BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|255764489|ref|YP_003065094.2| stationary phase survival protein SurE [Candidatus Liberibacter asiaticus str. psy62] (250 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|255764489|ref|YP_003065094.2| stationary phase survival protein SurE [Candidatus Liberibacter asiaticus str. psy62] Length = 250 Score = 522 bits (1345), Expect = e-150, Method: Compositional matrix adjust. Identities = 250/250 (100%), Positives = 250/250 (100%) Query: 1 MRILLTNDDGIKSKGLITLENIARSISDDIWICAPEMDQSCLANSLTMSRNIACRTISKK 60 MRILLTNDDGIKSKGLITLENIARSISDDIWICAPEMDQSCLANSLTMSRNIACRTISKK Sbjct: 1 MRILLTNDDGIKSKGLITLENIARSISDDIWICAPEMDQSCLANSLTMSRNIACRTISKK 60 Query: 61 RFAVHGTPVDCVVIALQKMSDKKPDLILSGVNVGTNTSNHVAYSGTLAAAFEGSLQGIRS 120 RFAVHGTPVDCVVIALQKMSDKKPDLILSGVNVGTNTSNHVAYSGTLAAAFEGSLQGIRS Sbjct: 61 RFAVHGTPVDCVVIALQKMSDKKPDLILSGVNVGTNTSNHVAYSGTLAAAFEGSLQGIRS 120 Query: 121 FALSQAYTYENMIPWEVSETHAPRVLRQLLKTQIPNTTLCNINFPRCSPEEVQKTVVTAQ 180 FALSQAYTYENMIPWEVSETHAPRVLRQLLKTQIPNTTLCNINFPRCSPEEVQKTVVTAQ Sbjct: 121 FALSQAYTYENMIPWEVSETHAPRVLRQLLKTQIPNTTLCNINFPRCSPEEVQKTVVTAQ 180 Query: 181 GKPCFSIDAKQISTNDNMSHYCLTFGDHLKNLCEKSDAFAIQHNMISVTPITTDLTDYNS 240 GKPCFSIDAKQISTNDNMSHYCLTFGDHLKNLCEKSDAFAIQHNMISVTPITTDLTDYNS Sbjct: 181 GKPCFSIDAKQISTNDNMSHYCLTFGDHLKNLCEKSDAFAIQHNMISVTPITTDLTDYNS 240 Query: 241 QQYISLSLET 250 QQYISLSLET Sbjct: 241 QQYISLSLET 250 >gi|254780168|ref|YP_003064581.1| monooxygenase FAD-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 380 Score = 26.6 bits (57), Expect = 0.38, Method: Compositional matrix adjust. Identities = 12/51 (23%), Positives = 30/51 (58%), Gaps = 2/51 (3%) Query: 51 NIACRTISKKRFAVHGTPVDCVVIALQKMSDKKPDLILSGVNVGTNTSNHV 101 +I + +++ + H T DC I+ K++++KPDL++ + +N +++ Sbjct: 111 HIQTQPLARLHLSTHITHPDCTQIS--KINNQKPDLLVGADGLNSNIRHYI 159 >gi|254780451|ref|YP_003064864.1| aconitate hydratase [Candidatus Liberibacter asiaticus str. psy62] Length = 896 Score = 25.4 bits (54), Expect = 0.91, Method: Compositional matrix adjust. Identities = 17/72 (23%), Positives = 33/72 (45%), Gaps = 14/72 (19%) Query: 75 ALQKMSDKKPDLILSGVNVGTNTSNHVAYSGT--------LAAAFEGSLQ------GIRS 120 A++ D+ P ++ +GV G +S A GT +A +FE + G+ Sbjct: 760 AMRYKVDQVPLVVFAGVEYGNGSSRDWAAKGTRLLGVRSVIAESFERIHRSNLIGMGVIP 819 Query: 121 FALSQAYTYENM 132 FA + +++N+ Sbjct: 820 FAFGKGISWKNL 831 >gi|254780510|ref|YP_003064923.1| hypothetical protein CLIBASIA_01985 [Candidatus Liberibacter asiaticus str. psy62] Length = 137 Score = 23.5 bits (49), Expect = 4.0, Method: Compositional matrix adjust. Identities = 11/32 (34%), Positives = 18/32 (56%) Query: 130 ENMIPWEVSETHAPRVLRQLLKTQIPNTTLCN 161 E+ + + +SE +LR+ LK I +T L N Sbjct: 24 ESNLAYTISERKKINILREKLKDSINSTALMN 55 >gi|254780151|ref|YP_003064564.1| tRNA-specific 2-thiouridylase MnmA [Candidatus Liberibacter asiaticus str. psy62] Length = 408 Score = 23.1 bits (48), Expect = 4.8, Method: Compositional matrix adjust. Identities = 7/24 (29%), Positives = 14/24 (58%) Query: 188 DAKQISTNDNMSHYCLTFGDHLKN 211 DA+++ N+SHY + + +N Sbjct: 75 DARRVCDTINVSHYVFDYEERFRN 98 >gi|255764505|ref|YP_003065248.2| polysialic acid capsule expression protein [Candidatus Liberibacter asiaticus str. psy62] Length = 341 Score = 22.3 bits (46), Expect = 8.5, Method: Compositional matrix adjust. Identities = 10/23 (43%), Positives = 15/23 (65%) Query: 8 DDGIKSKGLITLENIARSISDDI 30 D+G K KG+IT +I R+ D+ Sbjct: 258 DEGQKLKGIITEGDIFRNFHKDL 280 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.318 0.130 0.383 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 148,279 Number of Sequences: 1233 Number of extensions: 5470 Number of successful extensions: 19 Number of sequences better than 100.0: 9 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 14 Number of HSP's gapped (non-prelim): 9 length of query: 250 length of database: 328,796 effective HSP length: 72 effective length of query: 178 effective length of database: 240,020 effective search space: 42723560 effective search space used: 42723560 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 37 (18.9 bits)