RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|255764489|ref|YP_003065094.2| stationary phase survival protein SurE [Candidatus Liberibacter asiaticus str. psy62] (250 letters) >gnl|CDD|30842 COG0496, SurE, Predicted acid phosphatase [General function prediction only]. Length = 252 Score = 232 bits (593), Expect = 8e-62 Identities = 85/253 (33%), Positives = 140/253 (55%), Gaps = 5/253 (1%) Query: 1 MRILLTNDDGIKSKGLITLENIARSISDDIWICAPEMDQSCLANSLTMSRNIACRTISKK 60 MRILLTNDDGI + G+ L R D+ + AP+ +QS ++SLT+ + R + Sbjct: 1 MRILLTNDDGIHAPGIRALARALRE-GADVTVVAPDREQSGASHSLTLHEPLRVRQVDNG 59 Query: 61 RFAVHGTPVDCVVIALQK-MSDKKPDLILSGVNVGTNTSNHVAYSGTLAAAFEGSLQGIR 119 +AV+GTP DCV++ L + + + +PDL++SG+N G N + V YSGT+AAA E +L GI Sbjct: 60 AYAVNGTPADCVILGLNELLKEPRPDLVVSGINAGANLGDDVIYSGTVAAAMEAALLGIP 119 Query: 120 SFALSQAYTYEN---MIPWEVSETHAPRVLRQLLKTQIPNTTLCNINFPRCSPEEVQKTV 176 + A+S AY + +E + A ++ LL +P TL N+N P EE++ Sbjct: 120 AIAISLAYREAFGKQDVDFETAAKVARALVEALLANPLPPDTLLNVNIPNLPLEEIKGIR 179 Query: 177 VTAQGKPCFSIDAKQISTNDNMSHYCLTFGDHLKNLCEKSDAFAIQHNMISVTPITTDLT 236 VT G+ ++ ++ + +Y + G ++ E +D A++ IS+TP+ DLT Sbjct: 180 VTRLGRRRYAEPVEERTDPRGEPYYWIGPGGLAEDAEEGTDFHAVREGYISITPLQLDLT 239 Query: 237 DYNSQQYISLSLE 249 Y + + + L+ Sbjct: 240 AYEALESLKSWLK 252 >gnl|CDD|145253 pfam01975, SurE, Survival protein SurE. E. coli cells with the surE gene disrupted are found to survive poorly in stationary phase. It is suggested that SurE may be involved in stress response. Yeast also contains a member of the family. A sequence from Yarrowia lipolytica can complement a mutation in acid phosphatase, suggesting that members of this family could be phosphatases. Length = 190 Score = 203 bits (520), Expect = 3e-53 Identities = 70/189 (37%), Positives = 110/189 (58%), Gaps = 5/189 (2%) Query: 2 RILLTNDDGIKSKGLITLENIARSISDDIWICAPEMDQSCLANSLTMSRNIACRTI---S 58 RILLTNDDGI + G+ L +++ + + + AP+ +QS + +S+T+ R + + + Sbjct: 1 RILLTNDDGIHAPGIRALAEALKALGE-VTVVAPDREQSGVGHSITLHRPLRVKKVDNDG 59 Query: 59 KKRFAVHGTPVDCVVIALQK-MSDKKPDLILSGVNVGTNTSNHVAYSGTLAAAFEGSLQG 117 +AV+GTP DCV + L + DKKPDL++SG+N G N V YSGT+ AA E +L G Sbjct: 60 AGAYAVNGTPADCVKLGLNGLLDDKKPDLVVSGINHGANLGTDVLYSGTVGAAMEAALLG 119 Query: 118 IRSFALSQAYTYENMIPWEVSETHAPRVLRQLLKTQIPNTTLCNINFPRCSPEEVQKTVV 177 I S A+S A + +E + R++ +LLK +P TL N+N P P E++ V Sbjct: 120 IPSIAVSLAGNSDEKDDFETAAKLVRRLVEKLLKNGLPPGTLLNVNIPALPPSEIKGIKV 179 Query: 178 TAQGKPCFS 186 T G+ ++ Sbjct: 180 TRLGRRRYA 188 >gnl|CDD|173804 cd07478, Peptidases_S8_CspA-like, Peptidase S8 family domain in CspA-like proteins. GSP (germination-specific protease) converts the spore peptidoglycan hydrolase (SleC) precursor to an active enzyme during germination of Clostridium perfringens S40 spores. Analysis of an enzyme fraction of GSP showed that it was composed of a gene cluster containing the processed forms of products of cspA, cspB, and cspC which are positioned in a tandem array just upstream of the 5' end of sleC. The amino acid sequences deduced from the nucleotide sequences of the csp genes showed significant similarity and showed a high degree of homology with those of the catalytic domain and the oxyanion binding region of subtilisin-like serine proteases. Members of the peptidases S8 and S35 clan include endopeptidases, exopeptidases and also a tripeptidyl-peptidase. The S8 family has an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The S53 family contains a catalytic triad Glu/Asp/Ser. The stability of these