RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddB 
           21,608 sequences; 5,994,473 total letters

Searching..................................................done

Query= gi|255764488|ref|YP_003065099.2| flagellar motor protein MotA
[Candidatus Liberibacter asiaticus str. psy62]
         (290 letters)



>gnl|CDD|181655 PRK09110, PRK09110, flagellar motor protein MotA; Validated.
          Length = 283

 Score =  336 bits (865), Expect = 4e-93
 Identities = 113/280 (40%), Positives = 173/280 (61%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  IIG  + +  + GG+   GG+   LIQP E++I+ GA LG F++ NP K IK +  +
Sbjct: 1   MLIIIGYIVVLGSVFGGYLLAGGHLGALIQPAELLIIGGAALGAFIVGNPGKAIKATLKA 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L ++F      +  Y D+L LLY L+   ++      E HI++P  S IF   P +L+++
Sbjct: 61  LPKLFKGPKYKKADYMDLLALLYELLRKARQEGMMALEAHIENPEESPIFAKYPKILKDH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FICDY+R++I GN   +EIE LMDEEI+   +E   P HA+  + ++LPA GIV A
Sbjct: 121 HLVDFICDYLRLMISGNMNPHEIEALMDEEIETHHHEAEVPAHALQKVADALPAFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG++K MG++ Q P +LG  IG +L GT LGI+L+Y    PL ++++    +  ++Y  
Sbjct: 181 VLGVVKTMGSIDQPPAVLGALIGAALVGTFLGILLAYGFVGPLAARLEQVVEEDTKMYQC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEV 280
           +K  L+A +NG  PQ+A+E+GRK LP +ERPS   + + V
Sbjct: 241 IKVTLLASLNGYAPQIAVEFGRKTLPSTERPSFAELEEHV 280


>gnl|CDD|163530 TIGR03818, MotA1, flagellar motor stator protein MotA.  This model
           represents one family of MotA proteins which are often
           not identified by the "transporter, MotA/TolQ/ExbB
           proton channel family" model, pfam01618.
          Length = 282

 Score =  319 bits (821), Expect = 4e-88
 Identities = 109/280 (38%), Positives = 177/280 (63%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  IIGL + + C+ GG+   GG+   L QP E++I+ GA +G F++ANP KV+K++   
Sbjct: 1   MLKIIGLVVVLGCVFGGYLLAGGHLAALWQPAELLIIGGAAIGAFIIANPPKVLKETLKG 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           L ++F     G+  Y D+L LLY L+   ++      E+HI++P  S+IF+  P +L+++
Sbjct: 61  LPKVFKGSKYGKADYLDLLSLLYELLRKARREGLMAIESHIENPEESSIFSKYPKILKDH 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L  FICDY+R++++GN   +E+E LM+EEI+   +E LKP HA+  + ++LP  GIV A
Sbjct: 121 HLVEFICDYLRLMVMGNMNPHELEALMEEEIETHHHELLKPAHALQKVADALPGFGIVAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LG++  MG++   P++LG  I  +L GT LGI+L+Y    PL + ++    ++ +    
Sbjct: 181 VLGVVITMGSIDGPPEVLGVLIAAALVGTFLGILLAYGFVGPLAAALEQRVEEEIKFLEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEV 280
           VK  L+A +NG  PQ+A+E+GRKV+P   RPS   + + V
Sbjct: 241 VKVTLVASLNGYAPQLAVEFGRKVIPSDVRPSFAELEEWV 280


>gnl|CDD|171532 PRK12482, PRK12482, flagellar motor protein MotA; Provisional.
          Length = 287

 Score =  181 bits (462), Expect = 1e-46
 Identities = 86/272 (31%), Positives = 153/272 (56%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           M  + GL + + C+ GG+   GG+   + QP EI+I+ GAG+G  ++ NP  V+K+    
Sbjct: 1   MQKLFGLLVVMGCVFGGYLMSGGSLSSIWQPGEIIIILGAGIGAMILGNPKSVLKEMWHQ 60

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENN 120
           +  +   K  G +    +L LLY L+  +++G     + HI+ P  S++F   P +L+  
Sbjct: 61  IKGVIRRKEYGVEFQRQLLLLLYELLEMVQEGGLKRLDQHIEIPEESSLFQKYPLILQQK 120

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGA 180
            L TFI D  R++ +G    +E+E ++D+E+D +  E L+P  ++  + E++P  GI  A
Sbjct: 121 RLITFISDNFRLMAMGKINQHELEGILDQELDAVEEELLQPSRSLQRIAEAMPGFGICAA 180

