RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|255764488|ref|YP_003065099.2| flagellar motor protein MotA [Candidatus Liberibacter asiaticus str. psy62] (290 letters) >gnl|CDD|31482 COG1291, MotA, Flagellar motor component [Cell motility and secretion]. Length = 266 Score = 229 bits (585), Expect = 8e-61 Identities = 102/282 (36%), Positives = 150/282 (53%), Gaps = 21/282 (7%) Query: 1 MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60 M TIIGL + ++GG+ GG+ LIQP ++I+ G G+G F++ NP KV+K + + Sbjct: 3 MLTIIGLVLAFGSVLGGYILGGGSLGALIQPSSLLIIVGGGIGAFMVGNPGKVVKATPKA 62 Query: 61 LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120 L E F + ++ Y D++ LLY L +K E D+ Sbjct: 63 LKEAF--RKPKKEDYVDLIALLYELAEKARKEGLLALEALADE----------------- 103 Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180 FI D +R+I+ GN EIE LM+EEI+ + KP HA + G+ PA GIVGA Sbjct: 104 IEDPFIKDGLRLIVDGND-PEEIEALMEEEIETMEERHEKPAHAFTTAGDYAPAFGIVGA 162 Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240 ++G+I A+GNL P LG I +L GTL GI L+Y L PL +++K ++ +L I Sbjct: 163 VMGLIHALGNLDD-PAELGALIAAALVGTLYGIFLAYGLFGPLANKLKQKSDEEVKLKEI 221 Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQ 282 + + L+A NG P++ E RK L ERPS + +EV Sbjct: 222 IIEGLLAIQNGENPRILEEKLRKFLSPKERPSFAELEEEVRG 263 >gnl|CDD|144995 pfam01618, MotA_ExbB, MotA/TolQ/ExbB proton channel family. This family groups together integral membrane proteins that appear to be involved translocation of proteins across a membrane. These proteins are probably proton channels. MotA is an essential component of the flageller motor that uses a proton gradient to generate rotational motion in the flageller. ExbB is part of the TonB-dependent transduction complex. The TonB complex uses the proton gradient across the inner bacterial membrane to transport large molecules across the outer bacterial membrane. Length = 139 Score = 36.8 bits (86), Expect = 0.006 Identities = 21/91 (23%), Positives = 38/91 (41%), Gaps = 13/91 (14%) Query: 137 NARSYEIENLMD-EEIDIILYEKLKPYHA--------ISHMGESLPAIGIVGAILGIIKA 187 + IE E + + L E L ++ +G P +G++G + GII A Sbjct: 21 LGLAPLIERGAFKEFLRLALEEALDAELRKLERGLTILATIGSVAPFLGLLGTVWGIIHA 80 Query: 188 MGNLSQS----PKILGTAIGVSLTGTLLGII 214 ++ Q+ P ++ I +L T LG+ Sbjct: 81 FIHIGQTGQADPAVVAPGISEALVATALGLF 111 >gnl|CDD|31153 COG0811, TolQ, Biopolymer transport proteins [Intracellular trafficking and secretion]. Length = 216 Score = 30.0 bits (67), Expect = 0.79 Identities = 14/68 (20%), Positives = 29/68 (42%), Gaps = 7/68 (10%) Query: 173 PAIGIVGAILGIIKAMGNLSQ----SPKILGTAIGVSLTGTLLGI---ILSYSLCNPLTS 225 P +G++G + GI+ A + ++ I +L T +G+ I + N L Sbjct: 130 PFLGLLGTVWGIMPAFIGIGAGGGADLAVVAPGISEALIATAIGLFVAIPAVVAYNVLRR 189 Query: 226 QIKSTRLK 233 +++ K Sbjct: 190 KVEELLAK 197 >gnl|CDD|38439 KOG3229, KOG3229, KOG3229, Vacuolar sorting protein VPS24 [Intracellular trafficking, secretion, and vesicular transport]. Length = 227 Score = 30.0 bits (67), Expect = 0.87 Identities = 16/64 (25%), Positives = 32/64 (50%), Gaps = 4/64 (6%) Query: 155 LYEKLKPYHAIS-HMGESLPAIGIVGAI---LGIIKAMGNLSQSPKILGTAIGVSLTGTL 210 LYE +++S + E L + + G++ ++KA+ +L + P++ T +S Sbjct: 77 LYESKAQLNSVSMQLKEQLATLRVAGSLQKSTEVMKAVNSLVKLPELAATMRELSKEMMK 136 Query: 211 LGII 214 GII Sbjct: 137 AGII 140 >gnl|CDD|145250 pfam01970, TctA, Tripartite tricarboxylate transporter TctA family. This family, formerly known as DUF112, is a family of bacterial and archaeal tripartite tricarboxylate transporters of the extracytoplasmic solute binding receptor-dependent transporter group of families, distinct from the ABC and TRAP-T families. TctA is part of the tripartite TctABC system which, as characterized in S. typhimurium, is a secondary carrier that depends for activity on the extracytoplasmic tricarboxylate-binding receptor TctC as well as two integral