RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|255764493|ref|YP_003065056.2| hypothetical protein CLIBASIA_02650 [Candidatus Liberibacter asiaticus str. psy62] (60 letters) >gnl|CDD|180092 PRK05451, PRK05451, dihydroorotase; Provisional. Length = 345 Score = 26.2 bits (59), Expect = 2.0 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 6/20 (30%) Query: 28 KLKIV------KDAIDYVLD 41 KLKIV KDA+DYV + Sbjct: 168 KLKIVFEHITTKDAVDYVRE 187 >gnl|CDD|162638 TIGR01982, UbiB, 2-polyprenylphenol 6-hydroxylase. This model represents the enzyme (UbiB) which catalyzes the first hydroxylation step in the ubiquinone biosynthetic pathway in bacteria. It is believed that the reaction is 2-polyprenylphenol -> 6-hydroxy-2-polyprenylphenol. This model finds hits primarily in the proteobacteria. The gene is also known as AarF in certain species. Length = 437 Score = 24.6 bits (54), Expect = 5.6 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 12/53 (22%) Query: 13 ADIDLL--ASRWQNS----SKKLK---IVKDAIDYV---LDTQREALNAEILK 53 ADI LL +R S++L+ +VK+ + LD +REA NA L Sbjct: 159 ADIALLYRLARIVERLSPDSRRLRPTEVVKEFEKTLRRELDLRREAANASELG 211 >gnl|CDD|179648 PRK03776, PRK03776, phosphoglycerol transferase I; Provisional. Length = 762 Score = 24.3 bits (53), Expect = 6.7 Identities = 13/39 (33%), Positives = 19/39 (48%), Gaps = 3/39 (7%) Query: 4 SSKISFSSGADIDLLASRWQNSSKKLKIVKDAIDYVLDT 42 K +F ID +R+Q + LKIV + I Y D+ Sbjct: 593 KGKTAFKDTV-ID--MARYQGNVDTLKIVDNDIRYKADS 628 >gnl|CDD|148597 pfam07083, DUF1351, Protein of unknown function (DUF1351). This family consists of several bacterial and phage proteins of around 230 residues in length. The function of this family is unknown. Length = 220 Score = 24.2 bits (53), Expect = 6.8 Identities = 11/41 (26%), Positives = 22/41 (53%) Query: 9 FSSGADIDLLASRWQNSSKKLKIVKDAIDYVLDTQREALNA 49 F D + S+W N S LK ++++ID ++ ++ + L Sbjct: 131 FEEKYDDYVKKSKWLNKSVSLKKIEESIDTLILSEAQKLEE 171 >gnl|CDD|183822 PRK12900, secA, preprotein translocase subunit SecA; Reviewed. Length = 1025 Score = 24.3 bits (53), Expect = 7.1 Identities = 11/21 (52%), Positives = 13/21 (61%) Query: 33 KDAIDYVLDTQREALNAEILK 53 KD D V T+RE NA +LK Sbjct: 570 KDMDDLVYKTRREKYNAIVLK 590 >gnl|CDD|166155 PLN02514, PLN02514, cinnamyl-alcohol dehydrogenase. Length = 357 Score = 24.4 bits (53), Expect = 7.6 Identities = 10/31 (32%), Positives = 20/31 (64%), Gaps = 4/31 (12%) Query: 12 GADIDLLASRWQNSSKKLKIVKDAIDYVLDT 42 GAD L++S + +++ D++DY++DT Sbjct: 225 GADDYLVSS----DAAEMQEAADSLDYIIDT 251 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.319 0.130 0.379 Gapped Lambda K H 0.267 0.0736 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 911,061 Number of extensions: 39263 Number of successful extensions: 132 Number of sequences better than 10.0: 1 Number of HSP's gapped: 132 Number of HSP's successfully gapped: 14 Length of query: 60 Length of database: 5,994,473 Length adjustment: 32 Effective length of query: 28 Effective length of database: 5,303,017 Effective search space: 148484476 Effective search space used: 148484476 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.0 bits)