Query: 181 ILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYII 240
           +LGII  M ++  S   +G  +  +L GT LG+ + Y L +PL + ++    K+  L   
Sbjct: 181 VLGIIITMQSIDGSIAEIGLKVAAALVGTFLGVFICYCLMDPLANAMEQEIKKELSLLEC 240

Query: 241 VKKALIAYMNGAIPQVAIEYGRKVLPLSERPS 272
           V+  L+A++ G    +A++ GRK+LPL  +P+
Sbjct: 241 VRTVLVAHVAGKPTLLAVDAGRKLLPLDNKPT 272


>gnl|CDD|181238 PRK08124, PRK08124, flagellar motor protein MotA; Validated.
          Length = 263

 Score = 79.6 bits (197), Expect = 9e-16
 Identities = 71/283 (25%), Positives = 131/283 (46%), Gaps = 41/283 (14%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSL 61
           +TIIGL + ++ ++ G    G +  +L+ P  I+I+    +   ++A P+  +K     +
Sbjct: 4   TTIIGLILGLIAVVVGMVVKGASLAVLLNPAAILIIIVGTIAAVMIAFPMSELK----KV 59

Query: 62  LEIFG--YKALGQDTYCDVLKLLYILMYNLKKGSRNE-------TENHIDDPYNSTIFTS 112
            ++F   +K     +  ++++            SR E         + IDDP        
Sbjct: 60  PKLFKVLFKEKKDPSKEELIEQFV----EWASESRREGLLALEAQLDEIDDP-------- 107

Query: 113 IPTVLENNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAI-SHMGES 171
                       F+   ++M+I G +  + I ++++EEI+ +  E+     AI +  G  
Sbjct: 108 ------------FLKRGLKMVIDGQSPEF-IRDVLEEEIEAM-EERHAAGAAIFTQAGTY 153

Query: 172 LPAIGIVGAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTR 231
            P +G++GA++G+I A+GNLS   K LG AI  +   TLLGI   Y L +P  +++K   
Sbjct: 154 APTLGVLGAVIGLIAALGNLSDIEK-LGHAISAAFVATLLGIFTGYVLWHPFANKLKRKS 212

Query: 232 LKQHRLYIIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIE 274
            ++  L  I+ + ++A   G  P+V  E     L   ER  +E
Sbjct: 213 KEEIELKYIIIEGVLAIQEGNAPRVIEEKLLGYLSPKERKKLE 255


>gnl|CDD|181654 PRK09109, motC, flagellar motor protein; Reviewed.
          Length = 246

 Score = 49.9 bits (120), Expect = 7e-07
 Identities = 32/92 (34%), Positives = 52/92 (56%), Gaps = 2/92 (2%)

Query: 168 MGESLPAIGIVGAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQI 227
           MG   P IGI+GA++G+I  M NL+  P  LG+ I V+   T+ G+  +  L  P+ +++
Sbjct: 149 MGGYAPTIGIIGAVMGLIHVMENLA-DPSQLGSGIAVAFVATIYGVASANLLFLPVANKL 207

Query: 228 KSTRLKQHRLYIIVKKALIAYMNGAIPQVAIE 259
           KS   +Q R   ++ + L+A   G  P+  IE
Sbjct: 208 KSIIHRQSRYREMLVEGLVAIAEGENPRS-IE 238



 Score = 38.0 bits (89), Expect = 0.003
 Identities = 19/55 (34%), Positives = 29/55 (52%)

Query: 3  TIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDS 57
          ++IGL +  + IIGG    GG+   L+     +IV G  LG  ++  PL V K +
Sbjct: 5  SLIGLILAFVAIIGGQVLEGGHLGSLLNGPAFLIVIGGTLGAVLLQTPLAVFKRA 59


>gnl|CDD|181434 PRK08456, PRK08456, flagellar motor protein MotA; Validated.
          Length = 257

 Score = 49.0 bits (117), Expect = 1e-06
 Identities = 60/260 (23%), Positives = 114/260 (43%), Gaps = 34/260 (13%)

Query: 1   MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVS 60
           +STI+G+ + +  I  G    GGNP  +I     +IV    L   + A   K +K +   
Sbjct: 3   LSTILGMVLAVASISVGDILEGGNPLHVIHLSSFIIVVPTALFAAMTATHKKYVKAAYKE 62

Query: 61  LLEIFGYKALGQDTYCDVLKLLYILMYNLKKG--SRNETENHIDDPYNSTIFTSIPTVLE 118
           L  +F  K  G +    + +L+ +     K G  +       I+D               
Sbjct: 63  LKIVF--KNPGVNLNERIKQLVELATLARKDGVLALEGRVAQIEDE-------------- 106

