 
Sbjct: 62  CRKTLFASMDDPKD---IISRFMDYANRARREGILSLEPILKEID--------------- 103

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               ++   +++ + G      I+ +M+ EI  +          +  MG   PA+G++G 
Sbjct: 104 --DEYLKKGLQLTVDG-LEPQTIQEIMETEIHYLESRHETGAEILGAMGNYAPALGMIGT 160

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  +  +S  P  +G A+ V+L  T  G +L+  + NP+  ++K    ++  L  +
Sbjct: 161 VIGLVAMLSTMSD-PSTIGPAMAVALITTFYGALLANLVFNPMAGKLKLRSRQEVLLREM 219

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERP 271
           V + ++A   G  P++  E     L  SER 
Sbjct: 220 VLEGILAISKGENPRIIEEKLNSYLAPSERK 250


>gi|39998118|ref|NP_954069.1| chemotaxis MotA protein [Geobacter sulfurreducens PCA]
 gi|39985063|gb|AAR36419.1| chemotaxis MotA protein [Geobacter sulfurreducens PCA]
 gi|298507056|gb|ADI85779.1| chemotaxis MotA protein [Geobacter sulfurreducens KN400]
          Length = 254

 Score =  196 bits (499), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 59/267 (22%), Positives = 105/267 (39%), Gaps = 22/267 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++TIIGL +    + GG    G +   LIQP   +IV G   G   ++ P+K I  +   
Sbjct: 3   IATIIGLVMGFGAVFGGALLEGLHLTALIQPTAAIIVLGGTFGAAFVSFPMKTIIGAAKD 62

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           + ++        +    V+K L       ++      E    +                 
Sbjct: 63  IKKVLMPAQNDPE---KVIKDLIGYAAKARRNGLISLEQEAQNVK--------------- 104

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F    + +++ G     ++   ++ E+        +        G   P IGI+GA
Sbjct: 105 --DPFTKKGISLVVDG-IDPQKLRETLEIEVTYYEEHAKQSAEFFEAAGGYAPTIGIIGA 161

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+I  MGNLS S   LG  I V+   T+ G++ +  +C P  ++IK    ++     +
Sbjct: 162 VLGLIHVMGNLSDS-SKLGAGIAVAFVATIYGLMTANIICLPFGTKIKHGIKEELICKNM 220

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPL 267
           + + LIA  NG  P    +  +  L  
Sbjct: 221 IIEGLIAIQNGENPHFIEQKLKAFLQH 247


>gi|242281266|ref|YP_002993395.1| MotA/TolQ/ExbB proton channel [Desulfovibrio salexigens DSM 2638]
 gi|242124160|gb|ACS81856.1| MotA/TolQ/ExbB proton channel [Desulfovibrio salexigens DSM 2638]
          Length = 253

 Score =  196 bits (499), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 45/271 (16%), Positives = 108/271 (39%), Gaps = 23/271 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           + T+IG+ ++   ++     +G +  I I    ++IV G  +G  ++  P+  +      
Sbjct: 3   LGTVIGIVLSFGLVL-SAILVGSSLAIFISVPSVLIVIGGTIGASLVNYPMGHVLGVVGV 61

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           + + F            ++          ++      E  +                   
Sbjct: 62  IKKTFFSSLESPGE---IIDKFMDFANRARREGILSLEPALKSIE--------------- 103

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   +++ + G      I+ +++ EI  +          +    +  PA+G++G 
Sbjct: 104 --DDFLRKGLQLTVDG-LEPQVIQEILETEIQYLENRHETGAEILKVFADFAPAMGMIGT 160

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G+++ +  +S  P  +G A+ V+L  TL G IL+  +  P++ ++K+   ++  L  +
Sbjct: 161 VIGLVQMLQTMSD-PSTIGPAMAVALLTTLYGAILANLVFTPMSGKLKTRSKEEILLREM 219

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERP 271
           V + +I+   G  P++  E     LP   R 
Sbjct: 220 VMEGIISISKGENPKIIEEKLNSFLPPKIRK 250


>gi|320354971|ref|YP_004196310.1| MotA/TolQ/ExbB proton channel [Desulfobulbus propionicus DSM 2032]
 gi|320123473|gb|ADW19019.1| MotA/TolQ/ExbB proton channel [Desulfobulbus propionicus DSM 2032]
          Length = 261

 Score =  196 bits (498), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 59/281 (20%), Positives = 108/281 (38%), Gaps = 25/281 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++T+IGL + +  ++GG    G +   L+QP   +IV G   G   ++ PL  +  +   
Sbjct: 3   IATLIGLVLGLGAVVGGAALEGLHLNALVQPTAALIVLGGTFGAAFVSFPLPTVLRAFKD 62

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           + ++        D    ++  +       +K      E                      
Sbjct: 63  VKKLLAGSPKNDD----IIADICAFAAKARKNGIIALEQDAKS----------------- 101

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   + + + G     EI  L++ ++     +           G   P IGI+GA
Sbjct: 102 HKDRFMKKAISLSVDG-IDPKEIRELLEIDMSATEEQAKMSAEFFEAAGGYAPTIGIIGA 160

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+I  M NLS +   LG  I V+   T+ G+I +  LC P  ++IK     +     +
Sbjct: 161 VLGLIHVMSNLSDT-SKLGAGIAVAFVATIYGLITANILCLPAATKIKLRIKDEMVRKEM 219

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVL--PLSERPSIEIVAQE 279
           +   ++A  NG  P+   E  R  L     ++PS     + 
Sbjct: 220 IIAGVVAIQNGENPRFIEERLRSYLGGEGDDKPSAVAEEEA 260


>gi|194014874|ref|ZP_03053491.1| chemotaxis protein MotA (Motility protein A) [Bacillus pumilus ATCC
           7061]
 gi|194013900|gb|EDW23465.1| chemotaxis protein MotA (Motility protein A) [Bacillus pumilus ATCC
           7061]
          Length = 264

 Score =  196 bits (498), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 61/282 (21%), Positives = 122/282 (43%), Gaps = 21/282 (7%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
           +++IG+ +  + +  G    G +   LI P  I+I+    +   V+A P   IK +    
Sbjct: 4   TSLIGIILAFIALSVGMVLKGVSLTALINPAAILIIVVGTIAAVVIAFPSSEIKKTPKLF 63

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
            +IF    L   T  +++ L        ++      E  I++                  
Sbjct: 64  GKIFKDNKLP--TIQEMIPLFSNWAQIARREGLLALEASIEEVD---------------- 105

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
              F+ + + M + G + +  I +++ EE+D +           +  G   P +G++GA+
Sbjct: 106 -DDFLKNGLSMAVDGQS-AEFIRDVLTEEVDAMSERHQSGALIFTQAGTYAPTLGVLGAV 163

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           +G+I A+ N+    + LG AI  +   TLLGI   Y L +P  +++K    ++ +L +I+
Sbjct: 164 VGLIAALANMGD-IEALGHAISAAFVATLLGIFTGYVLWHPFANKLKRKSKEEVKLRLIM 222

Query: 242 KKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQY 283
            + +++ + G  P+V  +     LP  ER ++ I   E    
Sbjct: 223 IEGILSVLEGQSPKVIEQKLLMYLPAKERANLVIEEGEKQNG 264


>gi|302343735|ref|YP_003808264.1| MotA/TolQ/ExbB proton channel [Desulfarculus baarsii DSM 2075]
 gi|301640348|gb|ADK85670.1| MotA/TolQ/ExbB proton channel [Desulfarculus baarsii DSM 2075]
          Length = 254

 Score =  195 bits (497), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 50/275 (18%), Positives = 116/275 (42%), Gaps = 23/275 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++TIIG+      ++      GG+  + I P  I+IV G  +G  ++  P++ I      
Sbjct: 3   LATIIGIVSAFALVLAAM-LYGGSLTMFIDPASILIVIGGTIGVTLINYPMRDIVKLFSI 61

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  +F YK +       ++          ++      E+ + +                 
Sbjct: 62  MKHLFFYKIVP---VGKIISQFVEFATRARREGILALESSMKEVD--------------- 103

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   +++ I G      I+ +++ EID +             MG   PA+G++G 
Sbjct: 104 --DPFLAKGLQLTIDG-LEPASIKEILETEIDYVGERHRLGAEIFMTMGTFAPAMGMIGT 160

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G+++ + N+S  P  +G A+ V++  T  G +++  +  P++ ++K+   ++     I
Sbjct: 161 LIGLVQMLQNMSD-PSSIGPAMAVAILTTFYGSVMANMIFLPMSGKLKNRSSEEVMTKEI 219

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEI 275
           +   +++   G  P+V  +     +P + R S+  
Sbjct: 220 MLNGILSIARGDNPRVIEQKLHSFIPPNLRQSVFK 254


>gi|323700141|ref|ZP_08112053.1| MotA/TolQ/ExbB proton channel [Desulfovibrio sp. ND132]
 gi|323460073|gb|EGB15938.1| MotA/TolQ/ExbB proton channel [Desulfovibrio desulfuricans ND132]
          Length = 253

 Score =  195 bits (497), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 45/270 (16%), Positives = 110/270 (40%), Gaps = 23/270 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           + TIIG+ ++   ++      G +  I +    ++IV G  +G  ++  P+  +      
Sbjct: 3   LGTIIGIVLSFGLVL-SAIMTGSSLIIFVSVPSLLIVVGGTIGAGLVNYPMNYVIGVIGV 61

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +   F           +V+          ++      E  I +                 
Sbjct: 62  IKNTFFSSLDSP---AEVIDRFKDYANRARREGILSLEPLIKEID--------------- 103

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               ++   +++ + G      I+ +++ EI  +          +S +G   PA+G++G 
Sbjct: 104 --DDYMRKGLQLTVDG-LEPQTIQEILETEISYLAERHATGADVVSALGTLAPAMGMIGT 160

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G+++ +  +S  P  +G A+ V+L  TL G I++  +  P+  ++K+   ++  L  +
Sbjct: 161 VIGLVQMLQTMSD-PSSIGPAMAVALLTTLYGAIIANLVLMPMAGKLKARSKEEVLLREM 219

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSER 270
           + + +++   G  P++  E     LP  +R
Sbjct: 220 IMEGILSISKGENPRIIEEKLNSYLPPKDR 249


>gi|78358628|ref|YP_390077.1| chemotaxis protein MotA [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|78221033|gb|ABB40382.1| chemotaxis protein MotA [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 254

 Score =  195 bits (497), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 48/271 (17%), Positives = 111/271 (40%), Gaps = 23/271 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++TI+G+ I+   ++ G    GG+  I +    ++IV G  +G  ++  PL  +      
Sbjct: 3   LATILGIVISFGLVLAG-ILEGGSIMIFVSIPSLLIVVGGTIGATLVNYPLATVLGVMGV 61

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           + + F   A        +++         ++      E  I +                 
Sbjct: 62  IKKTFNASAQSPS---SIIEQFMDFANRARREGILSLEPVIKEVE--------------- 103

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               ++   +++ + G      I+ +++ EI  +          I+ MG   PA+G++G 
Sbjct: 104 --DAYLRKGLQLTVDG-LEPQAIQEILETEISSLESRHETGVEIINAMGAYAPALGMIGT 160

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G+++ +  +S  P  +G A+ V+L  T  G +L+  +  P+  ++K    ++  +  +
Sbjct: 161 VIGLVQMLQTMSD-PSSIGPAMAVALITTFYGAVLANLVFIPMAGKLKMRSREEVTMREM 219

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERP 271
             + ++A   G  P++  E      P  ER 
Sbjct: 220 QMEGILAISRGENPRIIQEKLSSYQPPKERK 250


>gi|260438797|ref|ZP_05792613.1| chemotaxis protein PomA [Butyrivibrio crossotus DSM 2876]
 gi|292808786|gb|EFF67991.1| chemotaxis protein PomA [Butyrivibrio crossotus DSM 2876]
          Length = 269

 Score =  195 bits (496), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 50/276 (18%), Positives = 104/276 (37%), Gaps = 25/276 (9%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYI---LIQPFEIVIVAGAGLGGFVMANPLKVIKDS 57
           ++T+IGL   I  +I G              +    I+I  G   G  ++++ +K     
Sbjct: 3   LATLIGLIACIALVIMGIITGDDGVAALKNFVDFKSILITFGGAFGATLISHKMKDFIGG 62

Query: 58  GVSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVL 117
                     +   Q    + +K +  L    +K      E   ++              
Sbjct: 63  LKGFALALKQRNYDQ---TEAIKNIIELSNVARKEGLLALEEAAENIEE----------- 108

Query: 118 ENNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGI 177
                  F+   + +I+ G      +  +++ EI  +     K       +    PA G+
Sbjct: 109 ------PFMKKGILLIVDG-TEPDLVRAILETEITCVEQRHKKVAGFWDTLAAMGPAWGM 161

Query: 178 VGAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRL 237
           VG ++G+I  + N+S     LG  + V+L  TL G +L+  +  P+ ++++     +  L
Sbjct: 162 VGTLIGLINMLKNMSD-ASALGPNMAVALITTLYGSMLANWIAMPIANKLRVNNSDEIIL 220

Query: 238 YIIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSI 273
             ++ + L++   G  P+V  E  +  L  ++R S 
Sbjct: 221 KEVMIEGLLSIQAGENPRVIEEKLKSFLSPNDRNSY 256


>gi|154685778|ref|YP_001420939.1| flagellar motor protein MotA [Bacillus amyloliquefaciens FZB42]
 gi|154351629|gb|ABS73708.1| MotA [Bacillus amyloliquefaciens FZB42]
          Length = 271

 Score =  195 bits (496), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 57/275 (20%), Positives = 114/275 (41%), Gaps = 21/275 (7%)

Query: 16  GGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDTY 75
            G    G +   L  P  I+I+    +   ++A P K IK        +F  K   Q T 
Sbjct: 18  VGMVLKGVSLSALANPAAILIILFGTISAVIIAFPGKEIKKVPALFKVLF--KENKQLTI 75

Query: 76  CDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMIIV 135
             ++ +        ++      E  I+D                     F+ + + M + 
Sbjct: 76  AQLIPMFSQWAQIARREGLLALEASIEDVD-----------------DAFLKNGLSMAVD 118

Query: 136 GNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQSP 195
           G + +  I ++M EE++ +           +  G   P +G++GA++G+I A+ N++ + 
Sbjct: 119 GQS-AEFIRDIMTEEVEAMEDRHQAGAAIFTQAGTYAPTLGVLGAVIGLIAALSNMN-NT 176

Query: 196 KILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIPQ 255
           + LG AI  +   TLLGI   Y L +P  +++K    ++ +L  I+ + +++ + G  P+
Sbjct: 177 EALGHAISAAFVATLLGIFTGYVLWHPFANKLKRKSKQEVKLREIMIEGVLSVLEGQAPK 236

Query: 256 VAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           V  +     LP +ER  +     E       ++ +
Sbjct: 237 VIEQKLLMYLPANERAKVAEQEGEANNGEKKEEEA 271


>gi|157692041|ref|YP_001486503.1| flagellar motor protein MotA [Bacillus pumilus SAFR-032]
 gi|157680799|gb|ABV61943.1| flagellar motor protein A [Bacillus pumilus SAFR-032]
          Length = 264

 Score =  195 bits (496), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 61/282 (21%), Positives = 122/282 (43%), Gaps = 21/282 (7%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
           +++IG+ +  + +  G    G +   LI P  I+I+    +   V+A P   IK +    
Sbjct: 4   TSLIGIILAFIALSVGMVLKGVSLTALINPAAILIIVVGTIAAVVIAFPSSEIKKTPKLF 63

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
            +IF    L   T  +++ L        ++      E  I++                  
Sbjct: 64  GKIFKDNKLP--TIQEMIPLFSNWAQIARREGLLALEASIEEVD---------------- 105

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
              F+ + + M + G + +  I +++ EE+D +           +  G   P +G++GA+
Sbjct: 106 -DDFLKNGLSMAVDGQS-AEFIRDVLTEEVDAMAERHQSGALIFTQAGTYAPTLGVLGAV 163

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           +G+I A+ N+    + LG AI  +   TLLGI   Y L +P  +++K    ++ +L +I+
Sbjct: 164 VGLIAALANMGD-IEALGHAISAAFVATLLGIFTGYVLWHPFANKLKRKSKEEVKLRLIM 222

Query: 242 KKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQY 283
            + +++ + G  P+V  +     LP  ER ++ I   E    
Sbjct: 223 IEGILSVLEGQSPKVIEQKLLMYLPAKERANLVIEEGEKQNG 264


>gi|218887299|ref|YP_002436620.1| MotA/TolQ/ExbB proton channel [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218758253|gb|ACL09152.1| MotA/TolQ/ExbB proton channel [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 252

 Score =  195 bits (495), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 53/272 (19%), Positives = 114/272 (41%), Gaps = 23/272 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++T++G+ I+   I G   +MGGNP   +    ++IV G  LG  ++  PL V       
Sbjct: 3   LATVLGILISFGLI-GTALSMGGNPLFFVDSAALLIVLGGTLGAALVHYPLPVALRVLSI 61

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
             + F  +    D    V+       +  ++      E  + +                 
Sbjct: 62  TRKAFATRLHRID---LVIDQFMEFAHRARREGLLSLEPAVRNLD--------------- 103

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   +++ I G      I  +M+ EI  +           + +    PA+G+VG 
Sbjct: 104 --DPFLRKGLQLTIDG-LEPDAIREIMESEIAALETRHSMGVDIFNALASYAPALGLVGT 160

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G+++ + +++  P  +G A+ V+L  T  G++L+  +  PL  +++    ++ +L  +
Sbjct: 161 LIGLVQMLRSMND-PSAIGPAMAVALITTFYGVVLANLVFLPLAGKLRHRSKEEVQLMEM 219

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPS 272
             + ++A   G  P++ +E      P  ER +
Sbjct: 220 QLEGILAIARGENPRIILEKLSCYQPPRERRT 251


>gi|257095367|ref|YP_003169008.1| flagellar motor protein [Candidatus Accumulibacter phosphatis clade
           IIA str. UW-1]
 gi|257047891|gb|ACV37079.1| MotA/TolQ/ExbB proton channel [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
          Length = 241

 Score =  195 bits (495), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 54/262 (20%), Positives = 105/262 (40%), Gaps = 22/262 (8%)

Query: 4   IIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLE 63
           ++GL I  L I+GG    GG+   L QP  ++IV G  LG  ++ +P          +  
Sbjct: 1   MLGLLIGFLAIVGGQLLEGGHVGSLSQPTALLIVVGGTLGAVMLQSPYATFVRGMRMVKW 60

Query: 64  IFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELT 123
           ++    +       +++ +       ++      +  +                 N    
Sbjct: 61  VWYPPVVNH---LQLIQQVSSWSQVSRREGLLALDAIV-----------------NELKD 100

Query: 124 TFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILG 183
            FI   +++++ G A    +  +++ EI     E           G   P IGI+GA++G
Sbjct: 101 EFIRKGLQLLVDG-AEPERLREVLEVEISTFEEEMKLSARIWEAAGGYSPTIGILGAVMG 159

Query: 184 IIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKK 243
           +I  M NLS  P  LG  I V+   T+ G+ L+  +  P+ +++K+   +      ++  
Sbjct: 160 LIHVMENLSD-PSKLGAGIAVAFVATIYGVGLANLVYLPMANKLKTHINRLVVQREMIVD 218

Query: 244 ALIAYMNGAIPQVAIEYGRKVL 265
            L+   NG  P++     R  +
Sbjct: 219 GLVGIANGDNPRIIESRLRGYI 240


>gi|327438678|dbj|BAK15043.1| flagellar motor component [Solibacillus silvestris StLB046]
          Length = 266

 Score =  194 bits (493), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 57/275 (20%), Positives = 118/275 (42%), Gaps = 21/275 (7%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           +S+++G+ I  + ++ G +  G  P +LI P  I+I+    +    +A P+K +K     
Sbjct: 3   ISSVVGVIIAFIALLVGMFLKGVTPEVLINPAAILIIIFGTIAAVTIAFPMKELKRVPKL 62

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
              +F    L  D   D++K+        ++      E+   +                 
Sbjct: 63  FKILFSETKLASD--IDLIKMFSQWADLARREGLLALESKAAEVE--------------- 105

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+ + + + I G   +  I +++ EE++ +           S  G   P +G++GA
Sbjct: 106 --DPFLKNGLTLAIDGQ-NADYIRDVLTEEVEAMEDRHASGAGIFSQAGTYAPTLGVLGA 162

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G+I A+ ++S     LG AI  +   TLLGI   Y L +P  +++K     + +   +
Sbjct: 163 VVGLIAALKDMSD-IDKLGHAISAAFVATLLGIFTGYVLWHPFANKLKRKSAVEVKQKQM 221

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEI 275
           + + +++ + G  P+V  +     L + ER  I  
Sbjct: 222 MIEGILSVLEGEAPRVIEQKLASYLTMEERKQITE 256


>gi|299535179|ref|ZP_07048503.1| chemotaxis protein motA [Lysinibacillus fusiformis ZC1]
 gi|298729300|gb|EFI69851.1| chemotaxis protein motA [Lysinibacillus fusiformis ZC1]
          Length = 267

 Score =  194 bits (493), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 52/273 (19%), Positives = 115/273 (42%), Gaps = 21/273 (7%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
           S+IIGL + ++ ++ G    G +      P  I+I+    +    +A P++ +K      
Sbjct: 4   SSIIGLILALVALLTGMVMKGVSLSAFYNPAAILIIIFGTISAVTIAFPMQELKRVPKLF 63

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
             +F    L  D   +++K+        ++      E+   +                  
Sbjct: 64  KILFKETKLAND--IEIIKMFSQWADLARREGLLALESKASEIE---------------- 105

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
              F+ + + + I G   +  I +++ EE++ +           +  G   P +G++GA+
Sbjct: 106 -DPFLKNGLTLAIDGQ-NADYIRDVLTEEVEAMEERHTSGAAIFTQAGTYAPTLGVLGAV 163

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           +G+I A+ +++   + LG AI  +   TLLGI   Y L +P  +++K     + +   ++
Sbjct: 164 VGLIAALADMND-IEKLGHAISAAFMATLLGIFTGYVLWHPFANKLKRKSALEVKQKRMM 222

Query: 242 KKALIAYMNGAIPQVAIEYGRKVLPLSERPSIE 274
            + +++ + G  P+V  +     L + ER  I 
Sbjct: 223 IEGILSVLEGEAPRVIEQKLSSYLTMEERRQIS 255


>gi|332296624|ref|YP_004438547.1| MotA/TolQ/ExbB proton channel [Thermodesulfobium narugense DSM
           14796]
 gi|332179727|gb|AEE15416.1| MotA/TolQ/ExbB proton channel [Thermodesulfobium narugense DSM
           14796]
          Length = 264

 Score =  194 bits (493), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 40/278 (14%), Positives = 107/278 (38%), Gaps = 22/278 (7%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++T+ G  I    I+      GG+    +     V+V G   G  V+   +  +K     
Sbjct: 3   IATVAGFAIAFGSIMLSVIIEGGSFSHYLSLPAFVLVLGGTTGAVVINTTVDQLKMVPKI 62

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           + + F            V+  +  L    ++      E  ++                  
Sbjct: 63  VRKAFFAPKDNP---VTVIDQIVRLAEKARREGLLSLEAELEGVD--------------- 104

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   +++++        +  +++ +++I+        +    +G   P +GI+G 
Sbjct: 105 --DMFMKRGVQLVVDA-VDPELVRAILENDLEIMEARHKLGENFFVGLGGFAPTLGILGT 161

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  + NL + P  +  AI  +   TL G+ ++  +  P+  ++     ++ ++  +
Sbjct: 162 VMGLVHMLANL-EDPSGVSQAIAGAFIATLYGVGVANLVFLPIAGKLGVRSKEETQIKTM 220

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQ 278
           + + +++   G  P++  E  +  LP + R + E   +
Sbjct: 221 IMEGILSIQAGDNPRIIEEKLKVFLPPTLRLAYEAQKE 258


>gi|196248996|ref|ZP_03147696.1| MotA/TolQ/ExbB proton channel [Geobacillus sp. G11MC16]
 gi|196211872|gb|EDY06631.1| MotA/TolQ/ExbB proton channel [Geobacillus sp. G11MC16]
          Length = 263

 Score =  194 bits (493), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 59/269 (21%), Positives = 119/269 (44%), Gaps = 21/269 (7%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
           ++++G+ + ++ +  G Y  G    +LI P  ++I+    +    +A P + IK     L
Sbjct: 4   TSVVGVILGVIAVGLGMYFKGVALSVLINPAALLIIFVGTVAAVTIAFPTREIKKVPKLL 63

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
             IF   A+   T   ++ +        ++      E  +DD                  
Sbjct: 64  KIIFTEPAIP--TVEQLIPMFVDWANIARREGLLALEAKLDDID---------------- 105

