RPSBLAST alignment for GI: 255764488 and conserved domain: PRK09110

>gnl|CDD|181655 PRK09110, PRK09110, flagellar motor protein MotA; Validated. Length = 283
 Score =  336 bits (865), Expect = 4e-93
 Identities = 113/280 (40%), Positives = 173/280 (61%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  IIG  + +  + GG+   GG+   LIQP E++I+ GA LG F++ NP K IK +  +
Sbjct: 1   MLIIIGYIVVLGSVFGGYLLAGGHLGALIQPAELLIIGGAALGAFIVGNPGKAIKATLKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L ++F      +  Y D+L LLY L+   ++      E HI++P  S IF   P +L+++
Sbjct: 61  LPKLFKGPKYKKADYMDLLALLYELLRKARQEGMMALEAHIENPEESPIFAKYPKILKDH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FICDY+R++I GN   +EIE LMDEEI+   +E   P HA+  + ++LPA GIV A
Sbjct: 121 HLVDFICDYLRLMISGNMNPHEIEALMDEEIETHHHEAEVPAHALQKVADALPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG++K MG++ Q P +LG  IG +L GT LGI+L+Y    PL ++++    +  ++Y  
Sbjct: 181 VLGVVKTMGSIDQPPAVLGALIGAALVGTFLGILLAYGFVGPLAARLEQVVEEDTKMYQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEV 280
           +K  L+A +NG  PQ+A+E+GRK LP +ERPS   + + V
Sbjct: 241 IKVTLLASLNGYAPQIAVEFGRKTLPSTERPSFAELEEHV 280