Query: 119 NNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHM----GESLPA 174
                 F+ + + M++ G     ++E +  E ++I + E  + YH  +H     GE+ P 
Sbjct: 107 ------FLKNGLSMLVDGK----DLEEI-KESMEIQIEEMEEYYHGAAHYWITAGETCPT 155

Query: 175 IGIVGAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQ 234
           +G+VGA++G++ A+  L  +P  +   I  + T T+ GI+ SY+L  P   ++K+     
Sbjct: 156 MGLVGAVMGLMLALQKL-DNPAEMAAGIAGAFTATVTGIMGSYALFGPWGHKLKAKSKDI 214

Query: 235 HRLYIIVKKALIAYMNGAIP 254
            +   ++ + ++    GA P
Sbjct: 215 IKEKTVILEGILGIAEGANP 234


>gnl|CDD|181604 PRK08990, PRK08990, flagellar motor protein PomA; Reviewed.
          Length = 254

 Score = 44.3 bits (105), Expect = 3e-05
 Identities = 28/104 (26%), Positives = 58/104 (55%), Gaps = 3/104 (2%)

Query: 168 MGESLPAIGIVGAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQI 227
            G+  PA+G++G ++G++  + N+   PK +G A+ V+L  TL G +L+  +  P+  ++
Sbjct: 146 FGDVAPAMGMIGTLIGLVAMLSNMD-DPKSIGPAMAVALLTTLYGAVLANMVAIPIADKL 204

Query: 228 KSTRLKQHRL-YIIVKKALIAYMNGAIPQVAIEYGRKVLPLSER 270
            S R+ +  L   ++  A++A  +G  P+V   + +  L   +R
Sbjct: 205 -SLRMGEEMLNRNLIMDAVLAIQDGQNPRVIEGFLKNYLAEKKR 247


>gnl|CDD|136027 PRK06743, PRK06743, flagellar motor protein MotP; Reviewed.
          Length = 254

 Score = 42.7 bits (100), Expect = 1e-04
 Identities = 27/103 (26%), Positives = 59/103 (57%), Gaps = 2/103 (1%)

Query: 125 FICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGI 184
           FI   +R+++ G     E++ ++ ++++  +YE  K    +  +G+  PA G++G ++G+
Sbjct: 104 FIQKGIRLMLSGYDED-ELKEVLMKDVETEVYELRKGAALLDKIGDFAPAWGMIGTLIGL 162

Query: 185 IKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQI 227
           I  + NL  + +I GT + V++  TL G +L+  +  PL  ++
Sbjct: 163 IIMLQNLQDTSQI-GTGMAVAMLTTLYGSVLANMIAIPLAEKV 204


>gnl|CDD|180755 PRK06926, PRK06926, flagellar motor protein MotP; Reviewed.
          Length = 271

 Score = 36.6 bits (85), Expect = 0.007
 Identities = 23/87 (26%), Positives = 45/87 (51%), Gaps = 1/87 (1%)

Query: 143 IENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQSPKILGTAI 202
           I ++M  EI  +     K        GE  PA G++G ++G++  + NL+  P  LG  +
Sbjct: 129 IRDIMMAEIAAMEERHRKGRRIFEKAGEYAPAWGMIGTLVGLVLMLKNLND-PSTLGPNM 187

Query: 203 GVSLTGTLLGIILSYSLCNPLTSQIKS 229
            ++L  TL G +L+  +  P+ ++++ 
Sbjct: 188 AIALLTTLYGTLLANLVFLPIAAKLEE 214


>gnl|CDD|182778 PRK10851, PRK10851, sulfate/thiosulfate transporter subunit;
           Provisional.
          Length = 353

 Score = 29.3 bits (66), Expect = 1.1
 Identities = 10/25 (40%), Positives = 14/25 (56%)

Query: 258 IEYGRKVLPLSERPSIEIVAQEVLQ 282
           I +G  VLP  ERP+   +  +V Q
Sbjct: 95  IAFGLTVLPRRERPNAAAIKAKVTQ 119


>gnl|CDD|180504 PRK06277, PRK06277, hydrogenase subunit F; Validated.
          Length = 478

 Score = 28.1 bits (63), Expect = 3.0
 Identities = 17/62 (27%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query: 155 LYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGII 214
           +Y K KP+   S + ++     +V  +L I K  G LS  P   G  I +S+   + G++
Sbjct: 225 IYAKAKPF--GSALLQTFSKFVLVALMLVIFKLFGGLSYFPSAQGVLIALSVLAMVFGVV 282