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
              F+ + + M I G  +   I ++M EEI  +           +H G   P +G++GA+
Sbjct: 106 -DPFLRNGLSMAIDGQTQ-EFIRDVMTEEIAAMEERHEANAAIFTHAGTYAPTLGVLGAV 163

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           +G+I A+GN+ ++   LG AI  +   TLLGI   Y L +P  ++++    ++ ++  I+
Sbjct: 164 IGLIAALGNM-ENIAELGQAISAAFVATLLGIFSGYVLWHPFANKLRRKSKEEAKVRYIM 222

Query: 242 KKALIAYMNGAIPQVAIEYGRKVLPLSER 270
            + +++ + G  P++  +     L  SER
Sbjct: 223 IEGVLSILEGQAPRMIEQKLASYLSESER 251


>gi|295696766|ref|YP_003590004.1| MotA/TolQ/ExbB proton channel [Bacillus tusciae DSM 2912]
 gi|295412368|gb|ADG06860.1| MotA/TolQ/ExbB proton channel [Bacillus tusciae DSM 2912]
          Length = 264

 Score =  194 bits (493), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 45/269 (16%), Positives = 101/269 (37%), Gaps = 22/269 (8%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
           +++ G+   I  ++  F   GG+ Y L Q    +IV G       +      I      L
Sbjct: 5   ASVFGMIAGIGALVTAFVLEGGDIYALFQGTAALIVFGGTFAATAVGLSRDQILAIPALL 64

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
              F  K         +++ L  L    +K      E  I++                  
Sbjct: 65  KVAFLGK---TKDPHRLIRDLVELAGTARKEGLLALEERIEEFE---------------- 105

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
              F+   +++I+ G      +  +++ ++  +     +        G   P +GI+G +
Sbjct: 106 -DPFMKQGIQLIVDG-VDPELVRTMLETDVQFLENRHRQGVAIFEAAGGYAPTMGIIGTV 163

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           +G++  + NLS   + LG  I  +   TL G+  +  +  P+ +++K    ++  +  ++
Sbjct: 164 MGLVHVLSNLSD-IQSLGPLIATAFIATLYGVASANLIYFPIATKLKLRSDEEIMIRELI 222

Query: 242 KKALIAYMNGAIPQVAIEYGRKVLPLSER 270
            + +++   G  P +  +  +  LP   R
Sbjct: 223 IEGVLSIQAGENPTLLGQKLKAFLPPKWR 251


>gi|54307285|ref|YP_128305.1| flagellar motor protein MotA [Photobacterium profundum SS9]
 gi|46911705|emb|CAG18503.1| Hypothetical MotA flagellar motor transmembrane protein
           [Photobacterium profundum SS9]
          Length = 282

 Score =  194 bits (493), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 75/268 (27%), Positives = 143/268 (53%), Gaps = 1/268 (0%)

Query: 13  CIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQ 72
            I+ G+    G    L QP E +I+ GAG G  V++NP  V+K+    L  +   K   +
Sbjct: 13  SIVYGYTHASGRLLALWQPAEYIIILGAGFGAMVISNPTYVLKNILTRLK-MMFGKGYTE 71

Query: 73  DTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRM 132
             +  VL+L++ L+  ++K    + ++HI++P NS+IF   P    +N L +FI D +RM
Sbjct: 72  AYFKSVLELMFELLEIIRKDGIKKLDDHIENPQNSSIFNKYPEATRSNVLVSFITDNLRM 131

Query: 133 IIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLS 192
           + +     +++E +++ E+  +  + ++P  A+  +GE++P  GIV A+LGI+  M ++ 
Sbjct: 132 MAMSKMNHHDLEAVLELELHALEDDLMRPSKALGKVGEAMPGFGIVAAVLGIVVTMQSIG 191

Query: 193 QSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGA 252
               ++G  +  +L GT  GI++ Y++  P+ + I +   K+     +V   L++   G 
Sbjct: 192 GDLALIGVKVAAALVGTFFGILMCYAVFEPIAASIANQVKKEMMAMHMVSAILVSQAQGK 251

Query: 253 IPQVAIEYGRKVLPLSERPSIEIVAQEV 280
              +A++ GRKVL    +PS   +   +
Sbjct: 252 PTLLALDAGRKVLHSEFKPSFATMENWM 279


>gi|238924160|ref|YP_002937676.1| motility protein A [Eubacterium rectale ATCC 33656]
 gi|238875835|gb|ACR75542.1| motility protein A [Eubacterium rectale ATCC 33656]
          Length = 263

 Score =  194 bits (492), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 48/276 (17%), Positives = 107/276 (38%), Gaps = 24/276 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYI--LIQPFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           +++++G+ + I  ++ G    GG P +   +     +I  G  L   + +N L       
Sbjct: 3   IASLLGVILGIGMVLFGIIQNGGVPALLNFLDAPSAIITIGGSLSAVLCSNKLSGFIAGI 62

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
            S    F  K++        +  +  L    +K      E                    
Sbjct: 63  KSFALPFKEKSVDPGE---TINKIIELSNVSRKEGLLALEEAAGSID------------- 106

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
                 F+   + +++ G   +  +  +++ ++  +     K        GE  PA G++
Sbjct: 107 ----DEFLKKGIMLVVDG-TDAELVRGILETDMLSMEERHKKTISFWEFWGEQGPAWGMI 161

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
           G ++G+I  + NL  S   +G  + V+L  T  G +++  LC P  +++K+    +  L 
Sbjct: 162 GTLIGLINMLKNLEDS-STIGPNMAVALVTTFYGSLIANWLCAPFANKLKANNELELTLK 220

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIE 274
            ++ + L++   G  P+V  E  +  L   +R ++ 
Sbjct: 221 TLIIEGLLSIQAGENPRVIEEKLKSFLSPDKREALS 256


>gi|308173339|ref|YP_003920044.1| motility protein MotA [Bacillus amyloliquefaciens DSM 7]
 gi|307606203|emb|CBI42574.1| motility protein A; MotA component of the stator flagellum complex
           [Bacillus amyloliquefaciens DSM 7]
 gi|328553735|gb|AEB24227.1| flagellar motor protein MotA [Bacillus amyloliquefaciens TA208]
 gi|328911415|gb|AEB63011.1| motility protein A; MotA component of the stator flagellum complex
           [Bacillus amyloliquefaciens LL3]
          Length = 271

 Score =  194 bits (492), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 57/275 (20%), Positives = 114/275 (41%), Gaps = 21/275 (7%)

Query: 16  GGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDTY 75
            G    G +   L  P  I+I+    +   ++A P K IK        +F  K   Q T 
Sbjct: 18  VGMVLKGVSLSALANPAAILIILFGTISAVIIAFPGKEIKKVPALFKVLF--KENKQLTI 75

Query: 76  CDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMIIV 135
             ++ +        ++      E  I+D                     F+ + + M + 
Sbjct: 76  AQLIPMFSQWAQIARREGLLALEASIEDVD-----------------DAFLKNGLSMAVD 118

Query: 136 GNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQSP 195
           G + +  I ++M EE++ +           +  G   P +G++GA++G+I A+ N++ + 
Sbjct: 119 GQS-AEFIRDIMTEEVEAMEDRHQAGAAIFTQAGTYAPTLGVLGAVIGLIAALSNMN-NT 176

Query: 196 KILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIPQ 255
           + LG AI  +   TLLGI   Y L +P  +++K    ++ +L  I+ + +++ + G  P+
Sbjct: 177 EALGHAISAAFVATLLGIFTGYVLWHPFANKLKRKSKQEVKLREIMIEGVLSVLEGQAPK 236

Query: 256 VAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           V  +     LP +ER  +     E       ++ +
Sbjct: 237 VIEQKLLMYLPANERAKVIEQEGEANNGEKKEEEA 271


>gi|138896103|ref|YP_001126556.1| flagellar motor protein MotA [Geobacillus thermodenitrificans
           NG80-2]
 gi|134267616|gb|ABO67811.1| Motility protein A [Geobacillus thermodenitrificans NG80-2]
          Length = 263

 Score =  194 bits (492), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 59/269 (21%), Positives = 119/269 (44%), Gaps = 21/269 (7%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
           ++++G+ + ++ +  G Y  G    +LI P  ++I+    +    +A P + IK     L
Sbjct: 4   TSVVGVILGVIAVGLGMYFKGVALSVLINPAALLIIFVGTVAAVTIAFPTREIKKVPKLL 63

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
             IF   A+   T   ++ +        ++      E  +DD                  
Sbjct: 64  KIIFTEPAIP--TVEQLIPMFVDWANIARREGLLALEAKLDDID---------------- 105

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
              F+ + + M I G  +   I ++M EEI  +           +H G   P +G++GA+
Sbjct: 106 -DPFLRNGLSMAIDGQTQ-EFIRDVMTEEIAAMEERHEANAAIFTHAGTYAPTLGVLGAV 163

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           +G+I A+GN+ ++   LG AI  +   TLLGI   Y L +P  ++++    ++ ++  I+
Sbjct: 164 IGLIAALGNM-ENIGELGQAISAAFVATLLGIFSGYVLWHPFANKLRRKSKEEAKVRYIM 222

Query: 242 KKALIAYMNGAIPQVAIEYGRKVLPLSER 270
            + +++ + G  P++  +     L  SER
Sbjct: 223 IEGVLSILEGQAPRMIEQKLASYLSESER 251


>gi|255099859|ref|ZP_05328836.1| putative chemotaxis protein [Clostridium difficile QCD-63q42]
 gi|255305747|ref|ZP_05349919.1| putative chemotaxis protein [Clostridium difficile ATCC 43255]
          Length = 262

 Score =  194 bits (492), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 57/278 (20%), Positives = 115/278 (41%), Gaps = 22/278 (7%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M+T+I   + I  ++  F   GG+   L      ++V G  +G    + P  V K S   
Sbjct: 1   MTTLIFFIVGIASLVVAFVIDGGHVGALFVFSSALVVFGGTIGAVGASTPFPVFKKSIKI 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +L  F  K        + +     +    +K      +  I +               N+
Sbjct: 61  MLLAFKNKKPNN---IENIIYFKEIATKARKEGLLSIDKEISE---------------ND 102

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           EL  FI   + +++ G   +  I N+++ +I I      +        G   P +GI+G 
Sbjct: 103 ELDPFIRKGLELMVDG-VDAVTIRNILESQIQITSKRHKEGIAIFDSAGGYAPTLGIIGT 161

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  +GNLS +P  LG  I V+   TL G+  +  +  P+ S++K+   ++    ++
Sbjct: 162 VMGLVHILGNLSSNPDALGPQISVAFLATLYGVGSANLIWLPIASKLKAINQQEVSERLL 221

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQ 278
           V +A+++ + G    +  E  +  L   E   +  + +
Sbjct: 222 VIEAILSILEGDNSNLMTEKLKIFLNSKE---LIELEE 256


>gi|126698324|ref|YP_001087221.1| putative chemotaxis protein [Clostridium difficile 630]
 gi|115249761|emb|CAJ67578.1| putative MotA/TolQ/ExbB proton channel [Clostridium difficile]
          Length = 262

 Score =  194 bits (492), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 57/278 (20%), Positives = 115/278 (41%), Gaps = 22/278 (7%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M+T+I   + I  ++  F   GG+   L      ++V G  +G    + P  V K S   
Sbjct: 1   MTTLIFFIVGIASLVVAFVIDGGHVGALFVFSSALVVFGGTIGAVGASTPFPVFKKSIKI 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +L  F  K        + +     +    +K      +  I +               N+
Sbjct: 61  MLLAFKNKKPNN---IENIIYFKEIATKARKEGLLSIDKEISE---------------ND 102

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           EL  FI   + +++ G   +  I N+++ +I I      +        G   P +GI+G 
Sbjct: 103 ELDPFIRKGLELMVDG-VDAVTIRNILESQIQITSKRHKEGIAIFDSSGGYAPTLGIIGT 161

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  +GNLS +P  LG  I V+   TL G+  +  +  P+ S++K+   ++    ++
Sbjct: 162 VMGLVHILGNLSSNPDALGPQISVAFLATLYGVGSANLIWLPIASKLKAINQQEISERLL 221

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQ 278
           V +A+++ + G    +  E  +  L   E   +  + +
Sbjct: 222 VIEAILSILEGDNSNLMTEKLKIFLNSKE---LIELEE 256


>gi|78221682|ref|YP_383429.1| MotA/TolQ/ExbB proton channel [Geobacter metallireducens GS-15]
 gi|78192937|gb|ABB30704.1| MotA/TolQ/ExbB proton channel [Geobacter metallireducens GS-15]
          Length = 254

 Score =  194 bits (492), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 58/269 (21%), Positives = 106/269 (39%), Gaps = 22/269 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++TIIGL +    +IGG    G +   LIQP   +IV G   G   ++ P+K I  +   
Sbjct: 3   IATIIGLVMGFGAVIGGALIEGLHLGALIQPTAALIVLGGTFGAAFVSYPMKTIIGAVKD 62

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           + ++        +    V+K +       ++      E    +                 
Sbjct: 63  IRKVLFPAQHDPE---KVIKEIIGYAAKARRNGLISLEQEAQNVK--------------- 104

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F    + +++ G     ++   ++ EI        +        G   P IGI+GA
Sbjct: 105 --DAFTKKGISLVVDG-IDPQKLRETLEIEIAYYEEHSKQSAEFFEAAGGYAPTIGIIGA 161

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+I  M NLS S   LG  I V+   T+ G++ +  +C P  ++IK    ++     +
Sbjct: 162 VLGLIHVMANLSDS-SKLGAGIAVAFVATIYGLMTANIVCLPFGTKIKHGIKEELICKNM 220

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSE 269
           + + LIA  NG  P    +  +  +   +
Sbjct: 221 IIEGLIAIQNGENPHFIEQKLKAFIQEGD 249


>gi|54294668|ref|YP_127083.1| flagellar motor protein [Legionella pneumophila str. Lens]
 gi|53754500|emb|CAH15984.1| flagellar motor protein MotA [Legionella pneumophila str. Lens]
          Length = 257

 Score =  193 bits (491), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 59/263 (22%), Positives = 105/263 (39%), Gaps = 22/263 (8%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
            T+IGL    L II G    GG+   L+    ++IV G  LG  ++  PL   K +   L
Sbjct: 4   LTLIGLLTGFLAIIVGQMFEGGDLNSLLNFPALLIVMGGTLGAVMVQTPLTTFKRAFRIL 63

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
             +        +        L  L    ++      E+ +                 + E
Sbjct: 64  PWVVKPPHHNFEECRTT---LIELSRKARQLGLLSLEDRL-----------------DVE 103

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
               I   + +++ G      +  +++ EID   ++ L+  H    MG   P +GI+GA+
Sbjct: 104 TNPLIYKGLELLVTG-VDKLTLRQVLEAEIDRTEHQDLRAAHVFESMGGYSPTVGILGAV 162

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           LG+I+ M NL+  P  LG  I V+   T+ G+  +     P+ +++KS    +     +V
Sbjct: 163 LGLIQVMRNLAD-PSQLGLGIAVAFVATIYGVGFANLFFLPVANKLKSCISHRVHFDEMV 221

Query: 242 KKALIAYMNGAIPQVAIEYGRKV 264
            + L+A  +G  P +        
Sbjct: 222 VEGLVAMASGESPNMLQLKLNNY 244


>gi|318604275|emb|CBY25773.1| flagellar motor rotation protein MotA [Yersinia enterocolitica
           subsp. palearctica Y11]
          Length = 288

 Score =  193 bits (491), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 84/284 (29%), Positives = 153/284 (53%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  +IGL + + C+IGG+   GG      QP EI+I+ G G+G  ++ANP  V+K+  + 
Sbjct: 1   MQKLIGLLVIMACVIGGYIMSGGILSSFWQPGEIIIIFGCGIGAMILANPGYVLKEMWLQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           ++ I        +    +L LLY L+  + +G     + HI+ P NS +F   P +L+++
Sbjct: 61  IVAIMRKSEYTAEFQQQLLMLLYELLEMVDEGGLKRLDEHIEVPANSPLFQRYPLILQDH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L TFI D  R++ +G    +E+E ++++E+  +  E L P  +     E++P  GI  A
Sbjct: 121 HLVTFISDNFRLMAMGKINQHELEGILEQELSAVEEELLVPSRSFHRTAEAMPGFGICAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGII  M ++  S  ++G  +  +L GT LG+ + Y L +PL + ++    K+   +  
Sbjct: 181 VLGIIITMQSIDGSIALIGVKVAAALIGTFLGVFICYCLMDPLANAMEQEMKKKLAFFEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYN 284
           V+  L+ ++ G    +A++ GRK+LPL  +P+   +   + +  
Sbjct: 241 VRMVLVNHVAGKPSLLAVDAGRKMLPLDSKPTFATLDSWINKLM 284


>gi|254974361|ref|ZP_05270833.1| putative chemotaxis protein [Clostridium difficile QCD-66c26]
 gi|255091755|ref|ZP_05321233.1| putative chemotaxis protein [Clostridium difficile CIP 107932]
 gi|255313485|ref|ZP_05355068.1| putative chemotaxis protein [Clostridium difficile QCD-76w55]
 gi|255516173|ref|ZP_05383849.1| putative chemotaxis protein [Clostridium difficile QCD-97b34]
 gi|255649269|ref|ZP_05396171.1| putative chemotaxis protein [Clostridium difficile QCD-37x79]
 gi|260682441|ref|YP_003213726.1| putative chemotaxis protein [Clostridium difficile CD196]
 gi|260686040|ref|YP_003217173.1| putative chemotaxis protein [Clostridium difficile R20291]
 gi|306519370|ref|ZP_07405717.1| putative chemotaxis protein [Clostridium difficile QCD-32g58]
 gi|260208604|emb|CBA61320.1| putative chemotaxis protein [Clostridium difficile CD196]
 gi|260212056|emb|CBE02636.1| putative chemotaxis protein [Clostridium difficile R20291]
          Length = 262

 Score =  193 bits (491), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 57/278 (20%), Positives = 116/278 (41%), Gaps = 22/278 (7%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M+T+I   + I  ++  F   GG+  +L      ++V G  +G    + P  V K S   
Sbjct: 1   MTTLIFFIVGIASLVVAFVIDGGHIGVLFVFSSALVVFGGTIGAVGASTPFPVFKKSIKI 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +L  F  K        + +     +    +K      +  I +               N+
Sbjct: 61  MLLAFKNKKPNN---IENIIYFKEIATKARKEGLLSVDKEISE---------------ND 102

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           EL  FI   + +++ G   +  I N+++ +I I      +        G   P +GI+G 
Sbjct: 103 ELDPFIRKGLELMVDG-VDAVTIRNILESQIQITSKRHKEGIAIFDSAGGYAPTLGIIGT 161

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  +GNLS +P  LG  I V+   TL G+  +  +  P+ S++K+   ++    ++
Sbjct: 162 VMGLVHILGNLSSNPDALGPQISVAFLATLYGVGSANLIWLPIASKLKAINQQEISERLL 221

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQ 278
           V +A+++ + G    +  E  +  L   E   +  + +
Sbjct: 222 VIEAILSILEGDNSNLMTEKLKIFLNSKE---LIELEE 256


>gi|206603128|gb|EDZ39608.1| Putative flagellar motor component (MotA) [Leptospirillum sp. Group
           II '5-way CG']
          Length = 260

 Score =  193 bits (491), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 62/274 (22%), Positives = 112/274 (40%), Gaps = 19/274 (6%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++T++GL I    I+GG    G     + Q    +IV G  +G  ++  P+  I  +  S
Sbjct: 3   ITTLLGLVIGFGGILGGAAIEGLPLGTIFQMTAAIIVFGGTIGATLVTTPMAQILAAVRS 62

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  +F      +     +++ +  L    +K    + E+ +DDP+               
Sbjct: 63  VPRLFLNP---KSDPVKIIRKIVELSKVSRKEGLLKLESFLDDPFIRG------------ 107

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   +RM++ G     ++ + ++ E   I  E+          G   P IGI+GA
Sbjct: 108 --DAFLTRGVRMVMDG-TDIAKVRDALETESRYIEDEEAASAKVFESAGGYAPTIGILGA 164

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+I  M NLS  P  L   I  +   T+ G+  +     PL+ ++K     + R   I
Sbjct: 165 VLGLIHVMSNLSD-PNKLAEGIATAFVATVYGVGSANLAYLPLSGKLKIKNHYEGRNREI 223

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIE 274
           + + L+A   G  P    +     L   ER  +E
Sbjct: 224 IIEGLVAIGQGENPNNIEDRLMGFLNEKERSGME 257


>gi|332162881|ref|YP_004299458.1| Lateral flagellar motor protein A [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|158327336|emb|CAM82842.1| flagellar motor protein MotA [Yersinia enterocolitica W22703]
 gi|325667111|gb|ADZ43755.1| Lateral flagellar motor protein A [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330863329|emb|CBX73452.1| chemotaxis protein lafT [Yersinia enterocolitica W22703]
          Length = 288

 Score =  193 bits (491), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 84/284 (29%), Positives = 154/284 (54%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  +IGL + + C+IGG+   GG      QP EI+I+ G+G+G  ++ANP  V+K+  + 
Sbjct: 1   MQKLIGLLVIMACVIGGYIMSGGILSSFWQPGEIIIIFGSGIGAMILANPGYVLKEMWLQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           ++ I        +    +L LLY L+  + +G     + HI+ P NS +F   P +L+++
Sbjct: 61  IVAIMRKSEYTAEFQQQLLMLLYELLEMVDEGGLKRLDEHIEVPANSPLFQRYPLILQDH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L TFI D  R++ +G    +E+E ++++E+  +  E L P  +     E++P  GI  A
Sbjct: 121 HLVTFISDNFRLMAMGKINQHELEGILEQELSAVEEELLAPSRSFHRTAEAMPGFGICAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGII  M ++  S  ++G  +  +L GT LG+ + Y L +PL + ++    K+   +  
Sbjct: 181 VLGIIITMQSIDGSIALIGVKVAAALIGTFLGVFICYCLMDPLANAMEQEMKKKLAFFEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYN 284
           V+  L+ ++ G    +A++ GRK+LPL  +P+   +   + +  
Sbjct: 241 VRMVLVNHVAGKPSLLAVDAGRKMLPLDSKPTFATLDSWINKLM 284


>gi|148359325|ref|YP_001250532.1| flagellar motor protein MotA [Legionella pneumophila str. Corby]
 gi|296107372|ref|YP_003619072.1| chemotaxis protein MotA [Legionella pneumophila 2300/99 Alcoy]
 gi|148281098|gb|ABQ55186.1| flagellar motor protein MotA [Legionella pneumophila str. Corby]
 gi|295649273|gb|ADG25120.1| chemotaxis protein MotA [Legionella pneumophila 2300/99 Alcoy]
          Length = 257

 Score =  193 bits (491), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 60/263 (22%), Positives = 105/263 (39%), Gaps = 22/263 (8%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
            T+IGL    L II G    GG+   L+    ++IV G  LG  ++  PL   K +   L
Sbjct: 4   LTLIGLLTGFLAIIVGQIFEGGDLNSLLNLPALLIVMGGTLGAVMVQTPLTTFKRAFRIL 63

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
             +        +        L  L    ++      E+ +                 + E
Sbjct: 64  PWVVKPPHHNFEECRTT---LIELSRKARQLGLLSLEDRL-----------------DVE 103

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
               I   + +++ G      +  +++ EID   ++ L+  H    MG   P IGI+GA+
Sbjct: 104 TNPLIYKGLELLVTG-VDKLTLRQVLEAEIDRTEHQDLRAAHVFESMGGYSPTIGILGAV 162

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           LG+I+ M NL+  P  LG  I V+   T+ G+  +     P+ +++KS    +     +V
Sbjct: 163 LGLIQVMRNLAD-PSQLGLGIAVAFVATIYGVGFANLFFLPVANKLKSCISHRVHFDEMV 221

Query: 242 KKALIAYMNGAIPQVAIEYGRKV 264
            + L+A  +G  P +        
Sbjct: 222 VEGLVAMASGESPNMLQLKLNNY 244


>gi|24216276|ref|NP_713757.1| endoflagellar motor protein A [Leptospira interrogans serovar Lai
           str. 56601]
 gi|45656520|ref|YP_000606.1| motility protein A [Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130]
 gi|24197542|gb|AAN50775.1| endoflagellar motor protein A [Leptospira interrogans serovar Lai
           str. 56601]
 gi|45599755|gb|AAS69243.1| motility protein A [Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130]
          Length = 260

 Score =  193 bits (491), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 48/269 (17%), Positives = 105/269 (39%), Gaps = 22/269 (8%)

Query: 3   TIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLL 62
           T++G     + +I G  + G +P  +     ++I  G    G +MA P +     G    
Sbjct: 5   TVVGFGGACVLMIFGIISAGLSPLDIFDIPSVIITFGGATAGTIMAVPWESTLAVGKITQ 64