membrane proteins, TctA and TctB. complete three-component systems are found only in bacteria. TctA is a large transmembrane protein with up to 12 predicted membrane spanning regions in bacteria and up to 11 such in archaea, with the N-terminal within the cytoplasm. TctA is thought to be a permease, and in most other bacteria functions without TctB and TctC molecules. Length = 418 Score = 29.7 bits (68), Expect = 0.89 Identities = 10/45 (22%), Positives = 23/45 (51%), Gaps = 7/45 (15%) Query: 3 TIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVM 47 I+ I + C++G YA+ + F++ ++ G+ G++M Sbjct: 369 RILYPIILVFCVVGA-YAINNSM------FDVWVMLVFGVLGYLM 406 >gnl|CDD|33602 COG3808, OVP1, Inorganic pyrophosphatase [Energy production and conversion]. Length = 703 Score = 28.7 bits (64), Expect = 1.8 Identities = 17/61 (27%), Positives = 27/61 (44%), Gaps = 7/61 (11%) Query: 164 AISHMGESLPAIGIVGAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPL 223 A+ +LPAI IV I+ + G + GTAI + G+I++ P+ Sbjct: 385 AVGLESTALPAIVIVIGIIITYQLAG-------LYGTAIAAVGMLSTAGMIVALDAYGPV 437 Query: 224 T 224 T Sbjct: 438 T 438 >gnl|CDD|132754 cd07069, NR_LBD_Lrh-1, The ligand binding domain of the liver receptor homolog-1, a member of nuclear receptor superfamily,. The ligand binding domain (LBD) of the liver receptor homolog-1 (LRH-1): LRH-1 belongs to nuclear hormone receptor superfamily, and is expressed mainly in the liver, intestine, exocrine pancreas, and ovary. Most nuclear receptors function as homodimer or heterodimers. However, LRH-1 binds DNA as a monomer, and is a regulator of bile-acid homeostasis, steroidogenesis, reverse cholesterol transport and the initial stages of embryonic development. Recently, phospholipids have been identified as potential ligand for LRH-1 and steroidogenic factor-1 (SF-1). Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, LRH-1 has a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD). Length = 241 Score = 28.5 bits (63), Expect = 2.3 Identities = 16/45 (35%), Positives = 24/45 (53%) Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNH 285 V AL+ Y PQ ++G+ +L L E +I + A+E L Y H Sbjct: 177 VNAALLDYTMCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKH 221 >gnl|CDD|32255 COG2072, TrkA, Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism]. Length = 443 Score = 27.7 bits (61), Expect = 3.8 Identities = 11/31 (35%), Positives = 14/31 (45%), Gaps = 3/31 (9%) Query: 35 VIVAGAGLGGFVMANPLKVIKDSGVSLLEIF 65 V + GAG G A +K +GV IF Sbjct: 11 VAIIGAGQSGLAAA---YALKQAGVPDFVIF 38 >gnl|CDD|176976 CHL00035, psbC, photosystem II 44 kDa protein. Length = 473 Score = 27.4 bits (61), Expect = 4.3 Identities = 11/34 (32%), Positives = 20/34 (58%), Gaps = 8/34 (23%) Query: 1 MSTIIG--LFITILCIIGGFYAMGGNPYILIQPF 32 + IIG +++ +CI+GG + +IL +PF Sbjct: 230 LEDIIGGHVWLGSICILGGIW------HILTKPF 257 >gnl|CDD|144095 pfam00375, SDF, Sodium:dicarboxylate symporter family. Length = 387 Score = 27.1 bits (61), Expect = 5.4 Identities = 8/45 (17%), Positives = 20/45 (44%) Query: 177 IVGAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCN 221 + +I+ I ++G+ + K+ G + L T + I+ + Sbjct: 45 VFFSIVSGIASLGDGKKLGKLGGKTLLYFLVTTAIAAIIGLLVAL 89 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.322 0.141 0.402 Gapped Lambda K H 0.267 0.0553 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 3,497,421 Number of extensions: 194067 Number of successful extensions: 629 Number of sequences better than 10.0: 1 Number of HSP's gapped: 620 Number of HSP's successfully gapped: 39 Length of query: 290 Length of database: 6,263,737 Length adjustment: 93 Effective length of query: 197 Effective length of database: 4,254,100 Effective search space: 838057700 Effective search space used: 838057700 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 57 (26.1 bits)