RPSBLAST alignment for GI: 255764488 and conserved domain: PRK08990

>gnl|CDD|181604 PRK08990, PRK08990, flagellar motor protein PomA; Reviewed. Length = 254
 Score = 44.3 bits (105), Expect = 3e-05
 Identities = 28/104 (26%), Positives = 58/104 (55%), Gaps = 3/104 (2%)

Query: 168 MGESLPAIGIVGAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQI 227
            G+  PA+G++G ++G++  + N+   PK +G A+ V+L  TL G +L+  +  P+  ++
Sbjct: 146 FGDVAPAMGMIGTLIGLVAMLSNMD-DPKSIGPAMAVALLTTLYGAVLANMVAIPIADKL 204

Query: 228 KSTRLKQHRL-YIIVKKALIAYMNGAIPQVAIEYGRKVLPLSER 270
            S R+ +  L   ++  A++A  +G  P+V   + +  L   +R
Sbjct: 205 -SLRMGEEMLNRNLIMDAVLAIQDGQNPRVIEGFLKNYLAEKKR 247