Query: 63  EIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNEL 122
           ++F  +        +++K L       ++      E+ +                 N   
Sbjct: 65  KVFKTEKH---DLIELIKTLVSFSEKARREGLLALEDDV-----------------NELP 104

Query: 123 TTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAIL 182
             F+   + +++ G      + N+M+ E+  I            + G   PA G++G ++
Sbjct: 105 DEFLRKGITLVVDG-TDPELVRNIMETEMGNIASRHNNGKAWWENWGALAPAFGMIGTLI 163

Query: 183 GIIKAMGNLS-QSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           G+++ + NL    P  +GT +  +L  TL G + +     P+  ++      +  +  I+
Sbjct: 164 GLVQMLKNLGSGDPSAIGTGMAAALITTLYGSMGANMFAIPVMKKLIRKSEDELTIKQIM 223

Query: 242 KKALIAYMNGAIPQVAIEYGRKVLPLSER 270
            +  ++  +G  P++  +     LP SER
Sbjct: 224 IEGTLSIQSGDNPRIVKDKLSSFLPPSER 252


>gi|89093475|ref|ZP_01166423.1| flagellar motor protein [Oceanospirillum sp. MED92]
 gi|89082165|gb|EAR61389.1| flagellar motor protein [Oceanospirillum sp. MED92]
          Length = 252

 Score =  193 bits (491), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 56/274 (20%), Positives = 124/274 (45%), Gaps = 25/274 (9%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++T++GL  +   ++      GG+  + I P  ++IV G  L   +M+  L     +G  
Sbjct: 3   IATLVGLLGSFGIVVAAMVM-GGDVGVFINPPSLLIVIGGSLFVVLMSYTLGQFLAAGKI 61

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
             + F +K+L  +    ++     L    +KG     E+                     
Sbjct: 62  AAKAFMFKSLNPED---IIAETVDLADAARKGGLLSLEDK-------------------T 99

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
             + F+   +++++ G+     ++ L+ +E  +            + +G+  PA+G++G 
Sbjct: 100 VSSDFMQRGIQLLVDGH-DPDVVKMLLKKESKLTHDRHEFGASIFASLGDVGPAMGMIGT 158

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G+++ + N+S  PK +G A+ V+L  TL G +L+  +C P++ ++K  + ++     +
Sbjct: 159 LVGLVQMLSNMSD-PKSIGPAMAVALLTTLYGAMLANMICIPISDKLKVRKDEEALNNDL 217

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIE 274
           +   L+A   G  P+V  +  R  LP  +R + E
Sbjct: 218 IIDGLLAIQAGQNPRVIEQMLRNYLPEKKRAAAE 251


>gi|118581871|ref|YP_903121.1| MotA/TolQ/ExbB proton channel [Pelobacter propionicus DSM 2379]
 gi|118504581|gb|ABL01064.1| MotA/TolQ/ExbB proton channel [Pelobacter propionicus DSM 2379]
          Length = 249

 Score =  193 bits (491), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 55/264 (20%), Positives = 103/264 (39%), Gaps = 22/264 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++TIIGL +    + GG    G +   LIQP   +IV G   G   +  PL  I  +   
Sbjct: 3   LATIIGLVMGFGAVFGGAVLEGLHLSALIQPTAALIVLGGTFGATFVCFPLSAIIKAFKD 62

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +   F    +  +    V+K +       ++      E                      
Sbjct: 63  VKIAFLPANVDHE---SVVKDIINYATKARRNGLISLEQE-----------------AQT 102

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   + +++ G     ++   ++ +I                 G   P IGI+GA
Sbjct: 103 AKDPFVKKGISLVVDG-IDPQKLRETLEADITAFEDHSKHSVEFYEAAGGFSPTIGIIGA 161

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+I  M NLS +   LG  I V+   T+ G++++  +C P+ +++K    ++    ++
Sbjct: 162 VLGLIHVMSNLSDT-SKLGAGIAVAFVATIYGLMVANIICLPIGTKLKIRMKEEVLRRVM 220

Query: 241 VKKALIAYMNGAIPQVAIEYGRKV 264
           + + LIA  NG  P    +  +  
Sbjct: 221 ILEGLIAIQNGENPHFIEQKLKAF 244


>gi|83589633|ref|YP_429642.1| MotA/TolQ/ExbB proton channel [Moorella thermoacetica ATCC 39073]
 gi|83572547|gb|ABC19099.1| MotA/TolQ/ExbB proton channel [Moorella thermoacetica ATCC 39073]
          Length = 272

 Score =  193 bits (490), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 43/265 (16%), Positives = 109/265 (41%), Gaps = 23/265 (8%)

Query: 3   TIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLL 62
           T++G+   I  ++G     GGNP +      +++  G      ++    + IK+   ++ 
Sbjct: 8   TVLGIVAGIGLMVGALIM-GGNPKLFWSVPSLMVTVGGSFAAVLINFSFQDIKNVFGTVK 66

Query: 63  EIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNEL 122
           + F    +  +    ++++   L    ++      E+                   N   
Sbjct: 67  QAFTTDLMDPEE---LIEVFGELARKARREGLLALEDD-----------------ANRLE 106

Query: 123 TTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAIL 182
             F    ++M++        I  +++ ++  +       Y      G   P+ G++G ++
Sbjct: 107 DPFFAKGIQMMVDAM-EPQMIREILETDMAYMARRHEIGYGIFKTWGNLAPSFGLIGTLI 165

Query: 183 GIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVK 242
           G+++ +  L + P+ LG ++ ++L  T  G I++Y +  PL  ++     ++  L+ ++ 
Sbjct: 166 GLVQMLAKLDK-PETLGPSMALALITTFYGAIMAYMIFIPLAGKLSLRSEQEMMLHQMML 224

Query: 243 KALIAYMNGAIPQVAIEYGRKVLPL 267
           + +IA  +G  P++  E+ R  L  
Sbjct: 225 EGIIAIQSGVNPRILEEHLRSFLAP 249


>gi|15895121|ref|NP_348470.1| flagellar motor protein MotA [Clostridium acetobutylicum ATCC 824]
 gi|15024822|gb|AAK79810.1|AE007693_8 Flagellar motor component MotA [Clostridium acetobutylicum ATCC
           824]
 gi|325509260|gb|ADZ20896.1| flagellar motor protein MotA [Clostridium acetobutylicum EA 2018]
          Length = 259

 Score =  193 bits (490), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 52/274 (18%), Positives = 111/274 (40%), Gaps = 21/274 (7%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           +  +IG+   +L ++ G    G N  +L+ P   +I+        + + P     +    
Sbjct: 3   IFLVIGIITGLLAVVVGMIVKGANVAVLLNPAAAIIIIVGTSAAVMNSFPKNEFTNIPKV 62

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
              +   K   ++   +++  +  +    +K      E  I    N              
Sbjct: 63  FKSLMRGK--SKEDPVEIINQIVDMAQETRKNGLLSLEGKIHSIDN-------------- 106

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   + M++ G      I  +++ EI+             +  G + P +G++GA
Sbjct: 107 ---EFLKTGLEMVVDG-VDPQHIAEVLEMEIESTEERHRGGALIFTTAGGAAPTLGVLGA 162

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G+I A+GNL+ + + LG  I  +   TL GI   Y +C+P  S++K   L++  +  I
Sbjct: 163 VVGLIGALGNLNDT-EKLGHMIAGAFVATLYGIFFGYVICHPFASRLKRKSLEEINVMRI 221

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIE 274
           + + ++   +G  P+   +     L   +R SI+
Sbjct: 222 ITEGILDIQSGNNPKSIEKKLIGTLSPKQRQSIQ 255


>gi|306820124|ref|ZP_07453772.1| chemotaxis protein MotA [Eubacterium yurii subsp. margaretiae ATCC
           43715]
 gi|304551902|gb|EFM39845.1| chemotaxis protein MotA [Eubacterium yurii subsp. margaretiae ATCC
           43715]
          Length = 258

 Score =  193 bits (490), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 54/271 (19%), Positives = 100/271 (36%), Gaps = 22/271 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++T+IGL      +  G  + G      I      I     +   ++A P+  IKD    
Sbjct: 3   LATVIGLVGAFAAMGLGIISGGAGFATYIDIPSFFITVLGAIFASMIAFPMSTIKDLPKL 62

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           + + F  +A         ++ L  L    +K      E    D                 
Sbjct: 63  IGKTFKSEATDPS---KTIESLIELANKARKDGLLSLEEAARD----------------- 102

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   + +I+ G      + NL++ E+D I          +  +    P  G++G 
Sbjct: 103 MGDPFLQKGLMLIVDG-TDPELVRNLLETELDFIEQRHKNGQGLMEMIASMGPGFGMIGT 161

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           + G++  + NLS +   LG  + V+L  TL G IL+     P+  ++      +     I
Sbjct: 162 LFGLVAMLKNLSDTAS-LGPNMAVALITTLYGSILANVFFTPMAKKLSVNSAVEMLERGI 220

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERP 271
           + + L++   G  P++  E  +  LP S R 
Sbjct: 221 ILEGLLSIQAGENPRIIEEKLKAFLPPSLRK 251


>gi|319651876|ref|ZP_08006000.1| flagellar motor protein [Bacillus sp. 2_A_57_CT2]
 gi|317396435|gb|EFV77149.1| flagellar motor protein [Bacillus sp. 2_A_57_CT2]
          Length = 272

 Score =  193 bits (490), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 60/289 (20%), Positives = 116/289 (40%), Gaps = 26/289 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGG--NPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M T  GL + +  +I G    GG       + P  I+IV G  + G +++ PLK I+   
Sbjct: 6   MLTPAGLMVGLAMLIFGIMWNGGADGFLSFVDPSSILIVLGGLIAGLLVSFPLKDIRHMA 65

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
               ++F  +     +  +++ +   L    ++      E  I                 
Sbjct: 66  TVFKQVFSSEE---QSVGELIGIFVKLSERARREGLLSLEAEI----------------- 105

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
                 FI   + + + G      I ++M+ EI  +     K    +   GE  PA G++
Sbjct: 106 GKVEDPFIQKGVYLAVDG-IEPDVITDIMNAEIMAMEERHRKGRSILERAGEYAPAWGMI 164

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
           G ++G++  + NL+  P  LG  + ++L  TL G +L+  +  P+ +++     K+  L 
Sbjct: 165 GTLIGLVLMLKNLND-PSTLGPNMALALLTTLYGSLLANLIFLPMAAKLALKTEKEVFLK 223

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIV--AQEVLQYNH 285
            I+ + +I   +G  P++  E     L   ER  ++     +E L    
Sbjct: 224 QIIIEGVIGVQSGQNPRILEEKLSAFLSSEERRDLDKAVNEEEALDNEA 272


>gi|254519412|ref|ZP_05131468.1| chemotaxis MotA protein [Clostridium sp. 7_2_43FAA]
 gi|226913161|gb|EEH98362.1| chemotaxis MotA protein [Clostridium sp. 7_2_43FAA]
          Length = 268

 Score =  193 bits (490), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 52/273 (19%), Positives = 114/273 (41%), Gaps = 23/273 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           + T +GL ++I+ +I G    G +  I      ++I  G  L   ++   L+ +K+ G  
Sbjct: 6   ILTSVGLILSIVLMIYGMLI-GSSLKIFWDVASVIITVGGSLSALLITYSLEEVKNMGKL 64

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            ++ F      + +  D++     L    ++      E+ I +                 
Sbjct: 65  FIQAF---KENKSSGKDIIIRFGSLSKKARREGLLSLEDDISEME--------------- 106

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   ++M++ G      I  +++ EI  +     +     +  G   PA G++G 
Sbjct: 107 --DPFMKKGLQMVVDG-IEPETIREILELEIGEMENRHERGAGIYAAWGAYAPAFGMLGT 163

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G+I+ + NL+     + + +G +L  T  G +L+  LCNP+ S ++    K+     +
Sbjct: 164 LIGLIQMLANLTD-VANIASGMGKALITTFYGSLLANILCNPIASNLRQKSAKEAGEREM 222

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSI 273
           + + ++A  +G  P++  E     LP  E+   
Sbjct: 223 ILEGILAIQSGVNPRIVEEKLITYLPPKEKLEY 255


>gi|73913488|gb|AAZ91671.1| MotA [Wigglesworthia glossinidia endosymbiont of Glossina
           morsitans]
          Length = 247

 Score =  193 bits (490), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 77/233 (33%), Positives = 129/233 (55%)

Query: 54  IKDSGVSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSI 113
                      F      +D Y DV+ L+Y L+   ++     +E  ID+P  S IF++ 
Sbjct: 2   FLQLSKHFQNYFTPSRYNKDMYMDVMSLIYRLLSKSRQSGLISSEKDIDNPETSKIFSNY 61

Query: 114 PTVLENNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLP 173
           P +L++  +  F+ DY+R++I GN  +YEIE LM+EEI+    E   P  ++  +G++LP
Sbjct: 62  PLMLKDKLIIDFLVDYLRLMISGNLNAYEIEALMNEEIETCEQEHEVPITSLLQVGDALP 121

Query: 174 AIGIVGAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLK 233
           A GIV A++G++ A+    +    LG  I  ++ GT LGI+L+Y    PL + +K    +
Sbjct: 122 AFGIVAAVMGVVNALAAADRPAAELGELIAHAMVGTFLGILLAYGCVMPLGALLKQKSDE 181

Query: 234 QHRLYIIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHN 286
             ++   +K  L++ +NG  PQ+AIE+GRK+L  SERPS   + + + Q   +
Sbjct: 182 HIKMLQCIKITLLSSINGYAPQIAIEFGRKILYSSERPSFTELEEHLRQVKKS 234


>gi|220932515|ref|YP_002509423.1| MotA/TolQ/ExbB proton channel [Halothermothrix orenii H 168]
 gi|219993825|gb|ACL70428.1| MotA/TolQ/ExbB proton channel [Halothermothrix orenii H 168]
          Length = 267

 Score =  192 bits (489), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 60/283 (21%), Positives = 122/283 (43%), Gaps = 29/283 (10%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           +ST+IG+   I+ ++GG   MGGN  I +    ++IV G  L G +++     +K     
Sbjct: 3   LSTLIGILTGIV-LLGGAIIMGGNAVIFLSVQSLMIVLGGTLAGTMVSYSFNELKKIPSL 61

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +   F    L  D    ++ +L       ++      E  + +                 
Sbjct: 62  IRVAFQEHTLDSDE---IIDILVGFAEKARREGLLALEQDVMEIN--------------- 103

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   +++++ G      + N+++ ++  +     K     S MG+  P+ G++G 
Sbjct: 104 --DPFLQKGIQLVVDG-TDPELVRNILETKLTFLEERHQKGRGLFSTMGQLAPSFGLIGT 160

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G+I+ +  L   P  LG+ + V+L  TL G +L+  L NPL  +++   L++  L  +
Sbjct: 161 LIGLIQMLSQLDD-PTNLGSGMAVALITTLYGALLANLLFNPLAGKLRIRSLEEVLLKEV 219

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLP------LSERPSIEIVA 277
           + + +++   G  P++  E     L        SE P  E +A
Sbjct: 220 MIEGVLSIQAGENPRIVREKLNAFLATERERIASEAPRFEEMA 262


>gi|52842008|ref|YP_095807.1| flagellar motor protein [Legionella pneumophila subsp. pneumophila
           str. Philadelphia 1]
 gi|54297694|ref|YP_124063.1| flagellar motor protein [Legionella pneumophila str. Paris]
 gi|52629119|gb|AAU27860.1| flagellar motor protein MotA [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|53751479|emb|CAH12897.1| flagellar motor protein MotA [Legionella pneumophila str. Paris]
 gi|307610481|emb|CBX00053.1| flagellar motor protein MotA [Legionella pneumophila 130b]
          Length = 257

 Score =  192 bits (489), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 60/263 (22%), Positives = 105/263 (39%), Gaps = 22/263 (8%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
            T+IGL    L II G    GG+   L+    ++IV G  LG  ++  PL   K +   L
Sbjct: 4   LTLIGLLTGFLAIIVGQIFEGGDLNSLLNFPALLIVMGGTLGAVMVQTPLTTFKRAFRIL 63

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
             +        +        L  L    ++      E+ +                 + E
Sbjct: 64  PWVVKPPHHNFEECRTT---LIELSRKARQLGLLSLEDRL-----------------DVE 103

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
               I   + +++ G      +  +++ EID   ++ L+  H    MG   P IGI+GA+
Sbjct: 104 TNPLIYKGLELLVTG-VDKLTLRQVLEAEIDRTEHQDLRAAHVFESMGGYSPTIGILGAV 162

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           LG+I+ M NL+  P  LG  I V+   T+ G+  +     P+ +++KS    +     +V
Sbjct: 163 LGLIQVMRNLAD-PSQLGLGIAVAFVATIYGVGFANLFFLPVANKLKSCISHKVHFDEMV 221

Query: 242 KKALIAYMNGAIPQVAIEYGRKV 264
            + L+A  +G  P +        
Sbjct: 222 VEGLVAMASGESPNMLQLKLNNY 244


>gi|124516289|gb|EAY57797.1| putative flagellar motor component (MotA) [Leptospirillum rubarum]
          Length = 260

 Score =  192 bits (489), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 62/274 (22%), Positives = 112/274 (40%), Gaps = 19/274 (6%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++T++GL I    I+GG    G     + Q    +IV G  +G  ++  P+  I  +  S
Sbjct: 3   ITTLLGLVIGFGGILGGAAIEGLPLGTIFQMTAAIIVFGGTIGATLVTTPMAQILAAVRS 62

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  +F      +     +++ +  L    +K    + E+ +DDP+               
Sbjct: 63  VPRLFLNP---KSDPVKIIRKIVELSKVSRKEGLLKLESFLDDPFIRG------------ 107

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   +RM++ G     ++ + ++ E   I  E+          G   P IGI+GA
Sbjct: 108 --DAFLTRGVRMVMDG-TDIAKVRDALETESRYIEDEEAASAKVFEAAGGYAPTIGILGA 164

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+I  M NLS  P  L   I  +   T+ G+  +     PL+ ++K     + R   I
Sbjct: 165 VLGLIHVMSNLSD-PNKLAEGIATAFVATVYGVGSANLAYLPLSGKLKIKNHYEGRNREI 223

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIE 274
           + + L+A   G  P    +     L   ER  +E
Sbjct: 224 IIEGLVAIGQGENPNNIEDRLMGFLNEKERSGME 257


>gi|240145495|ref|ZP_04744096.1| chemotaxis protein PomA [Roseburia intestinalis L1-82]
 gi|257202310|gb|EEV00595.1| chemotaxis protein PomA [Roseburia intestinalis L1-82]
          Length = 267

 Score =  192 bits (489), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 48/279 (17%), Positives = 108/279 (38%), Gaps = 24/279 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGG--NPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           +++I+G+ + ++  + G  + GG  + + +      +I  G  + G + +  L    +  
Sbjct: 6   IASIVGMLLGVVMFVFGVLSNGGVASLHSMWDTASFIITIGGSIAGTLASFKLADFINGV 65

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
            S+  IF  +         V+  +  L    +K      E                    
Sbjct: 66  KSIKLIFKDEV---QDPAVVINQIISLSNTARKEGLLALEEA-----------------A 105

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
           N     F+   + +++ G      +  +M+ ++  +               E  PA G++
Sbjct: 106 NGIEDDFLKKGIMLVVDG-TDPELVRGIMETDLACVESRHKAKIAVWEKWAELGPAWGMI 164

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
           G ++G+I  + N+ +    +G A+  +L  TL G +L+  LCNP+  ++K     +  + 
Sbjct: 165 GTLIGLILMLKNM-EDASTIGPAMATALVTTLYGSLLANWLCNPIAGKLKLNNDNEMMMK 223

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVA 277
            I  + +++   G  P+V  E  +  L  S R + +   
Sbjct: 224 EISVEGILSIQAGENPRVIEEKLKSFLAPSARNTAQESE 262


>gi|182418467|ref|ZP_02949761.1| chemotaxis protein MotA [Clostridium butyricum 5521]
 gi|237666315|ref|ZP_04526300.1| chemotaxis protein MotA [Clostridium butyricum E4 str. BoNT E
           BL5262]
 gi|182377849|gb|EDT75393.1| chemotaxis protein MotA [Clostridium butyricum 5521]
 gi|237657514|gb|EEP55069.1| chemotaxis protein MotA [Clostridium butyricum E4 str. BoNT E
           BL5262]
          Length = 272

 Score =  192 bits (489), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 49/276 (17%), Positives = 106/276 (38%), Gaps = 23/276 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMG-GNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGV 59
           M T IGL + I  +  G  + G    ++      + I  G  L   ++  P+   K  G 
Sbjct: 6   MLTAIGLLLGIGMMFYGMASGGLSEMHLFWDAPSVAITIGGSLAAVMIVTPMSEFKKIGT 65

Query: 60  SLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLEN 119
             ++ F   +       + +     L    +K      E+ I++  +             
Sbjct: 66  LFVQAFKEPSSSS---IETIAKFSELSRKARKEGLLSLEDAINNLDDK------------ 110

Query: 120 NELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVG 179
                F+   ++M++ G      I+ +++ EI  +              G   P  G++G
Sbjct: 111 -----FLKKGLQMVVDG-IEPESIKEILELEILGMETRHGNGASIFKTWGAFAPGFGMLG 164

Query: 180 AILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYI 239
            ++G+I+ +GNLS     + + +G +L  T  G +L+  + +P+   + +    +  +  
Sbjct: 165 TLIGLIQMLGNLSD-ASTIASGMGKALITTYYGSLLANLIASPIAQNLSAKSAYEVNMRE 223

Query: 240 IVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEI 275
           ++ + +IA  +G  P++  +     L  SER     
Sbjct: 224 MMVEGIIAIQSGVNPRIVEDKLISYLSPSEREEYSK 259


>gi|255654792|ref|ZP_05400201.1| putative chemotaxis protein [Clostridium difficile QCD-23m63]
 gi|296449537|ref|ZP_06891314.1| chemotaxis MotA protein [Clostridium difficile NAP08]
 gi|296878140|ref|ZP_06902155.1| chemotaxis MotA protein [Clostridium difficile NAP07]
 gi|296261601|gb|EFH08419.1| chemotaxis MotA protein [Clostridium difficile NAP08]
 gi|296430893|gb|EFH16725.1| chemotaxis MotA protein [Clostridium difficile NAP07]
          Length = 262

 Score =  192 bits (488), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 58/278 (20%), Positives = 115/278 (41%), Gaps = 22/278 (7%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M+T+I   + I  ++  F   GG+   L      ++V G  +G    + P  V K S   
Sbjct: 1   MTTLIFFIVGIASLVVAFVIDGGHVGALFVFSSALVVFGGTIGAVGASTPFPVFKKSIKI 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +L  F  K        + +     +    +K      +  I D               NN
Sbjct: 61  MLLAFKNKKPNN---IENIIYFKEIATKARKEGLLSIDKEISD---------------NN 102

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           EL  FI   + +++ G   +  I ++++ +I I      +        G   P +GI+G 
Sbjct: 103 ELDPFIKKGLELMVDG-VDAVTIRSILESQIQITSKRHKEGIAIFDSAGGYAPTMGIIGT 161

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  +GNLS +P  LG  I V+   TL G+  +  +  P+ S++K+   ++    ++
Sbjct: 162 VMGLVHILGNLSSNPDALGPQISVAFLATLYGVGSANLIWLPIASKLKAINQQEISERLL 221

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQ 278
           V +A+++ + G    +  E  +  L   E   +  + +
Sbjct: 222 VIEAILSILEGDNSNLMTEKLKIFLNSKE---LIELEE 256


>gi|189423112|ref|YP_001950289.1| MotA/TolQ/ExbB proton channel [Geobacter lovleyi SZ]
 gi|189419371|gb|ACD93769.1| MotA/TolQ/ExbB proton channel [Geobacter lovleyi SZ]
          Length = 249

 Score =  192 bits (488), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 58/264 (21%), Positives = 103/264 (39%), Gaps = 22/264 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++TIIGL +    + GG    G +   LI P   +IV G   G   ++ PL    +    
Sbjct: 3   LATIIGLALGFGAVFGGAVLEGVHVSALISPTSALIVLGGTFGAVFISFPLAACINGFKD 62

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +   F    +  +    V+K +       ++      E    +                 
Sbjct: 63  IKTAFLPPKVDPEA---VVKDIIGYATKARRNGLISLEQEAQN----------------- 102

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               FI   + +++ G     ++   ++ EI      K          G   P IGI+GA
Sbjct: 103 AKDPFIKKGISLVVDG-IDPQKLRETLEAEIMAYEDHKKHSVEFFEAAGGYSPTIGIIGA 161

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+I  MGNLS +   LG  I  +   T+ G++ +  +C P+ S+IK    ++    ++
Sbjct: 162 VLGLIHVMGNLSDT-SKLGAGIAAAFVATIYGLMTANIICLPIGSKIKIRMKEEVLRRVM 220