Query: 215 LS 216
           ++
Sbjct: 283 MA 284


>gnl|CDD|129921 TIGR00841, bass, bile acid transporter.  Functionally characterized
           members of the BASS family catalyze Na+:bile acid
           symport. These systems have been identified in
           intestinal, liver and kidney tissues of animals. These
           symporters exhibit broad specificity, taking up a
           variety of non bile organic compounds as well as
           taurocholate and other bile salts. Functionally
           uncharacterised homologues are found in plants, yeast,
           archaea and bacteria.
          Length = 286

 Score = 27.3 bits (61), Expect = 4.6
 Identities = 17/78 (21%), Positives = 28/78 (35%), Gaps = 2/78 (2%)

Query: 151 IDIILYEKLKPYHAISHMGESLPAIGIVGAI--LGIIKAMGNLSQSPKILGTAIGVSLTG 208
           I +++  KL     I      +    +   I  +G I      +  P +L   I + L G
Sbjct: 149 IGMLVKHKLPQIAKIILKVGLISVFLLSVIIAVVGGINVENLATIGPLLLLVGILLPLAG 208

Query: 209 TLLGIILSYSLCNPLTSQ 226
            LLG +L+     P    
Sbjct: 209 FLLGYLLAKLAGLPWARC 226


>gnl|CDD|179625 PRK03659, PRK03659, glutathione-regulated potassium-efflux system
           protein KefB; Provisional.
          Length = 601

 Score = 27.3 bits (61), Expect = 4.9
 Identities = 15/43 (34%), Positives = 25/43 (58%), Gaps = 9/43 (20%)

Query: 35  VIVAGAG-----LGGFVMANPLKVI---KD-SGVSLLEIFGYK 68
           VI+ G G     +G  +MAN +++    +D S V+L+  +GYK
Sbjct: 403 VIIVGFGRFGQVIGRLLMANKMRITVLERDISAVNLMRKYGYK 445


>gnl|CDD|183782 PRK12834, PRK12834, putative FAD-binding dehydrogenase; Reviewed.
          Length = 549

 Score = 27.2 bits (61), Expect = 5.1
 Identities = 12/25 (48%), Positives = 14/25 (56%), Gaps = 5/25 (20%)

Query: 35 VIVAGAGLGGFVMANPL-----KVI 54
          VIV GAGL G V A  L     +V+
Sbjct: 7  VIVVGAGLAGLVAAAELADAGKRVL 31


>gnl|CDD|162338 TIGR01398, FlhA, flagellar biosynthesis protein FlhA.  This model
           describes flagellar biosynthesis protein FlhA, one of a
           large number of genes associated with the biosynthesis
           of functional bacterial flagella. Homologs of many such
           proteins, including FlhA, function in type III protein
           secretion systems. A separate model describes InvA
           (Salmonella enterica), LcrD (Yersinia enterocolitica),
           HrcV (Xanthomonas), etc., all of which score below the
           noise cutoff for this model.
          Length = 678

 Score = 26.8 bits (60), Expect = 5.8
 Identities = 8/15 (53%), Positives = 11/15 (73%)

Query: 4   IIGLFITILCIIGGF 18
           I G+ IT++ IIGG 
Sbjct: 192 IAGIIITLINIIGGL 206


>gnl|CDD|130295 TIGR01228, hutU, urocanate hydratase.  This model represents the
           second of four enzymes involved in the degradation of
           histidine to glutamate.
          Length = 545

 Score = 27.1 bits (60), Expect = 6.0
 Identities = 13/26 (50%), Positives = 15/26 (57%)

Query: 36  IVAGAGLGGFVMANPLKVIKDSGVSL 61
            V  AGLGG   A PL V  + GVS+
Sbjct: 160 WVLTAGLGGMGGAQPLAVTMNGGVSI 185


>gnl|CDD|181023 PRK07538, PRK07538, hypothetical protein; Provisional.
          Length = 413

 Score = 26.8 bits (60), Expect = 6.4
 Identities = 7/14 (50%), Positives = 11/14 (78%)

Query: 35 VIVAGAGLGGFVMA 48
          V++AG G+GG  +A
Sbjct: 3  VLIAGGGIGGLTLA 16


>gnl|CDD|162512 TIGR01739, tegu_FGAM_synt, herpesvirus tegument
           protein/v-FGAM-synthase.  This model describes a family
           of large proteins of herpesvirues. The protein is
           described variably as tegument protein or
           phosphoribosylformylglycinamidine synthase
           (FGAM-synthase). Most of the length of the protein shows
           homology to eukaryotic FGAM-synthase. Functional
           characterizations were not verified during construction
           of this model.
          Length = 1202

 Score = 26.6 bits (59), Expect = 7.2
 Identities = 15/71 (21%), Positives = 21/71 (29%), Gaps = 10/71 (14%)

