HHsearch alignment for GI: 255764490 and conserved domain: TIGR03394

>TIGR03394 indol_phenyl_DC indolepyruvate/phenylpyruvate decarboxylase, Azospirillum family. A family of closely related, thiamine pyrophosphate-dependent enzymes includes indolepyruvate decarboxylase (EC 4.1.1.74), phenylpyruvate decarboxylase (EC 4.1.1.43), pyruvate decarboxylase (EC 4.1.1.1), branched-chain alpha-ketoacid decarboxylase, etc.. Members of this group of homologs may overlap in specificity. This model represents a clade that includes a Azospirillum brasilense member active as both phenylpyruvate decarboxylase and indolepyruvate decarboxylase.
Probab=99.06  E-value=7.5e-11  Score=89.68  Aligned_cols=114  Identities=23%  Similarity=0.309  Sum_probs=78.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCHHHHHHHCCC-CCCCCCCC-----CCC
Q ss_conf             674667674325431001123344443310256654302456765443211401110221034-34444432-----321
Q gi|255764490|r  157 HGIVGAQVSLGTGIAFANKYRRSDKICVVCFGDGAANQGQVYESFNIAALWNLNVIYVIENNQ-YAMGTSVS-----RAS  230 (364)
Q Consensus       157 ~~~vg~~~p~A~G~A~a~k~~~~~~v~v~~~GDGa~~eG~f~Ealn~A~~~~lPvifvvenN~-~aist~~~-----~~~  230 (364)
T Consensus       402 ~g~mG~glpaAiGA~~a----~~~r~-v~i~GDG~f~m~~-~E-L~Tavr~~lpi~ivV~NN~~yg~ir~~q~~~~~~~l  474 (535)
T TIGR03394       402 YAGMGFGVPAGIGAQCT----SGKRI-LTLVGDGAFQMTG-WE-LGNCRRLGIDPIVILFNNASWEMLRVFQPESAFNDL  474 (535)
T ss_pred             CHHHHHHHHHHHHHHHC----CCCCE-EEEEECCHHHHHH-HH-HHHHHHHCCCCEEEEEECCCCHHHEECCCCCCCCCC
T ss_conf             11565678999899855----99956-9999471676059-99-999999399988999989942321201357777879


Q ss_pred             CCCCHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHCCCCCCCCC-CEEEEECCCC
Q ss_conf             4864357777763111121000023368875421024554546-5589831566
Q gi|255764490|r  231 AQTNFSKRGVSFNIPGMQVDGMDIRAVKATMDKAVAYCRAHKG-PIIIEMLTYR  283 (364)
Q Consensus       231 ~~~~i~~ra~~~gi~~~~vDG~D~~~v~~~~~~a~~~~r~~~g-P~lie~~tyR  283 (364)
T Consensus       475 ~~~df~~lA~a~G~~g~rV~--~~~eL~~al~~A~~----~~g~~~lIev~id~  522 (535)
T TIGR03394       475 DDWRFADMAAGMGGDGVRVR--TRAELAAALDKAFA----TRGRFQLIEAMLPR  522 (535)
T ss_pred             CCCCHHHHHHHCCCEEEEEC--CHHHHHHHHHHHHH----CCCCCEEEEEECCC
T ss_conf             99999999997799899979--89999999999984----58994899998288