Query: 241 VKKALIAYMNGAIPQVAIEYGRKV 264
           + + LIA  NG  P    +  +  
Sbjct: 221 IVEGLIAIQNGENPHFIEQKLKAF 244


>gi|126649534|ref|ZP_01721775.1| flagellar motor protein MotA [Bacillus sp. B14905]
 gi|126593859|gb|EAZ87782.1| flagellar motor protein MotA [Bacillus sp. B14905]
          Length = 267

 Score =  192 bits (488), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 52/273 (19%), Positives = 114/273 (41%), Gaps = 21/273 (7%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
           S++IGL I  + ++ G    G +      P  I+I+    +    +A P++ +K      
Sbjct: 4   SSVIGLIIAFIALLTGMVMKGVSLTAFYNPAAILIIIFGTISAVTIAFPMQELKRVPKLF 63

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
             +F    L  D   +++K+        ++      E+   +                  
Sbjct: 64  KILFKETKLAND--IEIIKMFSQWADLARREGLLALESKASEIE---------------- 105

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
              F+ + + + I G   +  I +++ EE++ +           +  G   P +G++GA+
Sbjct: 106 -DPFLKNGLTLAIDGQ-NADYIRDVLTEEVEAMEERHASGSAIFTQAGTYAPTLGVLGAV 163

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           +G+I A+ +++   + LG AI  +   TLLGI   Y L +P  +++K     + +   ++
Sbjct: 164 VGLIAALADMND-IEKLGHAISAAFMATLLGIFTGYVLWHPFANKLKRKSALEVKQKRMM 222

Query: 242 KKALIAYMNGAIPQVAIEYGRKVLPLSERPSIE 274
            + +++ + G  P+V  +     L + ER  I 
Sbjct: 223 IEGILSVLEGEAPRVIEQKLSSYLTMEERRQIS 255


>gi|229917740|ref|YP_002886386.1| MotA/TolQ/ExbB proton channel [Exiguobacterium sp. AT1b]
 gi|229469169|gb|ACQ70941.1| MotA/TolQ/ExbB proton channel [Exiguobacterium sp. AT1b]
          Length = 260

 Score =  192 bits (488), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 56/277 (20%), Positives = 107/277 (38%), Gaps = 21/277 (7%)

Query: 3   TIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLL 62
           T++GL +  L ++GG    G     LI P  +VI+         +A   + +++      
Sbjct: 5   TLVGLILGFLTLVGGMLLKGAGVAPLINPAAMVIIFVGTAAAVSIAVSKEQLQNVPKLFK 64

Query: 63  EIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNEL 122
            +F  + L   +   +L     L    +K      E  ++                    
Sbjct: 65  ILFKKQELPSKS--GLLTQFVDLSTQARKEGLLSLETALEQVEE---------------- 106

Query: 123 TTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAIL 182
             F+   M M+I G   S  I  +M  +I+ +           +  G   P +G++GA++
Sbjct: 107 -PFLRQGMMMVIDGQ-PSEYIAEVMSRDIENMEQRHKANADIFTQAGTYAPTLGVLGAVI 164

Query: 183 GIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVK 242
           G+I A+ +LS   + LG AI  +   TL GI   Y L  P  +++K     +  +  ++ 
Sbjct: 165 GLIAALKDLSD-IEKLGHAISAAFVATLFGIFTGYVLWFPFANKLKQYSKSEVIIKEMMI 223

Query: 243 KALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQE 279
           + +++  +G  P+   +     L   ER   E   + 
Sbjct: 224 EGILSIQSGESPKTLEDKLSVYLSPKERADYEAQKEA 260


>gi|297618037|ref|YP_003703196.1| MotA/TolQ/ExbB proton channel [Syntrophothermus lipocalidus DSM
           12680]
 gi|297145874|gb|ADI02631.1| MotA/TolQ/ExbB proton channel [Syntrophothermus lipocalidus DSM
           12680]
          Length = 263

 Score =  192 bits (488), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 57/279 (20%), Positives = 120/279 (43%), Gaps = 22/279 (7%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++++IGL I +  +I GF    G   +L++    +IV G  +G   ++   + +K     
Sbjct: 3   LTSLIGLIIGLAGLILGFVLEEGKVGMLLKETAALIVFGGTIGAVTVSFSSEELKTIPYF 62

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F  K +    + + +  L  +    ++      E  +++  N              
Sbjct: 63  LKVVFTNKKI---EFGETIDQLVQVADKARREGLLSLETQLEELEN-------------- 105

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   ++++I G        N+++ EI+     +       +  G   P +GI+G 
Sbjct: 106 ---EFMRRALQLVIDG-TDPELTRNMLEMEIEAFEKRQKLGVDIFNAAGGFAPTMGIIGT 161

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G+++ + N+S+ P  LG AI V+   TL GI  +  L  P   +IK    K+ +L  +
Sbjct: 162 VMGLVQVLSNVSE-PDKLGGAIAVAFIATLYGIFSANILWIPFAGKIKVKTEKEVKLMEL 220

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQE 279
           V + +++   G  P+V  E     L  +E+ ++    + 
Sbjct: 221 VLEGVLSVQAGENPRVIREKLMTFLAPAEKQAMFEAQKA 259


>gi|168703395|ref|ZP_02735672.1| chemotaxis protein [Gemmata obscuriglobus UQM 2246]
          Length = 281

 Score =  191 bits (486), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 72/264 (27%), Positives = 129/264 (48%)

Query: 13  CIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQ 72
            ++ GF   GG    LI   E V + GA LG  +M +P+KVIKD     L+       G+
Sbjct: 13  SVLVGFSMAGGKIGALIHLSEFVTIGGATLGSLIMMSPVKVIKDLIRGALQTVKGSPYGK 72

Query: 73  DTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRM 132
               ++LKL Y L   +++      ++HI +P  S +    P +  N+    F+CD + +
Sbjct: 73  AACVELLKLQYALARLVRQEGLLALDSHITNPDGSALLREYPKLNGNHHAREFLCDSLAL 132

Query: 133 IIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLS 192
           I+ G   S ++   ++EEI ++  E       +S   +SLP  GIV A+LGI+  M  + 
Sbjct: 133 ILDGTVESSQLTEWLEEEIQVVEREHNAAVDTLSKTADSLPGFGIVAAVLGIVVTMQAIG 192

Query: 193 QSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGA 252
              + +G  +G +L GT LGI+ +Y    P+ +++ +   ++      +   ++A  +GA
Sbjct: 193 GPVEEIGYKVGAALVGTFLGILAAYGFVAPMAARMHALGDQEILFLKAMAVGVVAMNDGA 252

Query: 253 IPQVAIEYGRKVLPLSERPSIEIV 276
            P+  +   R+V+    RP+   +
Sbjct: 253 SPKDVVARARRVISTDCRPNQAEL 276


>gi|218290400|ref|ZP_03494530.1| MotA/TolQ/ExbB proton channel [Alicyclobacillus acidocaldarius
           LAA1]
 gi|218239528|gb|EED06722.1| MotA/TolQ/ExbB proton channel [Alicyclobacillus acidocaldarius
           LAA1]
          Length = 265

 Score =  191 bits (486), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 50/253 (19%), Positives = 102/253 (40%), Gaps = 22/253 (8%)

Query: 18  FYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDTYCD 77
           +    GN   LIQP  ++IV G  LG  ++++PLKV       L   F            
Sbjct: 20  YILDKGNIAALIQPSAMMIVFGGTLGATMLSSPLKVFLSLPKYLRIAFFAPKRDPRAQ-- 77

Query: 78  VLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMIIVGN 137
            +  L  L    ++      E+H+                 N+    F+ + +R+I+ G 
Sbjct: 78  -IDQLVDLAVMARREGILALEDHV-----------------NSFDDAFMRNGVRLIVDG- 118

Query: 138 ARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQSPKI 197
                +++++  E+  I        +     G   P +GI+G ++G++  +G+LS +   
Sbjct: 119 IDPELVKDMLQTELAHIEERHEVGINMFEAAGGFAPTMGIIGTVMGLVHVLGSLS-NVSS 177

Query: 198 LGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIPQVA 257
           LG  I  +   TL G+  +     P+ +++++   ++     +  + +++   G  P V 
Sbjct: 178 LGPEIATAFIATLYGVASANIFWLPVANKLRARSQEEMLEREMTLEGILSIQAGENPNVL 237

Query: 258 IEYGRKVLPLSER 270
            +     L  S+R
Sbjct: 238 RQKLLSFLAASDR 250


>gi|1170997|sp|P46826|YTXD_BACME RecName: Full=Uncharacterized 29.3 kDa protein in ccpA 3'region;
           AltName: Full=ORF1
 gi|415665|gb|AAA22296.1| homologue to motA; ORF1; putative [Bacillus megaterium]
          Length = 267

 Score =  191 bits (486), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 55/285 (19%), Positives = 114/285 (40%), Gaps = 25/285 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGN--PYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M T IG+ I I  ++ G  + GGN      I    I+IV G   G   ++ PLK +K+ G
Sbjct: 6   MLTPIGILIGISMVVFGVISSGGNERFLAFIDVPSILIVLGGVFGTLCVSFPLKQLKNMG 65

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
               + F  K +  +    ++     L    ++      E  ++   +S           
Sbjct: 66  RVGKQAFQSKEINVEE---IVGTFVHLSEKARREGLLSLEAELEQIDDS----------- 111

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
                 F+   + + I G      I  L++ EI  +     +        G+  PA G++
Sbjct: 112 ------FVKKGILLAIDG-VEPEMIRELLEAEIATVEERHARGRSMFEKAGDYAPAWGMI 164

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
           G ++G++  + +L+ +P  LG  + ++L  T  G +LS     P+ +++      +  + 
Sbjct: 165 GTLVGLVLMLKSLN-TPSSLGPDMAIALLTTFYGALLSNLFFQPIAAKLAGKTEHELFVK 223

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQY 283
            ++ + +I  + G   +      +   P+ +R  +E   + V + 
Sbjct: 224 EVIIEGVIGLLAGQNSRFVQAKLKVFAPVEKR-KLEEKREHVREA 267


>gi|16802727|ref|NP_464212.1| flagellar motor protein MotA [Listeria monocytogenes EGD-e]
 gi|46906936|ref|YP_013325.1| flagellar motor protein MotA [Listeria monocytogenes serotype 4b
           str. F2365]
 gi|47095251|ref|ZP_00232862.1| chemotaxis protein MotA [Listeria monocytogenes str. 1/2a F6854]
 gi|224498767|ref|ZP_03667116.1| flagellar motor protein MotA [Listeria monocytogenes Finland 1988]
 gi|224502010|ref|ZP_03670317.1| flagellar motor protein MotA [Listeria monocytogenes FSL R2-561]
 gi|226223316|ref|YP_002757423.1| motility protein (flagellar motor rotation) MotA [Listeria
           monocytogenes Clip81459]
 gi|254829342|ref|ZP_05234029.1| motility protein [Listeria monocytogenes FSL N3-165]
 gi|254830324|ref|ZP_05234979.1| flagellar motor protein MotA [Listeria monocytogenes 10403S]
 gi|254853111|ref|ZP_05242459.1| motility protein [Listeria monocytogenes FSL R2-503]
 gi|254900079|ref|ZP_05260003.1| flagellar motor protein MotA [Listeria monocytogenes J0161]
 gi|254911368|ref|ZP_05261380.1| flagellar motor protein MotA [Listeria monocytogenes J2818]
 gi|254935695|ref|ZP_05267392.1| motility protein [Listeria monocytogenes F6900]
 gi|254993371|ref|ZP_05275561.1| flagellar motor protein MotA [Listeria monocytogenes FSL J2-064]
 gi|255026596|ref|ZP_05298582.1| flagellar motor protein MotA [Listeria monocytogenes FSL J2-003]
 gi|255028360|ref|ZP_05300311.1| flagellar motor protein MotA [Listeria monocytogenes LO28]
 gi|284801015|ref|YP_003412880.1| flagellar motor protein MotA [Listeria monocytogenes 08-5578]
 gi|284994157|ref|YP_003415925.1| flagellar motor protein MotA [Listeria monocytogenes 08-5923]
 gi|300764497|ref|ZP_07074490.1| chemotaxis protein MotA [Listeria monocytogenes FSL N1-017]
 gi|5305455|gb|AAD41659.1| motility protein [Listeria monocytogenes]
 gi|16410074|emb|CAC98763.1| lmo0685 [Listeria monocytogenes EGD-e]
 gi|46880202|gb|AAT03502.1| chemotaxis protein MotA [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|47016322|gb|EAL07244.1| chemotaxis protein MotA [Listeria monocytogenes str. 1/2a F6854]
 gi|225875778|emb|CAS04481.1| Putative motility protein (flagellar motor rotation) MotA [Listeria
           monocytogenes serotype 4b str. CLIP 80459]
 gi|258601754|gb|EEW15079.1| motility protein [Listeria monocytogenes FSL N3-165]
 gi|258606461|gb|EEW19069.1| motility protein [Listeria monocytogenes FSL R2-503]
 gi|258608277|gb|EEW20885.1| motility protein [Listeria monocytogenes F6900]
 gi|284056577|gb|ADB67518.1| flagellar motor protein MotA [Listeria monocytogenes 08-5578]
 gi|284059624|gb|ADB70563.1| flagellar motor protein MotA [Listeria monocytogenes 08-5923]
 gi|293589304|gb|EFF97638.1| flagellar motor protein MotA [Listeria monocytogenes J2818]
 gi|300514851|gb|EFK41905.1| chemotaxis protein MotA [Listeria monocytogenes FSL N1-017]
          Length = 283

 Score =  191 bits (486), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 55/270 (20%), Positives = 112/270 (41%), Gaps = 20/270 (7%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++TIIGL + ++ I G F     +  +L     ++++    +   +MA+P   +K     
Sbjct: 3   ITTIIGLVLAVIVIAGSFMIQNISLAMLFSAEALIVIILGTITAVMMAHPWSDVKVVPKL 62

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
              +F  + +      DVL         +++      E+ +D+                 
Sbjct: 63  FKILFTKEKMP--DKVDVLVQYKEYADEIRRSGVLALEDSVDEIE--------------- 105

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   MR+++ G +    + ++++EE+  +           +  G   P +G++GA
Sbjct: 106 --DPFMKRGMRLVVDGQSSPEFLRDVLEEEVASMEERHAAYAKIFASAGAYAPTLGVLGA 163

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
            +G+I AMG +S +P  L  AI  +   T+ GI   Y L  P  +++K    K+  L  +
Sbjct: 164 AMGLIHAMGEMS-NPDKLSEAIAAAFVCTIFGIFTGYVLWTPFANKLKVKSQKEVHLRYM 222

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSER 270
           + + ++A      P+V  E     L   E+
Sbjct: 223 MIEGVVALQERNAPRVVEERLLSFLSPKEK 252


>gi|153947051|ref|YP_001399653.1| flagellar motor protein MotA [Yersinia pseudotuberculosis IP 31758]
 gi|152958546|gb|ABS46007.1| chemotaxis protein MotA [Yersinia pseudotuberculosis IP 31758]
          Length = 288

 Score =  191 bits (486), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 85/282 (30%), Positives = 156/282 (55%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I GL + ++C+IGG+   GG      QP EI+I+ G+G+G  ++ NP  V+KD    
Sbjct: 1   MQKIFGLLVIMVCVIGGYLMSGGVLSSFWQPGEIIIIFGSGIGAMILGNPRSVLKDMWHQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +L +        +    +L LLY L+  + +G     + HI+ P NS++F   P +L++ 
Sbjct: 61  ILAVTRRSEYTGEFQQQLLLLLYELLEMVDEGGLKRLDEHIEIPANSSVFQRYPLILQDL 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L TFI D  R++ +G    +E+E+++++E+  +  E L P  +   +GE++P  GI  A
Sbjct: 121 HLITFISDNFRLMAMGKINQHELESILEQELSAVEEELLVPSRSFQRIGEAMPGFGICAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGII  M ++  S  ++G  +  +L GT LG+ + Y L +PL + ++    K+  L+  
Sbjct: 181 VLGIIITMQSIDGSIAMIGVKVAAALIGTFLGVFICYCLMDPLANAMEQEIKKKLALFEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQ 282
           V+  L+ ++ G    +A++ GRK+LP+  +P+   +   + +
Sbjct: 241 VRMVLVNHVAGKPSLLAVDAGRKMLPMDNKPTFATLDSWINK 282


>gi|150021175|ref|YP_001306529.1| MotA/TolQ/ExbB proton channel [Thermosipho melanesiensis BI429]
 gi|149793696|gb|ABR31144.1| MotA/TolQ/ExbB proton channel [Thermosipho melanesiensis BI429]
          Length = 262

 Score =  191 bits (486), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 55/281 (19%), Positives = 119/281 (42%), Gaps = 22/281 (7%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++ + G+ +  + +I G  + GG+    I    IVIV G  +G  V ANP  +   +   
Sbjct: 3   IALLGGVGLAFVMVIYGIISGGGDFAAFINIPSIVIVIGGSIGAAVAANPKDI---AFKF 59

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +          +  Y ++L+ L  L    ++      E +I+                  
Sbjct: 60  VQVTLEALKEPKTDYVNLLRTLVSLSEKARREGLLSLEENIEQLD--------------- 104

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   +++++ G      ++++M+ EI++   E          +G   PA G++G 
Sbjct: 105 --DPFMKKGLQLLVDG-TEPEVLKSMMEIEIEVASNEMNLKKGLFEAIGAYAPAFGMIGT 161

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G+I+ + +L+  P  LG ++ V+L  TL G I++ +   P+  ++    L       +
Sbjct: 162 LIGLIQMLKSLND-PNSLGPSMAVALITTLYGSIMANAFALPIAEKMGKRVLNTELEKNM 220

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
           + + +++   G  P++  E  +  LP + +   E   QE  
Sbjct: 221 ILEGILSIQAGENPRILEEKLKAFLPQAAKAQYEASTQEAN 261


>gi|116872074|ref|YP_848855.1| flagellar motor protein MotA [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|116740952|emb|CAK20072.1| chemotaxis (flagellar motor rotation) protein MotA [Listeria
           welshimeri serovar 6b str. SLCC5334]
          Length = 279

 Score =  191 bits (486), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 56/297 (18%), Positives = 116/297 (39%), Gaps = 28/297 (9%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++TI+GL + ++ I G F     +  +L     ++++    +   +MA+P   +K     
Sbjct: 3   ITTIVGLVLAVIVIAGSFMIQNISLAMLFSAEALIVIILGTITAVMMAHPWSDVKVVPKL 62

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
              +F  + +      DVL         +++      E+ +D+                 
Sbjct: 63  FKILFTKEKMP--DKVDVLVQYKEYADEIRRSGVLALEDSVDEIE--------------- 105

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   MR+++ G +    + ++++EE+  +           +  G   P +G++GA
Sbjct: 106 --DPFMKRGMRLVVDGQSSPEFLRDVLEEEVASMEERHAAYAKIFASAGAYAPTLGVLGA 163

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
            +G+I AMG +S +P  L  AI  +   T+ GI   Y L  P  +++K    K+  L  +
Sbjct: 164 AMGLIHAMGEMS-NPDKLSEAIAAAFVCTIFGIFTGYVLWTPFANKLKVKSQKEVHLRYM 222

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSER--------PSIEIVAQEVLQYNHNKKA 289
           + + ++A      P+V  E     L   E+             V +        + A
Sbjct: 223 MIEGVVALQERNAPRVVEERLLSFLSPKEKDVLRNGKGKKTREVEETERGQASQETA 279


>gi|254255075|ref|ZP_04948392.1| Flagellar motor component [Burkholderia dolosa AUO158]
 gi|124899720|gb|EAY71563.1| Flagellar motor component [Burkholderia dolosa AUO158]
          Length = 290

 Score =  191 bits (485), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 80/289 (27%), Positives = 146/289 (50%), Gaps = 2/289 (0%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  I+G+ I + C++GGF  MGGN   L QP E++I+ GA  G  V+ NP  V+ +    
Sbjct: 1   MQQIVGIVIVMACVLGGFIFMGGNVAKLWQPVELLIIVGAAAGALVIGNPRHVLSEMASQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           + ++   +     T      LL +             + H++ P+ S++FT  P VL   
Sbjct: 61  VRKVVTGRKRASGTEFQRQLLLLMYELLEVGRDLKALDQHVEAPHESSLFTRYPLVLAEP 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           +L  FI D  RM+ +G   ++E+E ++++E+  I  +  +P  ++  + +++P  GIV A
Sbjct: 121 KLLAFIVDNFRMMALGKISAHELEGVLEQELVAIHEDLEQPSRSMKKISDAMPGFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPK--ILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
           +LG++ AM  ++       L   +G ++ GT +GI   Y + +PL+S I      +   +
Sbjct: 181 VLGVVMAMNGINAGASAGELAEQVGAAMIGTFIGIFFCYGVLDPLSSVIGQLVRAEMSDF 240

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
              K  L+AY  G  P +AI+ GR+++ L  +PS   +   +   +  +
Sbjct: 241 ECAKVVLVAYAAGKPPLLAIDAGRRLVQLINKPSFAQLETWIKDLDGAR 289


>gi|46579054|ref|YP_009862.1| chemotaxis protein PomA [Desulfovibrio vulgaris str. Hildenborough]
 gi|120603362|ref|YP_967762.1| MotA/TolQ/ExbB proton channel [Desulfovibrio vulgaris DP4]
 gi|46448467|gb|AAS95121.1| chemotaxis protein PomA [Desulfovibrio vulgaris str. Hildenborough]
 gi|120563591|gb|ABM29335.1| MotA/TolQ/ExbB proton channel [Desulfovibrio vulgaris DP4]
 gi|311232900|gb|ADP85754.1| MotA/TolQ/ExbB proton channel [Desulfovibrio vulgaris RCH1]
          Length = 250

 Score =  191 bits (485), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 55/272 (20%), Positives = 116/272 (42%), Gaps = 25/272 (9%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++T+IG+      II      GG+    +    +VIV G  +   ++  PL+V+  S   
Sbjct: 3   IATLIGIVGGFALIIIAILL-GGSLMPFVDIPSVVIVIGGTITAILVMFPLEVVLGSMGI 61

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            +  F      ++     ++ +  L    ++ S    E                   +  
Sbjct: 62  AMRTF---KFNKENPVQTVEDICKLADTARRESLVALE-------------------KVP 99

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   +RM+  G+++  ++  L+D EI+ +     +       +G + PA G++G 
Sbjct: 100 LQDEFLKKGIRMVADGSSQ-DQVTALLDAEINFMKQRHRRGQAVFKGLGSAAPAFGMIGT 158

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  + NLS  P  +G A+ V+L  T  G +LS  +  P+  +++     +  +  +
Sbjct: 159 LVGLVNMLQNLSD-PASIGPAMAVALLTTFYGAVLSNLMFLPMAKKLEERSFDEQFMMQL 217

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPS 272
             + +++ +NG  PQ+  E     LP + RP 
Sbjct: 218 KMEGVLSILNGEHPQLVKEKLMAFLPPNLRPK 249


>gi|134094522|ref|YP_001099597.1| proton conductor component of motor, torque generator
           [Herminiimonas arsenicoxydans]
          Length = 208

 Score =  191 bits (485), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 79/207 (38%), Positives = 123/207 (59%)

Query: 79  LKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMIIVGNA 138
           + LL+ ++  ++K      E  ID P  S IFT  PTVL ++ +  FI DY+R+++ GN 
Sbjct: 1   MTLLFEILTKVRKEGLMSIEGDIDAPEESAIFTKYPTVLADHHIIEFITDYLRLMVSGNM 60

Query: 139 RSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQSPKIL 198
            +++IENLMD EID    E   P H I+ MG+ LPA GIV A++G++  M ++   P  L
Sbjct: 61  DAFQIENLMDNEIDTHHAEGEIPVHCIAKMGDGLPAFGIVAAVMGVVHTMASVGLPPAEL 120

Query: 199 GTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIPQVAI 258
           G  I  +L GT LGI+L+Y   +PL+S ++    +  +++  +K  L+A +NG  P +A+
Sbjct: 121 GILIANALVGTFLGILLAYGFVSPLSSTLEQKLHESSKVFQCIKVTLLASLNGYAPALAV 180

Query: 259 EYGRKVLPLSERPSIEIVAQEVLQYNH 285
           E+GRKVL  +ERPS   +   + Q   
Sbjct: 181 EFGRKVLFSTERPSFSELEDHIKQSKS 207


>gi|254824035|ref|ZP_05229036.1| flagellar motor protein MotA [Listeria monocytogenes FSL J1-194]
 gi|254932035|ref|ZP_05265394.1| flagellar motor protein MotA [Listeria monocytogenes HPB2262]
 gi|293583588|gb|EFF95620.1| flagellar motor protein MotA [Listeria monocytogenes HPB2262]
 gi|293593264|gb|EFG01025.1| flagellar motor protein MotA [Listeria monocytogenes FSL J1-194]
 gi|307570224|emb|CAR83403.1| chemotaxis protein [Listeria monocytogenes L99]
 gi|328475648|gb|EGF46397.1| flagellar motor protein MotA [Listeria monocytogenes 220]
 gi|332311110|gb|EGJ24205.1| Chemotaxis protein MotA [Listeria monocytogenes str. Scott A]
          Length = 283