Query: 138 ARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIG----------IVGAILGIIKA 187
               E    +  + D  LY           +     A+G            GA   I +A
Sbjct: 562 VTYSENAMDLILDPDSWLYSWENEVLENPALSCVCSALGEQTYKVQADPKRGATYAITEA 621

Query: 188 MGNLSQSPKIL 198
           + NLS SP   
Sbjct: 622 LLNLSLSPWNT 632


>gnl|CDD|185547 PTZ00304, PTZ00304, NADH dehydrogenase [ubiquinone] flavoprotein 1;
           Provisional.
          Length = 461

 Score = 26.7 bits (59), Expect = 7.6
 Identities = 10/28 (35%), Positives = 15/28 (53%)

Query: 121 ELTTFICDYMRMIIVGNARSYEIENLMD 148
           E T ++   M   +VGNA   EI+ L +
Sbjct: 375 EGTPWLVKMMERFVVGNADKEEIDTLEE 402


>gnl|CDD|161671 TIGR00031, UDP-GALP_mutase, UDP-galactopyranose mutase.  The gene
          is known as glf, ceoA, and rfbD. It is known
          experimentally in E. coli, Mycobacterium tuberculosis,
          and Klebsiella pneumoniae.
          Length = 377

 Score = 26.7 bits (59), Expect = 8.1
 Identities = 12/21 (57%), Positives = 15/21 (71%), Gaps = 1/21 (4%)

Query: 32 FEIVIVAGAGLGGFVMANPLK 52
          F+ +IV GAGL G V+AN L 
Sbjct: 2  FDYIIV-GAGLSGIVLANILA 21


>gnl|CDD|182150 PRK09928, PRK09928, choline transport protein BetT; Provisional.
          Length = 679

 Score = 26.6 bits (59), Expect = 8.3
 Identities = 17/54 (31%), Positives = 22/54 (40%), Gaps = 7/54 (12%)

Query: 2   STIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIK 55
           S  IGL    + +  G  A+     I+  PF  VI        FVMA   K +K
Sbjct: 457 SVAIGLLTLGMLMTNGISALQNTTVIMGLPFSFVIF-------FVMAGLYKSLK 503


>gnl|CDD|182865 PRK10957, PRK10957, iron-enterobactin transporter periplasmic
           binding protein; Provisional.
          Length = 317

 Score = 26.5 bits (59), Expect = 8.5
 Identities = 12/24 (50%), Positives = 16/24 (66%), Gaps = 3/24 (12%)

Query: 191 LSQSPK-ILGTAIGVSLTGTLLGI 213
           L   P+ I+ T+  V+LTGTLL I
Sbjct: 40  LESKPQRIVSTS--VTLTGTLLAI 61


>gnl|CDD|179368 PRK02106, PRK02106, choline dehydrogenase; Validated.
          Length = 560

 Score = 26.3 bits (59), Expect = 9.4
 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 1/32 (3%)

Query: 32 FEIVIVAGAGLGGFVMANPLKVIKDSGVSLLE 63
          ++ +I+ GAG  G V+AN L    D  V LLE
Sbjct: 6  YDYIII-GAGSAGCVLANRLSEDPDVSVLLLE 36


>gnl|CDD|184562 PRK14193, PRK14193, bifunctional 5,10-methylene-tetrahydrofolate
           dehydrogenase/ 5,10-methylene-tetrahydrofolate
           cyclohydrolase; Provisional.
          Length = 284

 Score = 26.1 bits (58), Expect = 9.8
 Identities = 12/29 (41%), Positives = 15/29 (51%), Gaps = 3/29 (10%)

Query: 35  VIVAGAGLGGFV---MANPLKVIKDSGVS 60
           +IVA AG+   V   M  P   + D GVS
Sbjct: 206 IIVAAAGVAHLVTADMVKPGAAVLDVGVS 234


  Database: CddB
    Posted date:  Feb 4, 2011  9:54 PM
  Number of letters in database: 5,994,473
  Number of sequences in database:  21,608
  
Lambda     K      H
   0.322    0.141    0.402 

Gapped
Lambda     K      H
   0.267   0.0827    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21608
Number of Hits to DB: 4,786,348
Number of extensions: 320569
Number of successful extensions: 832
Number of sequences better than 10.0: 1
Number of HSP's gapped: 824
Number of HSP's successfully gapped: 54
Length of query: 290
Length of database: 5,994,473
Length adjustment: 93
Effective length of query: 197
Effective length of database: 3,984,929
Effective search space: 785031013
Effective search space used: 785031013
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 57 (25.6 bits)