enzymes may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values. Length = 455 Score = 28.7 bits (65), Expect = 1.6 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Query: 83 KPDLILSGVNVGTNTSN--HVAYSGTLAAA 110 KPD+ GVN+ T + + SGT AA Sbjct: 374 KPDIAAPGVNILTASPGGGYTTRSGTSVAA 403 >gnl|CDD|144789 pfam01320, Colicin_Pyocin, Colicin immunity protein / pyocin immunity protein. Length = 85 Score = 27.2 bits (61), Expect = 4.3 Identities = 9/22 (40%), Positives = 11/22 (50%), Gaps = 3/22 (13%) Query: 167 CSPEEVQKTVV---TAQGKPCF 185 SPE + K + A GKP F Sbjct: 62 DSPEGIVKEIKEWRAANGKPGF 83 >gnl|CDD|107381 cd06386, PBP1_NPR_C_like, Ligand-binding domain of type C natriuretic peptide receptor. Ligand-binding domain of type C natriuretic peptide receptor (NPR-C). NPR-C is found in atrial, mesentery, placenta, lung, kidney, venous tissue, aortic smooth muscle, and aortic endothelial cells. The affinity of NPR-C for natriuretic peptides is ANP>CNP>BNP. The extracellular domain of NPR-C is about 30% identical to NPR-A and NPR-B. However, unlike the cyclase-linked receptors, it contains only 37 intracellular amino acids and no guanylyl cyclase activity. Major function of NPR-C is to clear natriuretic peptides from the circulation or extracellular surroundings through constitutive receptor-mediated internalization and degradation. Length = 387 Score = 27.1 bits (60), Expect = 4.9 Identities = 16/35 (45%), Positives = 18/35 (51%), Gaps = 4/35 (11%) Query: 61 RFAVHGTPVDCVVIALQKMSD----KKPDLILSGV 91 RF VH DC AL + D +KPDLIL V Sbjct: 41 RFNVHYEDSDCGNEALFSLVDRSCARKPDLILGPV 75 >gnl|CDD|132725 cd06528, RNAP_A'', A'' subunit of Archaeal RNA Polymerase (RNAP). Archaeal RNA polymerase (RNAP), like bacterial RNAP, is a large multi-subunit complex responsible for the synthesis of all RNAs in the cell. The relative positioning of the RNAP core is highly conserved between archaeal RNAP and the three classes of eukaryotic RNAPs. In archaea, the largest subunit is split into two polypeptides, A' and A'', which are encoded by separate genes in an operon. Sequence alignments reveal that the archaeal A'' subunit corresponds to the C-terminal one-third of the RNAPII largest subunit (Rpb1). In subunit A'', several loops in the jaw domain are shorter. The RNAPII Rpb1 interacts with the second-largest subunit (Rpb2) to form the DNA entry and RNA exit channels in addition to the catalytic center of RNA synthesis. Length = 363 Score = 26.4 bits (59), Expect = 7.0 Identities = 20/87 (22%), Positives = 40/87 (45%), Gaps = 15/87 (17%) Query: 18 TLENIARSISDDIWICA--PEMDQSCLANS-LTMSRNIACRTISK-KRFAVHGTPVDCVV 73 TLEN+A IS D++ E+D+ L + +T+ + I K K+ V ++ Sbjct: 121 TLENLAEDISIDLFNMRITIELDEEMLEDRGITVDDVLK--AIEKLKKGKVGEEGDVTLI 178 Query: 74 I---------ALQKMSDKKPDLILSGV 91 + L+K+++K + + G+ Sbjct: 179 VLKAEEPSIKELRKLAEKILNTKIKGI 205 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.318 0.130 0.383 Gapped Lambda K H 0.267 0.0830 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,745,954 Number of extensions: 130415 Number of successful extensions: 301 Number of sequences better than 10.0: 1 Number of HSP's gapped: 295 Number of HSP's successfully gapped: 12 Length of query: 250 Length of database: 6,263,737 Length adjustment: 91 Effective length of query: 159 Effective length of database: 4,297,318 Effective search space: 683273562 Effective search space used: 683273562 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 56 (25.2 bits)