 Score =  191 bits (485), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 54/270 (20%), Positives = 112/270 (41%), Gaps = 20/270 (7%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++TIIGL + ++ I G F     +  +L     ++++    +   +MA+P   +K     
Sbjct: 3   ITTIIGLVLAVIVIAGSFMIQNISLAMLFSAEALIVIILGTITAVMMAHPWSDVKVVPKL 62

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
              +F  + +      +VL         +++      E+ +D+                 
Sbjct: 63  FKILFTKEKMP--DKVEVLVQYKEYADEIRRSGVLALEDSVDEIE--------------- 105

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   MR+++ G +    + ++++EE+  +           +  G   P +G++GA
Sbjct: 106 --DPFMKRGMRLVVDGQSSPEFLRDVLEEEVASMEERHAAYAKIFASAGAYAPTLGVLGA 163

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
            +G+I AMG +S +P  L  AI  +   T+ GI   Y L  P  +++K    K+  L  +
Sbjct: 164 AMGLIHAMGEMS-NPDKLSEAIAAAFVCTIFGIFTGYVLWTPFANKLKVKSQKEVHLRYM 222

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSER 270
           + + ++A      P+V  E     L   E+
Sbjct: 223 MIEGVVALQERNAPRVVEERLLSFLSPKEK 252


>gi|121533428|ref|ZP_01665256.1| MotA/TolQ/ExbB proton channel [Thermosinus carboxydivorans Nor1]
 gi|121307987|gb|EAX48901.1| MotA/TolQ/ExbB proton channel [Thermosinus carboxydivorans Nor1]
          Length = 261

 Score =  191 bits (485), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 61/278 (21%), Positives = 121/278 (43%), Gaps = 21/278 (7%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
           ST++G+ + ++ I  G    G N  IL+    I+I+    L   + A PL  IK   V  
Sbjct: 4   STVLGMLVGVVAISVGMVLKGANLSILLNYAAIMIIFVGTLASLLNAFPLAQIKKLPVLF 63

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
             +F  + L      ++LKL   +    ++      E  +++                  
Sbjct: 64  KLLFKEQQLMPR--TELLKLFVEMAQTARREGLLALEGRLEEIS---------------- 105

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
              F+ + + M++ G   +  I ++++ EI+++     K     +  G   P +G++GA+
Sbjct: 106 -DPFLRNGLMMVVDGM-DTELIRDVLEAEIELMQERHSKGALMFTQAGTYAPTLGVLGAV 163

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           +G+I A+GNL    + LG +I  +   TL GI   Y + +P  +++K     +  L  ++
Sbjct: 164 VGLIAALGNLDD-IEKLGHSIAAAFVATLFGIFSGYVMWHPFANKLKFLSKNEVELKRMM 222

Query: 242 KKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQE 279
            + +++   G  P          +P SER S++   +E
Sbjct: 223 IEGILSLQAGESPNALEAKLVVFIPQSERASLKEKREE 260


>gi|114777570|ref|ZP_01452551.1| hypothetical protein SPV1_07681 [Mariprofundus ferrooxydans PV-1]
 gi|114552041|gb|EAU54558.1| hypothetical protein SPV1_07681 [Mariprofundus ferrooxydans PV-1]
          Length = 252

 Score =  191 bits (485), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 52/272 (19%), Positives = 119/272 (43%), Gaps = 25/272 (9%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++TIIG+ +    ++      GG     I P  ++IV G  +G  ++  P   +K +   
Sbjct: 3   IATIIGILVAFGLVVSAI---GGGISSFIDPPSMLIVIGGTVGVLLVGYP---LKTALSV 56

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  +        D+  +V+  L  L   ++K      E  + +  N              
Sbjct: 57  IGIVMKTFLYKVDSGSEVIAKLVELAQTVRKDGILALEGEVGNIDNK------------- 103

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   ++M I G      IE+++ +E+D +           + +G   P++G++G 
Sbjct: 104 ----FMAKGLQMAIDGQ-EPSVIEDILYKEMDKVAERHALGADMFTSLGTYAPSMGMIGT 158

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  + N+S  P  +G ++ ++L  T  G +++  L  P++ ++K+   ++  ++ I
Sbjct: 159 LVGLVLMLQNMSD-PSSIGPSMSIALLTTFYGALMANILFLPMSGKLKNRSKQEMLVHEI 217

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPS 272
           +   + + + G  P++  +     LP  ER S
Sbjct: 218 ILVGVQSLVIGENPRIMEQKLLGYLPPKERKS 249


>gi|290893980|ref|ZP_06556955.1| motility protein [Listeria monocytogenes FSL J2-071]
 gi|315281339|ref|ZP_07869985.1| chemotaxis protein MotA [Listeria marthii FSL S4-120]
 gi|290556426|gb|EFD89965.1| motility protein [Listeria monocytogenes FSL J2-071]
 gi|313615015|gb|EFR88513.1| chemotaxis protein MotA [Listeria marthii FSL S4-120]
          Length = 283

 Score =  190 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 54/270 (20%), Positives = 112/270 (41%), Gaps = 20/270 (7%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++TI+GL + ++ I G F     +  +L     ++++    +   +MA+P   +K     
Sbjct: 3   ITTIVGLVLAVIVIAGSFMIQNISLAMLFSAEALIVIILGTITAVMMAHPWSDVKVVPKL 62

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
              +F  + +      DVL         +++      E+ +D+                 
Sbjct: 63  FKILFTKEKMP--DKVDVLVQYKEYADEIRRSGVLALEDSVDEIE--------------- 105

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   MR+++ G +    + ++++EE+  +           +  G   P +G++GA
Sbjct: 106 --DPFMKRGMRLVVDGQSSPEFLRDVLEEEVASMEERHAAYAKIFASAGAYAPTLGVLGA 163

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
            +G+I AMG +S +P  L  AI  +   T+ GI   Y L  P  +++K    K+  L  +
Sbjct: 164 AMGLIHAMGEMS-NPDKLSEAIAAAFVCTIFGIFTGYVLWTPFANKLKVKSQKEVHLRYM 222

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSER 270
           + + ++A      P+V  E     L   E+
Sbjct: 223 MIEGVVALQERNAPRVVEERLLSFLSPKEK 252


>gi|294501553|ref|YP_003565253.1| putative flagellar motor channel protein [Bacillus megaterium QM
           B1551]
 gi|294351490|gb|ADE71819.1| putative flagellar motor channel protein [Bacillus megaterium QM
           B1551]
          Length = 267

 Score =  190 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 54/285 (18%), Positives = 112/285 (39%), Gaps = 25/285 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGG--NPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M T IG+ I I  ++ G  + GG       I    I+IV G   G   ++ PLK +K+ G
Sbjct: 6   MLTPIGILIGISMVVFGVISSGGMSGFLAFIDVPSILIVLGGVFGTLCVSFPLKQLKNMG 65

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
               + F  K +  +    ++     L    ++      E  ++   +S           
Sbjct: 66  KVGKQAFQSKEINVEE---IVGTFVHLSEKARREGLLSLEAELEQIDDS----------- 111

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
                 F+   + + I G      I  L++ EI  +     +        G+  PA G++
Sbjct: 112 ------FVKKGILLAIDG-VEPEMIRELLEAEIAAVEERHARGRSMFEKAGDYAPAWGMI 164

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
           G ++G++  + +L+ +P  LG  + ++L  T  G +LS     P+ +++      +  + 
Sbjct: 165 GTLVGLVLMLKSLN-TPSSLGPNMAIALLTTFYGALLSNLFFQPIAAKLAGKTEHELFVK 223

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQY 283
            ++ + +I    G   +      +   P+ +R  +E   + V + 
Sbjct: 224 EVIIEGVIGLQAGQNSRFVQAKLKVFAPVEKR-KLEEKREHVREA 267


>gi|284041523|ref|YP_003391863.1| MotA/TolQ/ExbB proton channel [Conexibacter woesei DSM 14684]
 gi|283945744|gb|ADB48488.1| MotA/TolQ/ExbB proton channel [Conexibacter woesei DSM 14684]
          Length = 265

 Score =  190 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 56/274 (20%), Positives = 107/274 (39%), Gaps = 22/274 (8%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
           ST IGL   +L I+      G +P   I    I+IV        + +  +  +K      
Sbjct: 4   STAIGLVGGLLAILLTGMLEGTSPATFINIPAIIIVLVGTFMATMASVGIDQMKRIPTLY 63

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
              F  +          + LL  +    ++      +  + D                  
Sbjct: 64  KITFSPQE---QDLRARVDLLVGIAEQARREGLLALDAQLGDID---------------- 104

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
              F    +++++ G      +  +++ EID ++       +     G   P +GI+GA+
Sbjct: 105 -DEFTRKGLQLVVDG-TDPDLVREILEAEIDGMVARHAIGANTFEKAGGYAPTLGILGAV 162

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           +G+I  +GNLS  P  LG AI V+   TL G+  +  +  P+ S++K+   ++  L  + 
Sbjct: 163 MGLISVLGNLSD-PDSLGPAISVAFIATLYGVGGANIVFLPICSRLKALSEEEVELRTLT 221

Query: 242 KKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEI 275
              ++A   G  P+V  +     +P SER + + 
Sbjct: 222 LDGILAVQAGDNPRVVADKLSSYVPPSERATADD 255


>gi|187932462|ref|YP_001885052.1| chemotaxis protein MotA [Clostridium botulinum B str. Eklund 17B]
 gi|187720615|gb|ACD21836.1| chemotaxis protein MotA [Clostridium botulinum B str. Eklund 17B]
          Length = 271

 Score =  190 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 47/288 (16%), Positives = 108/288 (37%), Gaps = 25/288 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGG---NPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDS 57
           + T  GL + +  +I G  + G    N  +      I I  G  +   ++  PL  IK +
Sbjct: 6   IMTAAGLIMGLGLMIYGMASGGSGASNLKLFWDVSSIAITFGGSIAAVMIVYPLDEIKKA 65

Query: 58  GVSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVL 117
           G+  L+ F           + +     L    ++      E+ I    +           
Sbjct: 66  GILFLQSFKEPKSST---METISQFTELSRKARRDGLLSLEDTISQLEDK---------- 112

Query: 118 ENNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGI 177
                  F+   ++M++ G      I+ +++ +I  +           S  G   P  G+
Sbjct: 113 -------FLKKGLQMVVDG-IEPESIKEILELDISEMEVRHKSGSGIFSAWGAFAPGFGM 164

Query: 178 VGAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRL 237
           +G ++G+I+ + NL+ S   + + +G +L  T  G +++    +P+   + +   K+  +
Sbjct: 165 LGTLIGLIQMLANLTDS-STIASGMGKALITTFYGSLIANIFASPIAQNLNNKSQKEVAI 223

Query: 238 YIIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
             ++ + +++  +G  P++  +     L   ER        E  +   
Sbjct: 224 KEMMLEGILSIQSGVNPRIVEDKLISYLSPQERIVYTQNNSENNEGVA 271


>gi|82702443|ref|YP_412009.1| flagellar motor protein [Nitrosospira multiformis ATCC 25196]
 gi|82410508|gb|ABB74617.1| MotA/TolQ/ExbB proton channel [Nitrosospira multiformis ATCC 25196]
          Length = 246

 Score =  190 bits (484), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 58/263 (22%), Positives = 115/263 (43%), Gaps = 22/263 (8%)

Query: 3   TIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLL 62
           +IIG+ I ++ + GG    GG+   LIQ   +V+V G  LG  ++ +P++    +     
Sbjct: 5   SIIGIGIALVAVFGGQVLEGGHHASLIQVTSLVVVLGGTLGAVLLQSPVRQFVLAMKMSR 64

Query: 63  EIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNEL 122
            IF    L  +    V++ +       +K      +NH++                    
Sbjct: 65  WIFVPPVLNPEA---VVQHIATWSAAARKEGLLALDNHVEGID----------------- 104

Query: 123 TTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAIL 182
             F+   ++M++ G      ++ +++ EI+       +        G   P IGI+GA++
Sbjct: 105 DPFVRKGLQMVVDG-TEPKVLQRVLEVEIETFEDLHHQGAKVWEAAGGYAPTIGILGAVM 163

Query: 183 GIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVK 242
           G+I+ M NLS +P  LG  I V+   T+ G+ L+     P+ +++K+   +Q  L  ++ 
Sbjct: 164 GLIQVMENLS-NPADLGAGIAVAFVATIYGVGLANLAFLPIANKLKTLIARQVLLRDMLV 222

Query: 243 KALIAYMNGAIPQVAIEYGRKVL 265
             L+    G  P++  E  +  +
Sbjct: 223 DGLVGIAKGENPRLIAERLKGYV 245


>gi|289433963|ref|YP_003463835.1| chemotaxis protein MotA [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|289170207|emb|CBH26747.1| chemotaxis protein MotA [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|313634397|gb|EFS00986.1| chemotaxis protein MotA [Listeria seeligeri FSL N1-067]
          Length = 283

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 54/270 (20%), Positives = 110/270 (40%), Gaps = 20/270 (7%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++TI+GL + ++ I G F     +  +L     ++++    +   +MA+P   +K     
Sbjct: 3   ITTIVGLVLAVIVIAGSFMIQNISLAMLFSAEALIVIILGTITAVMMAHPWSDVKVVPKL 62

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
              +F           DVL         +++      E+ +D+                 
Sbjct: 63  FKILFT--KERGPDKVDVLIQYKEYADEIRRSGVLALEDSVDEIE--------------- 105

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   MR+++ G +    + ++++EE+  +           +  G   P +G++GA
Sbjct: 106 --DPFMKRGMRLVVDGQSSPEFLRDVLEEEVSSMEERHAAYAKIFASAGAYAPTLGVLGA 163

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
            +G+I AMG +S +P  L  AI  +   T+ GI   Y L  P  +++K    K+  L  +
Sbjct: 164 AMGLIHAMGEMS-NPDKLSEAIAAAFICTIFGIFTGYVLWTPFANKLKVKSQKEVHLRYM 222

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSER 270
           + + ++A      P+V  E     L   E+
Sbjct: 223 MIEGVVALQERNAPRVVEERLLSFLSPKEK 252


>gi|94264077|ref|ZP_01287876.1| MotA/TolQ/ExbB proton channel [delta proteobacterium MLMS-1]
 gi|93455493|gb|EAT05683.1| MotA/TolQ/ExbB proton channel [delta proteobacterium MLMS-1]
          Length = 253

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 51/273 (18%), Positives = 110/273 (40%), Gaps = 25/273 (9%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++T++G+ +  + + G     G  P I + P  ++IV G      ++      + +S   
Sbjct: 3   LATLVGVVLGTILLSGAILL-GDAPGIFVNPPGVLIVFGGTFAATLIRFSFADVVNSIKI 61

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +   F  +         V+  +  L +  +K      E                      
Sbjct: 62  VANAFTVRLSNPQE---VIAEIVSLAHVARKNGLIVLEQQ-------------------P 99

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   +   + G+  +  IE ++ +E+D+ L            MG S PA G++G 
Sbjct: 100 ITDPFLKKSIMYCVDGH-EAEFIEEVLQKEVDLTLDRHRVGRKVFEGMGISAPAFGMIGT 158

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G+++ + +L   P  +G  + V++  TL G +L+  L  PL  ++     ++ R   +
Sbjct: 159 LVGLVQMLAHLDD-PAAIGPGMAVAMLTTLYGAVLANFLFIPLADKLSLRSEEEERNRQL 217

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSI 273
           + + ++  + G  P+V  E+    LP  +R S 
Sbjct: 218 IIEGVLGILKGLNPRVMEEFLETFLPPKDRKSA 250


>gi|83589324|ref|YP_429333.1| MotA/TolQ/ExbB proton channel [Moorella thermoacetica ATCC 39073]
 gi|83572238|gb|ABC18790.1| MotA/TolQ/ExbB proton channel [Moorella thermoacetica ATCC 39073]
          Length = 277

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 47/281 (16%), Positives = 103/281 (36%), Gaps = 23/281 (8%)

Query: 11  ILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKAL 70
              +I  F   GG+P  L+     +IV G  +G  ++    + + +    L   F  K L
Sbjct: 15  FGSLIAAFILEGGSPGALLAITAAMIVFGGTIGATLIGLRREEVLNIPRLLKVAFREKPL 74

Query: 71  GQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYM 130
                 + +  +       +K      E  +                 +     F+   +
Sbjct: 75  ---DLNETINAIVNYAVLARKEGFVRLEKEL-----------------DGVKDDFLRTAL 114

Query: 131 RMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGN 190
           ++++ G     +  N++++ I                 G   P +GI+G ++G++  + N
Sbjct: 115 QLVVDG-TDPEQTRNVLEQYIYATSERHHSGISLFEAAGGYAPTMGIIGTVMGLVHVLSN 173

Query: 191 LSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMN 250
           LS +P  LG +I ++   TL G+  +  L  P+ +++K+   ++     ++ + ++A   
Sbjct: 174 LS-TPDKLGPSIAMAFIATLYGVSSANLLWLPIATKLKNKDARERLYQEMILEGVLALQA 232

Query: 251 GAIPQVAIEYGRKVLPL-SERPSIEIVAQEVLQYNHNKKAS 290
           G  P +        L    ER       +EV      +  +
Sbjct: 233 GKNPTLIRNTLAAFLAPGKERAGAGKEEREVSDGAGPQGRA 273


>gi|108809035|ref|YP_652951.1| flagellar motor protein MotA [Yersinia pestis Antiqua]
 gi|150260229|ref|ZP_01916957.1| lateral flagellar proton motor protein A [Yersinia pestis
           CA88-4125]
 gi|162420069|ref|YP_001604824.1| flagellar motor protein MotA [Yersinia pestis Angola]
 gi|165925094|ref|ZP_02220926.1| chemotaxis protein MotA [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|166008864|ref|ZP_02229762.1| chemotaxis protein MotA [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166212123|ref|ZP_02238158.1| chemotaxis protein MotA [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167399319|ref|ZP_02304843.1| chemotaxis protein MotA [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167418793|ref|ZP_02310546.1| chemotaxis protein MotA [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167466316|ref|ZP_02331020.1| chemotaxis protein MotA [Yersinia pestis FV-1]
 gi|218927932|ref|YP_002345807.1| flagellar motor protein MotA [Yersinia pestis CO92]
 gi|229840643|ref|ZP_04460802.1| Flagellar motor rotation protein motA [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229842805|ref|ZP_04462957.1| Flagellar motor rotation protein motA [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|294502808|ref|YP_003566870.1| flagellar motor protein [Yersinia pestis Z176003]
 gi|108780948|gb|ABG15006.1| putative flagellar motor transmembrane channel protein [Yersinia
           pestis Antiqua]
 gi|115346543|emb|CAL19420.1| putative flagellar motor transmembrane channel protein [Yersinia
           pestis CO92]
 gi|149289637|gb|EDM39714.1| lateral flagellar proton motor protein A [Yersinia pestis
           CA88-4125]
 gi|162352884|gb|ABX86832.1| chemotaxis protein MotA [Yersinia pestis Angola]
 gi|165923294|gb|EDR40445.1| chemotaxis protein MotA [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165992203|gb|EDR44504.1| chemotaxis protein MotA [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166206869|gb|EDR51349.1| chemotaxis protein MotA [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166962787|gb|EDR58808.1| chemotaxis protein MotA [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167051823|gb|EDR63231.1| chemotaxis protein MotA [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|229690072|gb|EEO82129.1| Flagellar motor rotation protein motA [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229697009|gb|EEO87056.1| Flagellar motor rotation protein motA [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|262360840|gb|ACY57561.1| flagellar motor protein [Yersinia pestis D106004]
 gi|262364785|gb|ACY61342.1| flagellar motor protein [Yersinia pestis D182038]
 gi|294353267|gb|ADE63608.1| flagellar motor protein [Yersinia pestis Z176003]
          Length = 288

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 82/282 (29%), Positives = 157/282 (55%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  + GL + + C+IGG+   GG+     QP EI+I+ G+G+G  ++ NP  V+++    
Sbjct: 1   MQKLFGLLVIMGCVIGGYLMSGGSLSSFWQPGEIIIIFGSGIGALILGNPGSVLQEMWHQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +L +        +    +L LLY L+  + +G     + HI+ P NS++F   P +L++ 
Sbjct: 61  ILAVARRSEYTVEFQQQLLLLLYELLEMVDEGGLKRLDEHIEIPANSSVFQRYPLILQDL 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L TFI D  R++ +G    +E+E+++++E+  +  E L P  +   +GE++P  GI  A
Sbjct: 121 HLITFISDNFRLMAMGKINQHELESILEQELSAVEEELLVPSRSFQRIGEAMPGFGICAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGII  M ++  S  ++G  +  +L GT LG+ + Y L +PL++ ++    K+  L+  
Sbjct: 181 VLGIIITMQSIDGSIAMIGIKVAAALVGTFLGVFICYCLMDPLSNAMEQEIKKKLALFEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQ 282
           V+  L+ ++ G    +A++ GRK+LP+  +P+   +   + +
Sbjct: 241 VRMVLVNHVAGKPSLLAVDAGRKMLPMDNKPTFATLDSWINK 282


>gi|16799768|ref|NP_470036.1| flagellar motor protein MotA [Listeria innocua Clip11262]
 gi|16413145|emb|CAC95925.1| lin0693 [Listeria innocua Clip11262]
 gi|313620084|gb|EFR91592.1| chemotaxis protein MotA [Listeria innocua FSL S4-378]
 gi|313624927|gb|EFR94835.1| chemotaxis protein MotA [Listeria innocua FSL J1-023]
          Length = 283

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 53/270 (19%), Positives = 112/270 (41%), Gaps = 20/270 (7%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++TIIGL + ++ I G F     +  +L     ++++    +   +MA+P   +K     
Sbjct: 3   ITTIIGLVLAVIVIAGSFMIQNISLAMLFSAEALIVIILGTITAVMMAHPWSDVKVVPKL 62

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
              +F  + +      ++L         +++      E+ +D+                 
Sbjct: 63  FKILFTKEKMP--DKVEILVQYKEYADEIRRSGVLALEDSVDEIE--------------- 105

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   MR+++ G +    + ++++EE+  +           +  G   P +G++GA
Sbjct: 106 --DPFMKRGMRLVVDGQSSPEFLRDVLEEEVASMEERHAAYAKIFASAGAYAPTLGVLGA 163

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
            +G+I AMG +S +P  L  AI  +   T+ GI   Y L  P  +++K    K+  L  +
Sbjct: 164 AMGLIHAMGEMS-NPDKLSEAIAAAFVCTIFGIFTGYVLWTPFANKLKVKSQKEVHLRYM 222

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSER 270
           + + ++A      P+V  E     L   E+
Sbjct: 223 MIEGVVALQERNAPRVVEERLLSFLSPKEK 252


>gi|258510422|ref|YP_003183856.1| MotA/TolQ/ExbB proton channel [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
 gi|257477148|gb|ACV57467.1| MotA/TolQ/ExbB proton channel [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
          Length = 265

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 49/253 (19%), Positives = 100/253 (39%), Gaps = 22/253 (8%)

Query: 18  FYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDTYCD 77
           +    GN   LIQP  ++IV G  LG  ++++ LKV       L   F            
Sbjct: 20  YILDKGNIAALIQPSAMMIVFGGTLGATMLSSSLKVFLSLPKYLRIAFFAPKRDPRAQ-- 77

Query: 78  VLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMIIVGN 137
            +  L  L    ++      E+H+                 N+    F+ + +R+I+ G 
Sbjct: 78  -IDQLVDLAVMARREGILALEDHV-----------------NSFDDAFMRNGVRLIVDG- 118

Query: 138 ARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQSPKI 197
                +++++  E+  I        +     G   P +GI+G ++G++  +G+LS     
Sbjct: 119 IDPELVKDMLQTELAHIEERHEVGINMFEAAGGFAPTMGIIGTVMGLVHVLGSLSD-VSS 177

Query: 198 LGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIPQVA 257
           LG  I  +   TL G+  +     P+ +++++   ++     +  + +++   G  P V 
Sbjct: 178 LGPEIATAFIATLYGVASANIFWLPVANKLRARSQEEMLEREMTLEGILSIQAGENPNVL 237

Query: 258 IEYGRKVLPLSER 270
            +     L  S+R
Sbjct: 238 RQKLLSFLAASDR 250


>gi|220917667|ref|YP_002492971.1| MotA/TolQ/ExbB proton channel [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219955521|gb|ACL65905.1| MotA/TolQ/ExbB proton channel [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 261

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 57/271 (21%), Positives = 106/271 (39%), Gaps = 24/271 (8%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
           +TI G+F  +  I+ G    GG+   L+Q    +IV G   G  ++A P + +  +   L
Sbjct: 4   TTIAGIFAAVGLILLGQALEGGHVGSLLQATAALIVFGGTFGAVLVAFPRRDVGRALSQL 63

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
             +F  + +       + + L       ++      E  +                    
Sbjct: 64  KLVFAERKV---DLGALSRELVEYAGVARRDGVLALEAKLPGI----------------- 103

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
              F+   +++++ G   +    + ++  +D    E           G   P IGI+GA+
Sbjct: 104 PDPFLRRALQLVVDG-VDASVTRSTLEAAVDAEYEEHAVGAKVWEAAGGFAPTIGILGAV 162

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           LG+I  M NLS  P  LG  I V+   T+ G+  +  L  P  +++K     +     ++
Sbjct: 163 LGLIHVMENLSD-PSKLGGGIAVAFVATVYGVGSANVLFLPFATKMKRKLGAERDRKTLI 221

Query: 242 KKALIAYMNGAIPQVAIEYGRKVL--PLSER 270
            + ++A   G  P+V  E  R     P +ER
Sbjct: 222 TEGVLAIQEGINPRVLEEKLRAYSGEPPAER 252


>gi|194365635|ref|YP_002028245.1| flagellar motor protein [Stenotrophomonas maltophilia R551-3]
 gi|194348439|gb|ACF51562.1| MotA/TolQ/ExbB proton channel [Stenotrophomonas maltophilia R551-3]
          Length = 246

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 50/264 (18%), Positives = 101/264 (38%), Gaps = 22/264 (8%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
            ++IGLF+ +  ++GG    G     L  P   VIV    +   ++     V K +   +
Sbjct: 4   LSLIGLFLALASLVGGSILKGAGLASLWSPAAFVIVIVGTVAAILLHTSPAVFKHAFKIV 63

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
             +            ++++ +       ++      E  ++                   
Sbjct: 64  RWVVRPP---HSDRRELIQQIVEWSNIARRQGLLGLEAQVEAQQ---------------- 104

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
              F+   +++++ G      I ++++ E+    ++          MG   P +GI+GA+
Sbjct: 105 -DPFLRKGLQLLVDG-VEPESIRHMLEIELGSQEHQDQAGAKVFEAMGIYAPTLGIIGAV 162

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           LG+I  M NL+  P  LG  I  + T T+ GI  +  L  P+ +++KS      R   ++
Sbjct: 163 LGLIAVMKNLAD-PSKLGHGIAAAFTATIYGIASANLLFLPIAAKLKSVISHNTRDREMI 221

Query: 242 KKALIAYMNGAIPQVAIEYGRKVL 265
            + LI+   G  P+         L
Sbjct: 222 IEGLISIAQGENPRNIETNLSGFL 245


>gi|328467254|gb|EGF38334.1| flagellar motor protein MotA [Listeria monocytogenes 1816]
          Length = 283

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 54/270 (20%), Positives = 113/270 (41%), Gaps = 20/270 (7%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++TIIGL + ++ I G F     +  +L+    ++++    +   +MA+P   +K     
Sbjct: 3   ITTIIGLVLAVIVIAGSFMIQNISLAMLLSAEALIVIILGTITAVMMAHPWSDVKVVPKL 62

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
              +F  + +      +VL         +++      E+ +D+                 
Sbjct: 63  FKILFTKEKMP--DKVEVLVQYKEYADEIRRSGVLALEDSVDEIE--------------- 105

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   MR+++ G +    + ++++EE+  +           +  G   P +G++GA
Sbjct: 106 --DPFMKRGMRLVVDGQSSPEFLRDVLEEEVASMEERHAAYAKIFASAGAYAPTLGVLGA 163

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
            +G+I AMG +S +P  L  AI  +   T+ GI   Y L  P  +++K    K+  L  +
Sbjct: 164 AMGLIHAMGEMS-NPDKLSEAIAAAFVCTIFGIFTGYVLWTPFANKLKVKSQKEVHLRYM 222

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSER 270
           + + ++A      P+V  E     L   E+
Sbjct: 223 MIEGVVALQERNAPRVVEERLLSFLSPKEK 252


>gi|51597619|ref|YP_071810.1| flagellar motor protein MotA [Yersinia pseudotuberculosis IP 32953]
 gi|186896752|ref|YP_001873864.1| flagellar motor protein MotA [Yersinia pseudotuberculosis PB1/+]
 gi|51590901|emb|CAH22557.1| putative flagellar motor transmembrane channel protein [Yersinia
           pseudotuberculosis IP 32953]
 gi|186699778|gb|ACC90407.1| MotA/TolQ/ExbB proton channel [Yersinia pseudotuberculosis PB1/+]
          Length = 288

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 82/282 (29%), Positives = 157/282 (55%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  + GL + + C+IGG+   GG+     QP EI+I+ G+G+G  ++ NP  V+++    
Sbjct: 1   MQKLFGLLVIMGCVIGGYLMSGGSLSSFWQPGEIIIIFGSGIGAMILGNPGSVLQEMWHQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +L +        +    +L LLY L+  + +G     + HI+ P NS++F   P +L++ 
Sbjct: 61  ILAVARRSEYTVEFQQQLLLLLYELLEMVDEGGLKRLDEHIEIPANSSVFQRYPLILQDL 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L TFI D  R++ +G    +E+E+++++E+  +  E L P  +   +GE++P  GI  A
Sbjct: 121 HLITFISDNFRLMAMGKINQHELESILEQELSAVEEELLVPSRSFQRIGEAMPGFGICAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGII  M ++  S  ++G  +  +L GT LG+ + Y L +PL++ ++    K+  L+  
Sbjct: 181 VLGIIITMQSIDGSIAMIGIKVAAALVGTFLGVFICYCLMDPLSNAMEQEIKKKLALFEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQ 282
           V+  L+ ++ G    +A++ GRK+LP+  +P+   +   + +
Sbjct: 241 VRMVLVNHVAGKPSLLAVDAGRKMLPMDNKPTFATLDSWINK 282


>gi|254522690|ref|ZP_05134745.1| flagellar motor protein [Stenotrophomonas sp. SKA14]
 gi|219720281|gb|EED38806.1| flagellar motor protein [Stenotrophomonas sp. SKA14]
          Length = 246

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 50/264 (18%), Positives = 102/264 (38%), Gaps = 22/264 (8%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
            ++IGLF+ +  ++GG    G     L  P   VIV    +   ++     V K +   +
Sbjct: 4   LSLIGLFLALASLVGGSILKGAGLASLWSPAAFVIVIVGTIAAILLHTSPAVFKHAFKIV 63

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
             +            ++++ +       ++      E+ ++                   
Sbjct: 64  RWVVRPP---HSDRRELIQQIVEWSNIARRQGLLGLESQVEAQQ---------------- 104

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
              F+   +++++ G      + ++++ E+    ++          MG   P +GI+GA+
Sbjct: 105 -DPFLRKGLQLLVDG-VEPESMRHMLEIELGSQEHQDQAGAKVFEAMGIYAPTLGIIGAV 162

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           LG+I  M NL+  P  LG  I  + T T+ GI  +  L  P+ +++KS      R   +V
Sbjct: 163 LGLIAVMKNLAD-PSKLGHGIAAAFTATIYGIASANLLFLPIAAKLKSVISHNTRDREMV 221

Query: 242 KKALIAYMNGAIPQVAIEYGRKVL 265
            + LI+   G  P+         L
Sbjct: 222 IEGLISIAQGENPRNIETNLSGFL 245


>gi|308273522|emb|CBX30124.1| Uncharacterized 29.3 kDa protein in ccpA 3'region [uncultured
           Desulfobacterium sp.]
          Length = 249

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 51/270 (18%), Positives = 115/270 (42%), Gaps = 23/270 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++T++G+F     +      MGG   + I    ++IVAG  LG  ++  PL  I      
Sbjct: 3   IATVLGIFSAFGLVFVA-IFMGGGIKLFIDLPSLMIVAGGTLGATMINYPLSEILGVFRV 61

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +   F    +  +    ++++       +++      +  +                   
Sbjct: 62  VKNAFFTSNIQNEW---LIRIFVGFANRVRREGLLSLDGELSGIK--------------- 103

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   +++ I G     EI+N+++ EID I             MG   PA+G++G 
Sbjct: 104 --DEFLKKGIQLSIDG-LEPQEIKNILETEIDFIRSRHSLGAEIFVTMGTYAPALGMIGT 160

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G+I+ + ++   P  +G ++ V+L  T  G I++  +C P+  ++++   ++     +
Sbjct: 161 LIGLIQMLQSMDD-PGKIGPSMSVALVTTFYGSIMANIICLPIAGKLRTRSKEEILSKEM 219

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSER 270
           + + +I+  NG  P++  E  +  +P   R
Sbjct: 220 MIQGVISLSNGDNPRILEERLKVFVPGGRR 249


>gi|205374482|ref|ZP_03227278.1| flagellar motor protein MotP [Bacillus coahuilensis m4-4]
          Length = 274

 Score =  190 bits (482), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 49/289 (16%), Positives = 108/289 (37%), Gaps = 28/289 (9%)

Query: 1   MSTIIGLFITILCIIGGFYAMGG--NPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           + T +G+ +    I  G  +  G       I    I++V G      +++  L+ +K   
Sbjct: 6   IFTPVGIVVGFGFIAFGIISNSGIGGFTSFIDVPSILVVFGGLTAAMLVSFSLRELKSLF 65

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
             + E F  +         ++     L    ++      E  ++                
Sbjct: 66  TIMREGFRTEEF---DIRGLISTFVTLSERARREGLLALEAELEKVD------------- 109

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
                 FI   + + + G      I ++M+ E+  +          +   GE  PA G++
Sbjct: 110 ----DPFIKKGVLLAVDG-IEPDVIVDIMNAELTALEDRHRGGRDLLDKAGEYAPAWGMI 164

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
           G ++G++  + NL+  P  LG  + ++L  T  G +LS  +  PL+ ++     K+    
Sbjct: 165 GTLIGLVLMLKNLND-PTTLGPNMAIALLTTFYGSLLSNLVFIPLSGKLAVRTKKEIFYK 223

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNK 287
            I+ + +I   +G  P++  E     L  ++R       Q+ ++ +  +
Sbjct: 224 QIIIEGVIGVQSGQNPKLLEEKLSVFLSKTDR----EKEQQKVEADGQE 268


>gi|291280095|ref|YP_003496930.1| flagellar motor protein MotA [Deferribacter desulfuricans SSM1]
 gi|290754797|dbj|BAI81174.1| flagellar motor protein MotA [Deferribacter desulfuricans SSM1]
          Length = 254

 Score =  190 bits (482), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 48/275 (17%), Positives = 111/275 (40%), Gaps = 23/275 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++T++G+ I    +      MG    + I    ++IV G   G   M  P+  + +    
Sbjct: 3   IATLLGIVIAYALVFVS-LLMGPGVGVYIDIPSVLIVIGGTFGIIFMNYPMNKVFNIIAI 61

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +++ F +K+   +    +++ L       ++      E+                  E  
Sbjct: 62  VMKTFLFKS---EDPSKLIEQLVNFAVRARRDGILALESA-----------------EGE 101

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   +R+ + G      I+++++ E+  +     +    +  +    PA+G++G 
Sbjct: 102 ISDEFLKKGIRLAVDG-TEPEVIKSILETELSYMEERHKEGVGILESIASFAPAMGMIGT 160

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G++  +  +S  P  +G A+ V+L  T  G I++     PL  ++K+   ++  L  I
Sbjct: 161 LIGLVAMLQTMSD-PSSIGPAMAVALLTTFYGAIIANLFAAPLAGKLKTRSAEEILLREI 219

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEI 275
           +   ++A   G  P++  +     LP   R S   
Sbjct: 220 MIAGIMAIQAGDNPRIVEQKLNAYLPPKMRKSQFE 254


>gi|190574216|ref|YP_001972061.1| flagellar motor protein [Stenotrophomonas maltophilia K279a]
 gi|190012138|emb|CAQ45761.1| putative flagellar motor proton channel [Stenotrophomonas
           maltophilia K279a]
          Length = 246

 Score =  190 bits (482), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 50/264 (18%), Positives = 102/264 (38%), Gaps = 22/264 (8%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
            ++IGLF+ +  ++GG    G     L  P   VIV    +   ++     V K +   +
Sbjct: 4   LSLIGLFLALASLVGGSILKGAGLASLWSPAAFVIVIVGTVAAILLHTSPAVFKHAFKIV 63

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
             +            ++++ +       ++      E+ ++                   
Sbjct: 64  RWVVRPP---HSDRRELIQQIVEWSNIARRQGLLGLESQVEAQQ---------------- 104

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
              F+   +++++ G      + ++++ E+    ++          MG   P +GI+GA+
Sbjct: 105 -DPFLRKGLQLLVDG-VEPESMRHMLEIELGSQEHQDQAGAKVFEAMGIYAPTLGIIGAV 162

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           LG+I  M NL+  P  LG  I  + T T+ GI  +  L  P+ +++KS      R   +V
Sbjct: 163 LGLIAVMKNLAD-PSKLGHGIAAAFTATIYGIASANLLFLPIAAKLKSVISHNTRDREMV 221

Query: 242 KKALIAYMNGAIPQVAIEYGRKVL 265
            + LI+   G  P+         L
Sbjct: 222 IEGLISIAQGENPRNIETNLSGFL 245


>gi|313639079|gb|EFS04060.1| chemotaxis protein MotA [Listeria seeligeri FSL S4-171]
          Length = 283

 Score =  189 bits (481), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 55/270 (20%), Positives = 110/270 (40%), Gaps = 20/270 (7%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++TI+GL + ++ I G F     +  +L     ++++    +   +MA+P   +K     
Sbjct: 3   ITTIVGLVLAVIVIAGSFMIQNISLAMLFSAEALIVIILGTITAVMMAHPWSDVKVVPKL 62

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
              +F           DVL         +++      E+ +D+                 
Sbjct: 63  FKILFT--KERGPDKVDVLIQYKEYADEIRRSGVLALEDSVDEIE--------------- 105

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   MR+++ G A    + ++++EE+  +           +  G   P +G++GA
Sbjct: 106 --DPFMKRGMRLVVDGQASPEFLRDVLEEEVSSMEERHAAYAKIFASAGAYAPTLGVLGA 163

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
            +G+I AMG +S +P  L  AI  +   T+ GI   Y L  P  +++K    K+  L  +
Sbjct: 164 AMGLIHAMGEMS-NPDKLSEAIAAAFICTIFGIFTGYVLWTPFANKLKVKSQKEVHLRYM 222

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSER 270
           + + ++A      P+V  E     L   E+
Sbjct: 223 MIEGVVALQERNAPRVVEERLLSFLSPKEK 252


>gi|261403962|ref|YP_003240203.1| MotA/TolQ/ExbB proton channel [Paenibacillus sp. Y412MC10]
 gi|329930229|ref|ZP_08283842.1| chemotaxis protein MotA [Paenibacillus sp. HGF5]
 gi|261280425|gb|ACX62396.1| MotA/TolQ/ExbB proton channel [Paenibacillus sp. Y412MC10]
 gi|328935251|gb|EGG31732.1| chemotaxis protein MotA [Paenibacillus sp. HGF5]
          Length = 266

 Score =  189 bits (481), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 62/284 (21%), Positives = 118/284 (41%), Gaps = 21/284 (7%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           +STIIGL I I+ ++ G    G +   L  P   +I+ G       +  PL  +K     
Sbjct: 3   ISTIIGLIIGIVAVLVGMILKGASLLALYNPAAYLIILGGTAATLFIGFPLSELKKIPKL 62

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +   F           D++KL        ++      E  +D+  +S             
Sbjct: 63  VKMTFV--KQNLMDKTDMIKLFMEWASITRREGLLALETKVDEIDDS------------- 107

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+ + MRMII GN     + +++ E+I+             S  G   P++G++GA
Sbjct: 108 ----FLRNGMRMIIDGN-DQEFVRDVLMEDINATEERHRSGSLIFSQAGMYAPSLGVLGA 162

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G+I A+ ++ +    L  AIG +   TLLGI   Y +C+P+ +++K    ++  + ++
Sbjct: 163 VIGLIAALSHM-EDMGELAHAIGAAFIATLLGIFTGYVICHPIANKLKRLSKREVEIRLM 221

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYN 284
           + + L++  +G       +     L  SER  +        +  
Sbjct: 222 MVEGLLSIQSGVSTIAINQKLSVFLTPSERAELSEREAGASEQK 265


>gi|315301918|ref|ZP_07872929.1| chemotaxis protein MotA [Listeria ivanovii FSL F6-596]
 gi|313629714|gb|EFR97836.1| chemotaxis protein MotA [Listeria ivanovii FSL F6-596]
          Length = 283

 Score =  189 bits (481), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 54/270 (20%), Positives = 110/270 (40%), Gaps = 20/270 (7%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++TI+GL + ++ I G F     +  +L     ++++    +   +MA+P   +K     
Sbjct: 3   ITTIVGLVLAVIVIAGSFMIQNISLAMLFSAEALIVIILGTITAVMMAHPWSDVKVVPKL 62

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
              +F           DVL         +++      E+ +D+                 
Sbjct: 63  FKILFT--KERGPDKVDVLIQYKEYADEIRRSGVLALEDSVDEME--------------- 105

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   MR+++ G +    + ++++EE+  +           +  G   P +G++GA
Sbjct: 106 --DPFMKRGMRLVVDGQSSPEFLRDVLEEEVSSMEERHAAYAKIFASAGAYAPTLGVLGA 163

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
            +G+I AMG +S +P  L  AI  +   T+ GI   Y L  P  +++K    K+  L  +
Sbjct: 164 AMGLIHAMGEMS-NPDKLSEAIAAAFICTIFGIFTGYVLWTPFANKLKVKSQKEVHLRYM 222

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSER 270
           + + ++A      P+V  E     L   E+
Sbjct: 223 MIEGVVALQERNAPRVVEERLLSFLSPKEK 252


>gi|28211322|ref|NP_782266.1| chemotaxis motA protein [Clostridium tetani E88]
 gi|28203762|gb|AAO36203.1| chemotaxis motA protein [Clostridium tetani E88]
          Length = 276

 Score =  189 bits (481), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 49/279 (17%), Positives = 108/279 (38%), Gaps = 28/279 (10%)

Query: 2   STIIGLFITILCIIGGFYAMG------GNPYILIQPFEIVIVAGAGLGGFVMANPLKVIK 55
            T IG+ +  L ++     +       G   +      I+I  G  L   ++  PL   K
Sbjct: 7   LTAIGIVVGFLMMVWAMAMVTITEYNVGQLKLFWDISSIIITVGGSLCAMLVNYPLHQFK 66

Query: 56  DSGVSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPT 115
                 ++ F      + +  D++     L    ++      E+ I              
Sbjct: 67  KLMKITIQAF---KENEKSGIDIINQFIDLSRKARREGLLSLEDEISGIN---------- 113

Query: 116 VLENNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAI 175
                    F+   ++M++ G      I+++MD EI  +     +    +   G   PA 
Sbjct: 114 -------DDFLKKGLQMVVDG-IEPETIQDIMDLEIGEMERRHGEGVDMLKAWGAYAPAF 165

Query: 176 GIVGAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQH 235
           G+ G ++G+I+ +GNL++S   + + +  +L  TL G +++  + NP+ + +     ++ 
Sbjct: 166 GMAGTLIGLIQMLGNLNES-GQIASGMSKALITTLYGSLMANIVFNPMAANLSLKSQQEI 224

Query: 236 RLYIIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIE 274
            +  ++ + ++A  +G  P++  E     L   ER    
Sbjct: 225 AVREMMLEGILAIQSGVNPRIVEEKLISYLSPEERQKYA 263


>gi|302389669|ref|YP_003825490.1| MotA/TolQ/ExbB proton channel [Thermosediminibacter oceani DSM
           16646]
 gi|302200297|gb|ADL07867.1| MotA/TolQ/ExbB proton channel [Thermosediminibacter oceani DSM
           16646]
          Length = 268

 Score =  189 bits (481), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 42/257 (16%), Positives = 102/257 (39%), Gaps = 22/257 (8%)

Query: 19  YAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDTYCDV 78
             MGG     I    ++IV G  +   ++  PL  + +    L  +F  K +  +    +
Sbjct: 20  IYMGGPLSAFINIPSMLIVLGGVVASTLINYPLSKLIEVVKILKVVFIEKPMSSEE---I 76

Query: 79  LKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMIIVGNA 138
           ++ +  L    ++      E+                         F+   + +++ G  
Sbjct: 77  IRTIVNLADIARREGLLALEDTASQVQ-----------------DDFMKRGIMLVVDG-T 118

Query: 139 RSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQSPKIL 198
               ++N+++ E+  +     +       MG   PA G++G I+G+I+ +  +   P  +
Sbjct: 119 DPELVKNILETELAFLEERHKEGQSIFETMGALAPAYGLIGTIIGLIQMLNKIDD-PSAV 177

Query: 199 GTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIPQVAI 258
           G  + V+L  T  G +L+  L  P+  ++K    ++  +  ++ + +++   G  P++  
Sbjct: 178 GPGMAVALITTFYGAVLANFLFLPIAGKLKVRSKQEILMKEVIIEGILSIQAGENPRIIE 237

Query: 259 EYGRKVLPLSERPSIEI 275
           E  +  L    R +++ 
Sbjct: 238 EKLKAFLAPKVRETLKE 254


>gi|197122875|ref|YP_002134826.1| MotA/TolQ/ExbB proton channel [Anaeromyxobacter sp. K]
 gi|196172724|gb|ACG73697.1| MotA/TolQ/ExbB proton channel [Anaeromyxobacter sp. K]
          Length = 261

 Score =  189 bits (481), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 58/271 (21%), Positives = 107/271 (39%), Gaps = 24/271 (8%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
           +TI G+F  +  I+ G    GG+   L+Q    +IV G  LG  ++A P + +  +   L
Sbjct: 4   TTIAGIFAAVGLILLGQALEGGHVGSLLQATAALIVFGGTLGAVLVAFPRRDVGRALSQL 63

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
             +F  + +       + + L       ++      E  +                    
Sbjct: 64  KLVFAERKV---DLGALSRELVEYAGVARRDGVLALEAKLPGI----------------- 103

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
              F+   +++++ G   +    + ++  +D    E           G   P IGI+GA+
Sbjct: 104 PDPFLRRALQLVVDG-VDASVSRSTLEAAVDAEYEEHAVGAKVWEAAGGFAPTIGILGAV 162

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           LG+I  M NLS  P  LG  I V+   T+ G+  +  L  P  +++K     +     ++
Sbjct: 163 LGLIHVMENLSD-PSKLGGGIAVAFVATVYGVGSANVLFLPFATKMKRKLGAERDRKTLI 221

Query: 242 KKALIAYMNGAIPQVAIEYGRKVL--PLSER 270
            + ++A   G  P+V  E  R     P +ER
Sbjct: 222 TEGVLAIQEGINPRVLEEKLRAYSGEPPAER 252


>gi|257141386|ref|ZP_05589648.1| flagellar motor protein MotA [Burkholderia thailandensis E264]
          Length = 270

 Score =  189 bits (481), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 80/269 (29%), Positives = 142/269 (52%)

Query: 14  IIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQD 73
           + GGF   GG    + QP EI+I++GA  G  VM NP  V+ + G  +  +   K+ G +
Sbjct: 1   MFGGFVLHGGALSSIWQPTEILIISGAAAGALVMGNPRSVLSEMGSQIKHVIARKSNGVE 60

Query: 74  TYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMI 133
              ++L +LY L+  ++ G     + H+++P  S +F   P +L    L  FI D  R++
Sbjct: 61  FQRELLLMLYELLETVRDGGLKALDQHVEEPKESDLFRKYPMILAQPRLIAFIVDNFRLM 120

Query: 134 IVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQ 193
            +G    +E+E ++D+E++ I  E ++P  ++S + ES+P  GI+ A+LGI+  M N+  
Sbjct: 121 AMGRITQHELEGMLDQELEAIESELMQPSRSLSKIAESMPGFGILAAVLGIVTTMANIGG 180

Query: 194 SPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAI 253
           S   +G  +  ++ GT +GI+L Y +  PL S +             VK  L A + G  
Sbjct: 181 SVSEIGLQVAAAMVGTFIGILLCYGVLEPLASAMVHRVKSDMSALECVKVVLCAQVAGKP 240

Query: 254 PQVAIEYGRKVLPLSERPSIEIVAQEVLQ 282
             +A++ GRK++ L  +PS   +   +++
Sbjct: 241 TLLAVDAGRKLIQLDVKPSFSKLESWIME 269


>gi|238916757|ref|YP_002930274.1| chemotaxis protein MotA [Eubacterium eligens ATCC 27750]
 gi|238872117|gb|ACR71827.1| chemotaxis protein MotA [Eubacterium eligens ATCC 27750]
          Length = 267

 Score =  189 bits (481), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 50/281 (17%), Positives = 105/281 (37%), Gaps = 28/281 (9%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYI------LIQPFEIVIVAGAGLGGFVMANPLKVI 54
           ++T++G+ I    ++ G      NP +       +    I +  G  L G + +   K  
Sbjct: 3   LATLLGIIIGFGMVVLGIITSTTNPTLKGIMDTFVDIPSIAVTIGGSLAGMLTSYTFKTF 62

Query: 55  KDSGVSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIP 114
                          L       V+  +  L    +K      E                
Sbjct: 63  IGHLKGFSIAMKDPKL---DNGQVISKIIELSNTARKEGLLALEE--------------- 104

Query: 115 TVLENNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPA 174
             +       F+   + +I+ G      +  +++ E+  +            +     PA
Sbjct: 105 --VAQGLDDEFMKKGILLIVDG-TEPELVRGILETELVNLDTRHKSTIGFFDNWAALAPA 161

Query: 175 IGIVGAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQ 234
            G++G +LG++  + NLS S   +G  + V+L  TL G +++  LC P+++++K     +
Sbjct: 162 WGMIGTLLGLVNMLKNLSDSAS-IGPNMAVALLTTLYGSLIANWLCVPISNKLKLQNNDE 220

Query: 235 HRLYIIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEI 275
           ++L  I+ + L++   G  P+V  E  +  L  S R ++  
Sbjct: 221 YQLREIIIEGLLSIQAGENPRVIEEKLKSFLSPSARTALSE 261


>gi|167725892|ref|ZP_02409128.1| flagellar motor protein MotA [Burkholderia pseudomallei DM98]
 gi|167905051|ref|ZP_02492256.1| flagellar motor protein MotA [Burkholderia pseudomallei NCTC 13177]
          Length = 270

 Score =  189 bits (481), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 80/269 (29%), Positives = 142/269 (52%)

Query: 14  IIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQD 73
           + GGF   GG    + QP EI+I++GA  G  VM NP  V+ + G  +  +   K+ G +
Sbjct: 1   MFGGFVLHGGALSSIWQPTEILIISGAAAGALVMGNPRSVLSEMGSQIKHVIARKSNGVE 60

Query: 74  TYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMI 133
              ++L +LY L+  ++ G     + H+++P  S +F   P +L    L  FI D  R++
Sbjct: 61  FQRELLLMLYELLETVRDGGLKALDQHVEEPRESDLFRKYPMILAQPRLIAFIVDNFRLM 120

Query: 134 IVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQ 193
            +G    +E+E ++D+E++ I  E ++P  ++S + ES+P  GI+ A+LGI+  M N+  
Sbjct: 121 AMGRITQHELEGMLDQELEAIESELMQPSRSLSKIAESMPGFGILAAVLGIVTTMANIGG 180

Query: 194 SPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAI 253
           S   +G  +  ++ GT +GI+L Y +  PL S +             VK  L A + G  
Sbjct: 181 SVSEIGLQVAAAMVGTFIGILLCYGVLEPLASAMVHRVKSDMSALECVKVVLCAQVAGKP 240

Query: 254 PQVAIEYGRKVLPLSERPSIEIVAQEVLQ 282
             +A++ GRK++ L  +PS   +   +++
Sbjct: 241 TLLAVDAGRKLIQLDVKPSFSKLESWIME 269


>gi|56475793|ref|YP_157382.1| flagellar motor protein [Aromatoleum aromaticum EbN1]
 gi|56311836|emb|CAI06481.1| chemotaxis motA protein [Aromatoleum aromaticum EbN1]
          Length = 246

 Score =  189 bits (480), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 53/265 (20%), Positives = 107/265 (40%), Gaps = 22/265 (8%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
           +++IG+ + I  I+ G    GG+   L+QP   +IV G  LG  ++ +PL V +D     
Sbjct: 4   TSLIGITLGIAAILSGQVLEGGHISSLVQPTAFLIVVGGTLGAVMLQSPLPVFRDGMRMA 63

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
             +F   +        ++       +  +K      E  I+                   
Sbjct: 64  KWVFVPPSSNHTD---LIAQTTDWSHIARKEGLLALEERIETL----------------- 103

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
              F+   ++++I G      + ++++ EID    +           G   P IGI+GA+
Sbjct: 104 PDPFVRKGLQLLIDG-VEPQHLRDVLEVEIDAWSAQMRLGAKIWEAAGGYAPTIGILGAV 162

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           +G+I  M NLS  P  LG+ I V+   T+ G+  +  +  P++ ++ +          ++
Sbjct: 163 MGLIHVMENLSD-PSRLGSGIAVAFAATIYGVAFANLIFLPISKKLLAHVASGVSQREML 221

Query: 242 KKALIAYMNGAIPQVAIEYGRKVLP 266
              L+   +G  P++     +  + 
Sbjct: 222 VDGLVGIASGDNPRIIESRMQGYVS 246


>gi|86157811|ref|YP_464596.1| MotA/TolQ/ExbB proton channel [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85774322|gb|ABC81159.1| MotA/TolQ/ExbB proton channel [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 261

 Score =  189 bits (479), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 58/291 (19%), Positives = 112/291 (38%), Gaps = 35/291 (12%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
           +TI G+   +  I+ G    GG+   L+Q    +IV G   G  ++A P + +  +   L
Sbjct: 4   TTIAGIAAAVGLILLGQALEGGHVGSLLQATAALIVFGGTFGAVLVAFPRRDVGKALSQL 63

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
             +F  + +       + + L       ++      E  +                    
Sbjct: 64  KLVFTERKV---DLGALSRELVDYAGVARRDGVLALEARLPGI----------------- 103

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
              F+   +++++ G   +    + ++  +D    E++         G   P +GI+GA+
Sbjct: 104 PDPFLRRALQLVVDG-VDASVTRSTLEAAVDADFEERVVGAKVWEAAGGFAPTVGILGAV 162

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           LG+I  M NLS  P  LG  I V+   T+ G+  +  L  P  +++K     +     +V
Sbjct: 163 LGLIHVMENLSD-PSKLGGGIAVAFVATVYGVGSANVLFLPFANKMKRKLGAERDRKTLV 221

Query: 242 KKALIAYMNGAIPQVAIEYGRKVL--PLSERPSIEIVAQEVLQYNHNKKAS 290
            + ++A   G  P+V  E  R     P +ER           +    +KA+
Sbjct: 222 TEGVLAIQEGINPRVLEEKLRAYSGEPPAER-----------EAEPRRKAA 261


>gi|167576626|ref|ZP_02369500.1| flagellar motor protein MotA [Burkholderia thailandensis TXDOH]
          Length = 270

 Score =  189 bits (479), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 80/269 (29%), Positives = 142/269 (52%)

Query: 14  IIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQD 73
           + GGF   GG    + QP EI+I++GA  G  VM NP  V+ + G  +  +   K+ G +
Sbjct: 1   MFGGFVMHGGALSSIWQPTEILIISGAAAGALVMGNPRSVLSEMGSQIKHVIARKSNGVE 60

Query: 74  TYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMI 133
              ++L +LY L+  ++ G     + H+++P  S +F   P +L    L  FI D  R++
Sbjct: 61  FQRELLLMLYELLETVRDGGLKALDQHVEEPKESDLFRKYPMILAQPRLIAFIVDNFRLM 120

Query: 134 IVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQ 193
            +G    +E+E ++D+E++ I  E ++P  ++S + ES+P  GI+ A+LGI+  M N+  
Sbjct: 121 AMGRITQHELEGMLDQELEAIESELMQPSRSLSKIAESMPGFGILAAVLGIVTTMANIGG 180

Query: 194 SPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAI 253
           S   +G  +  ++ GT +GI+L Y +  PL S +             VK  L A + G  
Sbjct: 181 SVSEIGLQVAAAMVGTFIGILLCYGVLEPLASAMVHRVKSDMSALECVKVVLCAQVAGKP 240

Query: 254 PQVAIEYGRKVLPLSERPSIEIVAQEVLQ 282
             +A++ GRK++ L  +PS   +   +++
Sbjct: 241 TLLAVDAGRKLIQLDVKPSFSKLESWIME 269


>gi|225181602|ref|ZP_03735043.1| MotA/TolQ/ExbB proton channel [Dethiobacter alkaliphilus AHT 1]
 gi|225167710|gb|EEG76520.1| MotA/TolQ/ExbB proton channel [Dethiobacter alkaliphilus AHT 1]
          Length = 275

 Score =  189 bits (479), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 52/288 (18%), Positives = 105/288 (36%), Gaps = 29/288 (10%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
            TI+G+ + +  ++G     GG+  +      I+I  G      ++   L  I       
Sbjct: 8   LTILGIGLGLSLVMGAIAL-GGSVAMFWSLNSIMITVGGSFAALLVNFQLPQITMVYGVT 66

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
              F  +        +++ +   L    ++      E+ ++D                  
Sbjct: 67  KNAFQQEV---QDIGELISVFVDLGQKARREGLLALEDDLNDLE---------------- 107

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
              F+ + ++M+I G      I ++MD EI   +             G   PA G++G +
Sbjct: 108 -DPFLGNGLQMVIDG-LEPELIRDIMDTEITATVARHRMGQDLFKTWGALAPAFGMIGTL 165

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           +G+I+ + NL   P  +G  + V+L  T  G +L+  L NPL  ++      +      V
Sbjct: 166 IGLIQMLANLDD-PSAIGPGMAVALLTTFYGALLANLLFNPLAGKLAIRSDAEIAQKEAV 224

Query: 242 KKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKA 289
            + ++A   G  P++  E  +     ++R       +   Q      A
Sbjct: 225 VEGVLAIQAGTNPRILQEKMKAFASPAQR------EEMARQSETPDTA 266


>gi|251772420|gb|EES52987.1| putative flagellar motor component (MotA) [Leptospirillum
           ferrodiazotrophum]
          Length = 264

 Score =  188 bits (478), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 62/275 (22%), Positives = 112/275 (40%), Gaps = 19/275 (6%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++TI+GL I I  I+ G    G     ++QP   +IV G   G  ++  PL  I ++   
Sbjct: 3   ITTILGLVIGIGAILLGATLEGLPLTTILQPTAAMIVFGGTFGATLLQFPLNFIINALKM 62

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  +   K++       +++ +  L    +K    + E H++DP                
Sbjct: 63  IPRVLISKSVDPG---PIIQKIQDLSKTSRKEGLLKLEAHLEDPEIK------------- 106

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               +    +RM++ G     ++   ++ E   I  E+   Y     MG   P IGI+GA
Sbjct: 107 -ADPYFARGVRMVMDG-TEITKVREALEVEAHYIEEEEGVVYKVFESMGGYAPTIGILGA 164

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG+I  M N+   P  L   I  +   T+ G+  +  +  P+  ++K     + +L  I
Sbjct: 165 VLGLIHVMSNMGD-PGKLAEGIATAFVATVYGVGSANLVYLPIGGKLKLKGRGEAKLREI 223

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEI 275
           +   L+    G  P +  E     L  +ER   E 
Sbjct: 224 IVDGLVGIGQGENPGMIEERLLGFLNEAERVKYEQ 258


>gi|295706901|ref|YP_003599976.1| putative flagellar motor channel protein [Bacillus megaterium DSM
           319]
 gi|294804560|gb|ADF41626.1| putative flagellar motor channel protein [Bacillus megaterium DSM
           319]
          Length = 267

 Score =  188 bits (478), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 54/285 (18%), Positives = 113/285 (39%), Gaps = 25/285 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGG--NPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSG 58
           M T IG+ I I  ++ G  + GG       I    I+IV G   G   ++ PLK +K+ G
Sbjct: 6   MLTPIGILIGISMVVFGVISSGGMSGFLAFIDVPSILIVLGGVFGTLCVSFPLKQLKNMG 65

Query: 59  VSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLE 118
               + F  K +  +    ++     L    ++      E  ++   +S           
Sbjct: 66  RVGKQAFQSKEINVEE---IVGTFVHLSEKARREGLLSLEAELEQIDDS----------- 111

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIV 178
                 F+   + + I G      I  L++ EI  +     +        G+  PA G++
Sbjct: 112 ------FVKKGILLAIDG-VEPEMIRELLEAEIATVEERHARGRSMFEKAGDYAPAWGMI 164

Query: 179 GAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLY 238
           G ++G++  + +L+ +P  LG  + ++L  T  G +LS     P+ +++      +  + 
Sbjct: 165 GTLVGLVLMLKSLN-TPSSLGPDMAIALLTTFYGALLSNLFFQPIAAKLAGKTEHELFVK 223

Query: 239 IIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQY 283
            ++ + +I  + G   +      +   P+ +R  +E   + V + 
Sbjct: 224 EVIIEGVIGLLAGQNSRFVQAKLKVFAPVEKR-KLEEKREHVREA 267


>gi|303240001|ref|ZP_07326523.1| MotA/TolQ/ExbB proton channel [Acetivibrio cellulolyticus CD2]
 gi|302592480|gb|EFL62206.1| MotA/TolQ/ExbB proton channel [Acetivibrio cellulolyticus CD2]
          Length = 268

 Score =  188 bits (478), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 53/274 (19%), Positives = 114/274 (41%), Gaps = 23/274 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++TIIG+   + CII      GG+         +V+V G G+   +++  L  +K     
Sbjct: 3   IATIIGVIFGLFCIIWSILL-GGSILTFWDLPSVVVVVGGGIAASLISYKLAEVKLIMKV 61

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           ++++F  K          +K +  L    ++      E   ++                 
Sbjct: 62  VVKVFIGKESSPID---TIKQMIELSQKARRDGLLSLEAEQENIK--------------- 103

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+ + +++++ G      I   MD EI+ +     K       M    PA G++G 
Sbjct: 104 --DEFLKESLQLVVDG-VEPEIIVESMDLEIENMKARHDKGTGLFKTMAAQFPAWGMIGT 160

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G+I+ + +L   P  +G A+ V+L  T  G +L+  +CNP+ +++     ++ R   +
Sbjct: 161 LIGLIQLLKSLDD-PSKIGPAMAVALITTFYGSVLANFICNPIANKLSLKSKEEIREKRM 219

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIE 274
           V + +++   G  P++     +  L   ++   E
Sbjct: 220 VIEGVLSIQAGENPKILEHKLKTFLSPKQKHEYE 253


>gi|165939049|ref|ZP_02227601.1| chemotaxis protein MotA [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|165913005|gb|EDR31630.1| chemotaxis protein MotA [Yersinia pestis biovar Orientalis str.
           IP275]
          Length = 288

 Score =  188 bits (478), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 81/282 (28%), Positives = 156/282 (55%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  + GL + + C+IGG+   GG+     QP EI+I+ G+G+G  ++ NP  V+++    
Sbjct: 1   MQKLFGLLVIMGCVIGGYLMSGGSLSSFWQPGEIIIIFGSGIGALILGNPGSVLQEMWHQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +L +        +    +L LLY L+  + +G     + HI+ P NS++F   P +L++ 
Sbjct: 61  ILAVARRSEYTVEFQQQLLLLLYELLEMVDEGGLKRLDEHIEIPANSSVFQRYPLILQDL 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L TFI D  R++ +G    +E+E+++++E+  +  E L P  +   +GE++P  GI  A
Sbjct: 121 HLITFISDNFRLMAMGKINQHELESILEQELSAVEEELLVPSRSFQRIGEAMPGFGICAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGII  M ++  S  ++G  +  +L GT LG+ + Y L +PL++ ++    K+  L+  
Sbjct: 181 VLGIIITMQSIDGSIAMIGIKVAAALVGTFLGVFICYCLMDPLSNAMEQEIKKKLALFEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQ 282
           V+  L+ ++ G    +A++ G K+LP+  +P+   +   + +
Sbjct: 241 VRMVLVNHVAGKPSLLAVDAGHKMLPMDNKPTFATLDSWINK 282


>gi|256833231|ref|YP_003161958.1| MotA/TolQ/ExbB proton channel [Jonesia denitrificans DSM 20603]
 gi|256686762|gb|ACV09655.1| MotA/TolQ/ExbB proton channel [Jonesia denitrificans DSM 20603]
          Length = 261

 Score =  188 bits (478), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 62/280 (22%), Positives = 109/280 (38%), Gaps = 22/280 (7%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
           +++IGL I    II      G +P  +  P  +V+V  A  G  +    L+    +   L
Sbjct: 4   ASLIGLAIGFGAIIMAILLEGASPMSVFLPAPMVLVFLATFGVAMAGGTLRDTIYALKQL 63

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
              F  K        D +     L    ++      E+   D  N               
Sbjct: 64  PAAFTRKPSNAAASVDTI---VSLAEQARREGLLALEDAAKDIEN--------------- 105

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
              F+ D +R  I G     ++ ++++++I     E    Y     MG   P IGIVG +
Sbjct: 106 --DFLRDGLRSAIDG-TDPEDLRDILEDKIAAKRAEDKVGYKFYDDMGGYAPTIGIVGTV 162

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           + ++  + NL+  P  LG  I  +   T  GI  +  +  P+ S++K     +     I+
Sbjct: 163 VSLVHVLENLAD-PSELGHMIAAAFLATFWGIFTANVMWLPIGSRLKRISNLECDEMEII 221

Query: 242 KKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVL 281
            + L+A   G+ P++  E  R ++P +  P    VA+E  
Sbjct: 222 LEGLLAVQAGSNPRLVGERLRSLIPSTSAPPAPKVAKEAA 261


>gi|218778867|ref|YP_002430185.1| MotA/TolQ/ExbB proton channel [Desulfatibacillum alkenivorans
           AK-01]
 gi|218760251|gb|ACL02717.1| Chemotaxis protein MotA [Desulfatibacillum alkenivorans AK-01]
          Length = 253

 Score =  188 bits (478), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 49/275 (17%), Positives = 110/275 (40%), Gaps = 24/275 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++TI+G+  + + ++      G      I    ++IV G  +G  ++  PLK I      
Sbjct: 3   IATILGVVGSFVLVVLAIGPSG--LGAFINVPSLIIVVGGTMGATMINYPLKEILGIVGV 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
            ++    K          +          ++      E  I +                 
Sbjct: 61  AMKTVFAKEASAKD---TIAKFMDFAQKARREGILSLEGDIKELE--------------- 102

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   +++ I G      I  +M+ EI+  +          + +G   PA+G+VG 
Sbjct: 103 --DEFMKKGIQLAIDG-LEPNAIREIMETEINYTMNRHKLGADLFTTIGTFAPALGMVGT 159

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G+++ + ++ + P  +G A+ V+L  T  G IL+  +C P+  ++K    ++  +  +
Sbjct: 160 LIGLVQMLQSM-EDPSSIGPAMAVALLTTFYGAILANIICMPVAGKLKMRSSQEMEVREL 218

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEI 275
           V + +++  +G  P++  +     LP  +R   E 
Sbjct: 219 VVEGVLSLSSGENPRIVEQKLACFLPPKQRELAED 253


>gi|313610150|gb|EFR85460.1| chemotaxis protein MotA [Listeria monocytogenes FSL F2-208]
          Length = 283

 Score =  188 bits (478), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 52/270 (19%), Positives = 110/270 (40%), Gaps = 20/270 (7%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++TIIGL + ++ I G F     +  +L     ++++    +   +MA+P   +K     
Sbjct: 3   ITTIIGLVLAVIVIAGSFMIQNISLAMLFSAEALIVIILGTITAVMMAHPWSDVKVVPKL 62

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
              +F  + +      +           +++      E+ +D+                 
Sbjct: 63  FKILFTKEKMP--DKVEXXXXYKEYADEIRRSGVLALEDSVDEIE--------------- 105

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   MR+++ G +    + ++++EE+  +           +  G   P +G++GA
Sbjct: 106 --DPFMKRGMRLVVDGQSSPEFLRDVLEEEVASMEERHAAYAKIFASAGAYAPTLGVLGA 163

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
            +G+I AMG +S +P  L  AI  +   T+ GI   Y L  P  +++K    K+  L  +
Sbjct: 164 AMGLIHAMGEMS-NPDKLSEAIAAAFVCTIFGIFTGYVLWTPFANKLKVKSQKEVHLRYM 222

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSER 270
           + + ++A      P+V  E     L   E+
Sbjct: 223 MIEGVVALQERNAPRVVEERLLSFLSPKEK 252


>gi|118443368|ref|YP_877985.1| chemotaxis motA protein [Clostridium novyi NT]
 gi|118133824|gb|ABK60868.1| chemotaxis motA protein [Clostridium novyi NT]
          Length = 269

 Score =  188 bits (478), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 46/286 (16%), Positives = 105/286 (36%), Gaps = 23/286 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           + T++G+      II G    GG   + I    + I  G      ++  P   +K     
Sbjct: 6   ILTLVGMLAGFGVIIYGMLGGGGTFGMFIDMPSVAITIGGSFCALLVNYPADELKRVFKV 65

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L + F   ++       ++     L    ++      E+ I+                  
Sbjct: 66  LAQSFKETSMSGLD---IVSQFGDLSKKARREGLLSLEDDIE-----------------K 105

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               ++   ++M++ G      I  +++ EI  +          +       PA G++G 
Sbjct: 106 VKDDYLRKGLQMVVDG-IEPETIREILELEIGEMEKRHKDGADVLKAWAGYAPAFGMLGT 164

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G+I+ + NL   P  LG  +  +L  T  G +++  + NP+ + +     K+  +  +
Sbjct: 165 LIGLIQMLANLDD-PGNLGPGMSKALITTFYGSLIASLILNPMAANLMYKSSKECTIREM 223

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHN 286
           + + ++A  +G  P++  E     L   ++   +   Q   +   N
Sbjct: 224 MLEGVLAIQSGVNPRIVEEKLVSYLNPVDKKIYQE-TQAASEVETN 268


>gi|71906383|ref|YP_283970.1| flagellar motor protein [Dechloromonas aromatica RCB]
 gi|71846004|gb|AAZ45500.1| MotA/TolQ/ExbB proton channel [Dechloromonas aromatica RCB]
          Length = 246

 Score =  188 bits (477), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 57/263 (21%), Positives = 110/263 (41%), Gaps = 22/263 (8%)

Query: 3   TIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLL 62
           ++ G+ I +  IIGG    GG+   L+QP  ++IV G  LG  ++ +P+ + +       
Sbjct: 5   SLAGIAIGLFAIIGGQILEGGHVGSLVQPTALLIVLGGTLGAVLLQSPIHIFRRGMKMAK 64

Query: 63  EIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNEL 122
            ++    + Q     +++ +       ++      EN+I                     
Sbjct: 65  WVWVPPVIEQK---RLIEQILNWSQLSRREGLLALENYIPAIK----------------- 104

Query: 123 TTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAIL 182
             F    +++++ G A    I  L++ EI+    E  +        G   P IGI+GA++
Sbjct: 105 DEFARRGLQLLVDG-ADPERIRELLEVEINTFEDEWRQSAKIWEAAGGYSPTIGILGAVM 163

Query: 183 GIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVK 242
           G+I  M NLS  P  LG  I V+   T+ G+ L+  +  P+ +++K   L+      ++ 
Sbjct: 164 GLIHVMENLSD-PTKLGAGIAVAFVATIYGVGLANLVYLPIAAKLKYYILRMVSTREMLV 222

Query: 243 KALIAYMNGAIPQVAIEYGRKVL 265
             L+    G  P++     +  L
Sbjct: 223 DGLVGIAVGDNPRIIEGRLKGYL 245


>gi|88704269|ref|ZP_01101983.1| chemotaxis motA protein [Congregibacter litoralis KT71]
 gi|88701320|gb|EAQ98425.1| chemotaxis motA protein [Congregibacter litoralis KT71]
          Length = 267

 Score =  188 bits (477), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 60/265 (22%), Positives = 106/265 (40%), Gaps = 22/265 (8%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
            T++G+ + +  I+GG +  GG+   L+Q    VIV G   G  ++  PL+  + +   L
Sbjct: 25  LTLLGVTLAVGAILGGNWLEGGHISALLQLTAFVIVIGGTFGAVLIQTPLRDFRGALGRL 84

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
             +    A  ++    VL          ++      E  +                   E
Sbjct: 85  RWVLLPPAFDREA---VLGKTIEWSRIARRDGLLALEERV-----------------GKE 124

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
                   +++++ G      I  +MD EID  L +  +       MG   P IGI+GA+
Sbjct: 125 PDNLTQKGLQLLVDG-LEPEAIRTVMDVEIDNALAKDARAAKVYEAMGGYSPTIGIIGAV 183

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           LG+I  M NLS  P  LG  I V+   T+ G+  +  L  P+ +++++    Q + + +V
Sbjct: 184 LGLIDVMNNLSD-PTQLGAGIAVAFVATIYGVGFANLLYLPIANKLRAVSGDQMQYHEMV 242

Query: 242 KKALIAYMNGAIPQVAIEYGRKVLP 266
              +    +G  PQ         L 
Sbjct: 243 VDGIAMIADGDNPQTIQNKLEGYLD 267


>gi|170760022|ref|YP_001787604.1| flagellar motor protein MotA [Clostridium botulinum A3 str. Loch
           Maree]
 gi|169407011|gb|ACA55422.1| putative chemotaxis protein MotA [Clostridium botulinum A3 str.
           Loch Maree]
          Length = 261

 Score =  188 bits (477), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 59/274 (21%), Positives = 111/274 (40%), Gaps = 21/274 (7%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           +  ++G+ I +  +I G    G N  +L+ P   +I+    +   + + P          
Sbjct: 3   IFLVLGVIIGLSSVIVGMIVKGANVAVLLNPAAAIIILVGTMAAVMNSFPKDEFLKIPKI 62

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F  K  G+     ++  +  L    +K      E  +D   N              
Sbjct: 63  LGVLFKEK--GKGEQASIVMEIVELSKTSRKDGLLALEKIVDSMSNK------------- 107

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   + M++ G      I  +++ EI  +           +  G + P +G++GA
Sbjct: 108 ----FMKKGLTMVVDG-TEPGYIREVLEIEIQTVEERHCLGASIFTTAGGAAPTLGVLGA 162

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G+I A+GNL+   + LG  I  +   TL GI   Y +C+P  S++K    ++     I
Sbjct: 163 VVGLIGALGNLND-VEKLGHMIAGAFVATLYGIFFGYVVCHPFASRLKRKSHEEINSMYI 221

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIE 274
           + + ++A   G  PQ   E    +L  +ER  IE
Sbjct: 222 IVEGVLAIQEGVNPQKIQEKLIGMLEPNERIKIE 255


>gi|95929858|ref|ZP_01312599.1| MotA/TolQ/ExbB proton channel [Desulfuromonas acetoxidans DSM 684]
 gi|95134154|gb|EAT15812.1| MotA/TolQ/ExbB proton channel [Desulfuromonas acetoxidans DSM 684]
          Length = 255

 Score =  188 bits (477), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 45/272 (16%), Positives = 105/272 (38%), Gaps = 23/272 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           +STIIG       +I      GG+  + + P  I+IVAG  LG  ++  P K +  +   
Sbjct: 3   ISTIIGAVAAFGLMIAAMM-NGGSILLFVDPASIMIVAGGTLGSTLIHYPFKEVFRAVSV 61

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
             +             +++  L       +K      ++ +                   
Sbjct: 62  AKKTLF---HKDQAPGEIISQLIEYAGKARKEGILSLQSVMSQVE--------------- 103

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F    ++M + G      + ++M+ E++ +           + M    PA+G++G 
Sbjct: 104 --DPFFLKGLQMAVDGQ-EPEALRDMMERELEYVQERHETGADIFTTMAAYAPAMGMIGT 160

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G+++ +  +   P  +G A+ V+L  T  G + +  +  P++ ++K     +     +
Sbjct: 161 LIGLVQMLQTMDD-PSSIGPAMAVALLTTFYGAVAANVIFTPMSGKLKHRSSSEMLCKTL 219

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPS 272
           + + + + + G  P+V  +     +  + R S
Sbjct: 220 ISEGMNSILAGENPRVMEQRLHAFVAPNLRES 251


>gi|315649792|ref|ZP_07902875.1| MotA/TolQ/ExbB proton channel [Paenibacillus vortex V453]
 gi|315274766|gb|EFU38147.1| MotA/TolQ/ExbB proton channel [Paenibacillus vortex V453]
          Length = 264

 Score =  188 bits (477), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 52/264 (19%), Positives = 113/264 (42%), Gaps = 22/264 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++ I G+   +  +IGGF   GG+   L+Q    +IV G  +   +++ P   ++    +
Sbjct: 3   ITIIFGILAGLAALIGGFLWEGGHLSGLLQGAAALIVFGGTIAAVIVSFPATRLRTIPAA 62

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L   FG      +    ++  +  +    ++      E                 +  ++
Sbjct: 63  LKLAFGRSERSSE---KLIDDIVDMSVTARRDGVLALE----------------RISADH 103

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           E   F+ + M+M++ GN     +  +++ +I+    +           G   P +GI+G 
Sbjct: 104 E-DPFLREGMQMVVDGN-DPEMVRQILELDINAAEQKHEGYAKIFESAGGYAPTMGIIGT 161

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G+I  +G+L Q P  LG +I V+ T TL G+  +  +  P+ S+IK+   ++     +
Sbjct: 162 VMGLIHVLGSL-QDPTNLGPSIAVAFTATLYGVASANIIFLPIASKIKARSEEEIANMEL 220

Query: 241 VKKALIAYMNGAIPQVAIEYGRKV 264
           + + ++A  NG  P +  +     
Sbjct: 221 LLEGIMAVQNGEHPLLVRKKLASF 244


>gi|224826336|ref|ZP_03699438.1| MotA/TolQ/ExbB proton channel [Lutiella nitroferrum 2002]
 gi|224601437|gb|EEG07618.1| MotA/TolQ/ExbB proton channel [Lutiella nitroferrum 2002]
          Length = 249

 Score =  188 bits (477), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 52/267 (19%), Positives = 106/267 (39%), Gaps = 22/267 (8%)

Query: 3   TIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLL 62
           +II +   +  II G    GG+   L Q    +IV G      ++ +  K          
Sbjct: 5   SIIAIIGGLAAIIVGQALEGGHIGSLFQLTAFMIVIGGTASAVMLQSTPKQFMTGLRMAR 64

Query: 63  EIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNEL 122
            +F       +     ++ +     + +KG     E ++                     
Sbjct: 65  WVFQPPQFDHE---KTIRDVIHWSQSARKGGLLSLEGYVAQQQ----------------- 104

Query: 123 TTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAIL 182
             F    ++M++ G      + ++M+ EI +  + + +        G   P +GI+GA+L
Sbjct: 105 DPFHRKALQMLVDG-TEPETLRSVMEVEISMFEHARRQSTRIWESAGGYAPTMGILGAVL 163

Query: 183 GIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVK 242
           G+I  M NLS  P  LG+ I V+   T+ G+  +  L  P+ +++K+    +  +  ++ 
Sbjct: 164 GLIHVMENLSD-PSKLGSGIAVAFVATIYGVGSANLLFLPIANKLKNLVAAEIAMRELIV 222

Query: 243 KALIAYMNGAIPQVAIEYGRKVLPLSE 269
           + L+A  +G  P++     R  L + +
Sbjct: 223 EGLVAIGHGENPRIIENRLRGFLAMHD 249


>gi|300855152|ref|YP_003780136.1| putative flagellar motor protein MotA [Clostridium ljungdahlii DSM
           13528]
 gi|300435267|gb|ADK15034.1| predicted flagellar motor protein MotA [Clostridium ljungdahlii DSM
           13528]
          Length = 263

 Score =  187 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 56/267 (20%), Positives = 111/267 (41%), Gaps = 21/267 (7%)

Query: 12  LCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALG 71
           L ++ G    G N  +L+ P   +I+        + + P +   +    L  +F  +   
Sbjct: 14  LAVVVGMIVKGANVAVLLNPAAAIIILVGTTAAVMNSFPKEEFLNIPKILKVLFKNRK-- 71

Query: 72  QDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMR 131
            D    ++  L  + +  +K      EN +    N                  F+   + 
Sbjct: 72  TDDPVAIINQLVDMSHQTRKNGLLSIENTLQSLDN-----------------EFMKKGLE 114

Query: 132 MIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNL 191
           M++ G      I  +++ EI+            ++  G S P +G++GA++G+I A+GNL
Sbjct: 115 MVVDG-VEPQYIIEVLELEIENREERHRAGASTMTTAGGSAPTLGVLGAVIGLIGALGNL 173

Query: 192 SQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNG 251
             + + LG  I  +   TL GI L Y +C+P  S++K    ++ R   I+   ++A  +G
Sbjct: 174 DDT-EKLGHMIAAAFVATLYGIFLGYVICHPFASRLKRKSQEEIRTMHIIMSGVLAIQSG 232

Query: 252 AIPQVAIEYGRKVLPLSERPSIEIVAQ 278
             P+   +    +LP   R ++E  ++
Sbjct: 233 NNPKSIEQKLVSMLPPKLRKNMEKGSE 259


>gi|254785496|ref|YP_003072925.1| flagellar motor protein [Teredinibacter turnerae T7901]
 gi|237683897|gb|ACR11161.1| transporter, MotA/TolQ/ExbB proton channel family [Teredinibacter
           turnerae T7901]
          Length = 246

 Score =  187 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 48/265 (18%), Positives = 111/265 (41%), Gaps = 22/265 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           + +++G+ I    ++GG +  GG+   L      +IV G  +G  ++  P+  +K +   
Sbjct: 3   LLSVLGVVIGFAALLGGNFIEGGSWGSLANGPAALIVIGGTIGAAMLQTPMAGLKRALSL 62

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
              IF    +    +   +  +     + ++      EN  +                  
Sbjct: 63  FKWIFKPPRV---QFKQGITRVVGWAKSARRDGLLGLENIAE-----------------R 102

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
           E   F    +++++ G +    I ++++ ++ +      +       MG   P IGI+GA
Sbjct: 103 ERDKFCRKGLQLLVDG-SEPEVIRHVLETDLIVAEQRDSEAVQFYESMGGYAPTIGIIGA 161

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G+I  M +LS +P  LG  I ++   T+ G+  +  L  P+ +++K+   +Q +   +
Sbjct: 162 VMGLIHVMQHLS-NPAELGPGIAIAFVATIYGVAFANLLLLPIANKLKACIRQQSQYREL 220

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVL 265
           + + +I+  +G  P+         L
Sbjct: 221 LIEGIISIADGENPRAIEMKLSGYL 245


>gi|331269324|ref|YP_004395816.1| chemotaxis MotA protein [Clostridium botulinum BKT015925]
 gi|329125874|gb|AEB75819.1| chemotaxis MotA protein [Clostridium botulinum BKT015925]
          Length = 269

 Score =  187 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 44/285 (15%), Positives = 106/285 (37%), Gaps = 23/285 (8%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           + T++G+      I+ G    GG   + +    + I  G      ++  P+  +K     
Sbjct: 6   ILTLVGMVAGFGVIVYGMLGGGGTFGMFVDVPSLGITVGGSFCSLLVNYPVNELKRIFKV 65

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L + F   ++       +++    L    ++      E  I+                  
Sbjct: 66  LAQSFKETSMSGLD---IVRQFGELSKKARREGLLSLEEDIERVE--------------- 107

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               ++   +RM++ G      I  +++ E+  +          +   G   PA G++G 
Sbjct: 108 --DAYLKKGLRMVVDG-IEPETIREILELEVGEMEKRHKDGADVLKAWGGYAPAFGMLGT 164

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G+I+ + NL   P  LG  +G +L  T  G +++  + NP+ + +     ++  +  +
Sbjct: 165 LIGLIQMLANLDD-PSNLGPGMGKALITTFYGSLMASLILNPMAANLMYKSSQEVTIREM 223

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285
           + + ++A  +G  P++  E     L   ++       Q   +   
Sbjct: 224 MLEGVLAIQSGVNPRIVEEKLVSYLNPVDKQIYSE-TQAASEVGA 267


>gi|192359153|ref|YP_001982601.1| flagellar motor protein [Cellvibrio japonicus Ueda107]
 gi|190685318|gb|ACE82996.1| transporter, MotA/TolQ/ExbB proton channel family [Cellvibrio
           japonicus Ueda107]
          Length = 248

 Score =  187 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 55/267 (20%), Positives = 103/267 (38%), Gaps = 22/267 (8%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
            +IIG+ I    IIGG    GG    L+      IV G  LG  ++  P   ++ +   L
Sbjct: 4   LSIIGVIIGFAAIIGGNLMEGGGLSTLVNGPAAFIVIGGTLGAAILQTPKNSLRRALKIL 63

Query: 62  LEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNE 121
             +F    +      + +          +K      E+                 +   E
Sbjct: 64  GWVFKPPYVPFKQGVNNISR---WAAAARKDGLLGLES-----------------VSERE 103

Query: 122 LTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAI 181
              F    +++++ GN     I  +++ ++ +     L        MG   P IGI+GA+
Sbjct: 104 KDKFAKKGLQLLVDGN-EPEVIRRVLETDMIVDEQRDLDAIKFYESMGGYAPTIGIIGAV 162

Query: 182 LGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIV 241
           +G+I  M NL+  P  LG  I V+   T+ G+ L+  L  P+ ++++    +  +   ++
Sbjct: 163 MGLIHVMNNLAD-PSTLGPGIAVAFVATIYGVALANLLLIPIANKLRMCVNENSQYRELI 221

Query: 242 KKALIAYMNGAIPQVAIEYGRKVLPLS 268
            + +IA  +G  P+         L   
Sbjct: 222 IEGIIAIADGENPRSIEMKLNGYLHPH 248


>gi|206895930|ref|YP_002246693.1| chemotaxis protein PomA [Coprothermobacter proteolyticus DSM 5265]
 gi|206738547|gb|ACI17625.1| chemotaxis protein PomA [Coprothermobacter proteolyticus DSM 5265]
          Length = 265

 Score =  187 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 47/288 (16%), Positives = 113/288 (39%), Gaps = 29/288 (10%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           +  + GL IT   I+    A   +    I    +++  G   G  ++A     +K+    
Sbjct: 3   IGVLGGLAITFGLIVLSVIA---DLNSFIDFNSMLVTIGGSFGSTLVAVGFDRMKNLPKY 59

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           ++  F  K   +      +KLL  L    ++      E+ +++                 
Sbjct: 60  VMAAFKKKTFDK---AGTIKLLVDLSNKARREGLLALEDSLEELE--------------- 101

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   ++++I G      ++N+++ +I+ +                  P+ G++G 
Sbjct: 102 --DPFVKRGLQLVIDG-VEPESVQNILNLDIEAMQNRHADGKMIFDVWAGFAPSFGMLGT 158

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           I+G+++ +  L   P  +G A+ ++L  T  G +L+Y +  P+++ ++     +     +
Sbjct: 159 IMGLVQMLKRLDD-PSTIGPAMALALITTFYGAVLAYGVFQPMSNTLQRKSDMESDFREM 217

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIE----IVAQEVLQYN 284
           + + ++   +G  P++  E     L  +ER   E       +EV +  
Sbjct: 218 IVEGILGIQSGENPRLLEERLVSFLSPAEREQYERTRAQKTEEVAEVA 265


>gi|227326902|ref|ZP_03830926.1| flagellar motor protein MotA [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
          Length = 217

 Score =  187 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 71/212 (33%), Positives = 127/212 (59%)

Query: 79  LKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMIIVGNA 138
           + LL+ +M   ++      E  ID+P  S IF+S P +L +N +  FI DY+R+++ GN 
Sbjct: 1   MALLFRVMAKSRQQGMLSLEFDIDNPRESEIFSSYPNILADNTVVEFITDYLRLMVSGNM 60

Query: 139 RSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQSPKIL 198
            ++EIE LMDEEI+ I +E   P  +++ MG+ LPA GIV A++G++ ++  + +    L
Sbjct: 61  NAFEIETLMDEEIETIEHESEVPASSLTMMGDGLPAFGIVAAVMGVVHSLAYVDRPAAEL 120

Query: 199 GTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIPQVAI 258
           G  I  ++ GT LGI+L+Y   +PL + ++    ++ ++   +K  L++ +NG  PQ+A+
Sbjct: 121 GMMIAHAMVGTFLGILLAYGFVSPLAALLRQKNAEKIKVLQCIKVTLLSSLNGYAPQIAV 180

Query: 259 EYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           E+GRK L  +ERPS   + + + +     + +
Sbjct: 181 EFGRKTLYSTERPSFTELEEHIRRVKSPTQQA 212


>gi|15893596|ref|NP_346945.1| chemotaxis motility protein A, gene motA [Clostridium
           acetobutylicum ATCC 824]
 gi|15023147|gb|AAK78285.1|AE007545_2 Chemotaxis motility protein A, gene motA [Clostridium
           acetobutylicum ATCC 824]
 gi|325507716|gb|ADZ19352.1| Chemotaxis motility protein A, gene motA [Clostridium
           acetobutylicum EA 2018]
          Length = 262

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 47/269 (17%), Positives = 103/269 (38%), Gaps = 20/269 (7%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M +I+ + + ++ +I GF   GG+   LI     +IV G  +G    + P+  IK  G  
Sbjct: 1   MDSIVFVLVALVSVIVGFIIDGGSVINLIHVSPAIIVFGGTIGAVGTSFPIGDIKKLGSI 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +          +     ++     + +  +K      E  I                 + 
Sbjct: 61  VKVALSKP---KSDLPALIAYFKQIAFKTRKEGLLSIEEMI----------------SDE 101

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            +  FI   ++M++ G      +++ ++  +++I              G   P +GI+G 
Sbjct: 102 SVDPFIKKGLQMVVDG-IEPQTVKDTLELSVELIEERHNMGASIFQAAGGYAPTLGIIGT 160

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +  ++  + NLS     LG +I  +   TL GI  +  +  P+ +++K     + +   +
Sbjct: 161 VCSLVVVLANLSSDTSQLGESISSAFLATLYGISSANLVYLPIANKLKRYNAIEIQEKNL 220

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSE 269
           + +A++    G  P    E  +  L   +
Sbjct: 221 IIEAILCIQEGINPNTLDEKLKGFLDKKQ 249


>gi|15643440|ref|NP_228484.1| motility protein A [Thermotoga maritima MSB8]
 gi|4981199|gb|AAD35759.1|AE001740_5 motility protein A [Thermotoga maritima MSB8]
          Length = 262

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 51/280 (18%), Positives = 118/280 (42%), Gaps = 22/280 (7%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++T++GL + I  +  G    GG+    I    + I     +   ++A+P      +   
Sbjct: 3   LATLMGLVLVIAALFIGILTGGGDFAAFINIPSLFITVVGSIAATMVAHPKD---KAFKI 59

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  +       +  +  +++ +       ++      E +++                  
Sbjct: 60  VNIMLSTLKEPKLDHVSLIQTMVSFSEKARREGLLSLEENLESIE--------------- 104

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   +++++ G      + N+M+ E+++   E       +   G   PA G++G 
Sbjct: 105 --DPFMKKALQLVVDG-TDPDLLRNMMETEMELFEEELDGERAVLESAGAYAPAFGMIGT 161

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G+I+ + +L+  P+ LG ++ V+L  TL G IL+  +  P+  +IK  R        +
Sbjct: 162 LIGLIQMLKSLND-PETLGPSMAVALITTLYGAILANGVFLPMAEKIKKRRDILVLEKRM 220

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEV 280
           + +A+++   G  P++  E  +  LP  ER + E  +QE 
Sbjct: 221 ILEAVLSIQAGENPRILEEKLKSFLPEKERQAYEAASQEA 260


>gi|187779119|ref|ZP_02995592.1| hypothetical protein CLOSPO_02714 [Clostridium sporogenes ATCC
           15579]
 gi|187772744|gb|EDU36546.1| hypothetical protein CLOSPO_02714 [Clostridium sporogenes ATCC
           15579]
          Length = 261

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 59/275 (21%), Positives = 111/275 (40%), Gaps = 21/275 (7%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           +  ++G+ I +  +I G    G N  +L+ P   +I+    +   + + P          
Sbjct: 3   IFLVLGVIIGLSAVIVGMIVKGANIAVLLNPAAAIIILVGTMAAVMNSFPKDEFLKIPKI 62

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L  +F  K  G+     ++  +  L    +K      E  +D   N              
Sbjct: 63  LGVLFKEK--GKGEQASIVNEIVELSKTSRKDGLLALEKIVDSMSNK------------- 107

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   + M++ G      I  +++ EI  +           +  G + P +G++GA
Sbjct: 108 ----FMKKGLTMVVDG-TEPGYIREVLEIEIQSVEERHRLGASIFTTAGGAAPTLGVLGA 162

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G+I A+GNL+   + LG  I  +   TL GI   Y +C+P  S++K    ++     I
Sbjct: 163 VVGLIGALGNLND-VEKLGHMIAGAFVATLYGIFFGYVVCHPFASRLKRKSHEEINSMYI 221

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEI 275
           + + ++A   G  PQ   E    +L  +ER  IE 
Sbjct: 222 IVEGVLAIQEGVNPQKIQEKLIGMLEPNERIKIEA 256


>gi|297583573|ref|YP_003699353.1| MotA/TolQ/ExbB proton channel [Bacillus selenitireducens MLS10]
 gi|297142030|gb|ADH98787.1| MotA/TolQ/ExbB proton channel [Bacillus selenitireducens MLS10]
          Length = 270

 Score =  187 bits (475), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 48/273 (17%), Positives = 111/273 (40%), Gaps = 25/273 (9%)

Query: 1   MSTIIGLFITILCIIGGFY---AMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDS 57
           + T +G+F+ +  ++   Y   A  G+    +Q   +++V G  +G   +   +  +K  
Sbjct: 6   LLTPVGIFLGLTAVLMAIYVNEAGDGSILDFVQVASLLVVFGGLIGALTVNFSIGDLKLL 65

Query: 58  GVSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVL 117
                E F  K    +   +++     L    ++      E  ++D              
Sbjct: 66  PRVFKETFQTKE---NDLEELIDTFVDLSTRARREGLLALEAGLEDVD------------ 110

Query: 118 ENNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGI 177
                  FI   + + + G      I+++M  E+  +     K    +   GE  PA G+
Sbjct: 111 -----DPFIQKGVLLAVDG-IEPDIIKDIMMAEVVAMEERHRKGRSIVEKAGEYAPAWGM 164

Query: 178 VGAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRL 237
           +G ++G++  + NL+  P  LG  + ++L  TL G +++  +  P+ ++++ +  ++   
Sbjct: 165 IGTLVGLVLMLQNLND-PSTLGPNMAIALLTTLYGTLMANLVFLPMANKLELSTEEEVFR 223

Query: 238 YIIVKKALIAYMNGAIPQVAIEYGRKVLPLSER 270
             +V + +I   +G  P++  E     LP   +
Sbjct: 224 KQVVVEGVIGVQSGQNPKILQEKLSAFLPNHVK 256


>gi|157364673|ref|YP_001471440.1| MotA/TolQ/ExbB proton channel [Thermotoga lettingae TMO]
 gi|157315277|gb|ABV34376.1| MotA/TolQ/ExbB proton channel [Thermotoga lettingae TMO]
          Length = 262

 Score =  187 bits (475), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 53/280 (18%), Positives = 115/280 (41%), Gaps = 22/280 (7%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           +STI+G+F+    I+ G  A   +  +      + I  G  +   + ++P +    S   
Sbjct: 3   ISTILGIFMAFGMIVFGIIANKSSLGVYYNLPSLFITIGGAIASTIASHPKE---KSFKI 59

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  +       +     +++ L       ++      E ++++                 
Sbjct: 60  IQVMMSTFKEPKIDNVGLVRTLVSFSEKARREGLLSLEENLNEIE--------------- 104

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   ++++I G      ++N+M+ E+D+I  +       +   G   PA G++G 
Sbjct: 105 --DPFMKKALQLVIDG-TDPDLLKNMMETEMDLIEEDLAGEKALMDSAGAYAPAYGMIGT 161

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           ++G+I  +  L+ +P+ LG  + V+L  T  G ILS ++  P+  +I     K  R   +
Sbjct: 162 LIGLIAMLKTLN-NPETLGPGMSVALITTFYGSILSNAVFLPMGEKIGKRAAKILRQKQM 220

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEV 280
           + + +++   G  P+V  E  +  L   E+   E   QE 
Sbjct: 221 ILEGVLSIQAGENPRVLEEKLKSFLTNQEKVVYEAAIQEA 260


>gi|148269400|ref|YP_001243860.1| MotA/TolQ/ExbB proton channel [Thermotoga petrophila RKU-1]
 gi|170288057|ref|YP_001738295.1| MotA/TolQ/ExbB proton channel [Thermotoga sp. RQ2]
 gi|281411903|ref|YP_003345982.1| MotA/TolQ/ExbB proton channel [Thermotoga naphthophila RKU-10]
 gi|147734944|gb|ABQ46284.1| MotA/TolQ/ExbB proton channel [Thermotoga petrophila RKU-1]
 gi|170175560|gb|ACB08612.1| MotA/TolQ/ExbB proton channel [Thermotoga sp. RQ2]
 gi|281373006|gb|ADA66568.1| MotA/TolQ/ExbB proton channel [Thermotoga naphthophila RKU-10]
          Length = 262

 Score =  187 bits (475), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 50/280 (17%), Positives = 119/280 (42%), Gaps = 22/280 (7%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           ++T++GL + I  +  G    GG+    I    + I     +   ++A+P      +   
Sbjct: 3   LATLMGLVLVIAALFIGILTGGGDFAAFINIPSLFITVVGSIAATMVAHPKD---KAFKI 59

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  +       +  +  +++ +       ++      E +++                  
Sbjct: 60  VNIMLSTLKEPKLDHVSLIQTMVSFSEKARREGLLSLEENLESIE--------------- 104

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
               F+   +++++ G