RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|255764493|ref|YP_003065056.2| hypothetical protein CLIBASIA_02650 [Candidatus Liberibacter asiaticus str. psy62] (60 letters) >3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Length = 293 Score = 30.6 bits (68), Expect = 0.098 Identities = 11/41 (26%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Query: 18 LASRWQNSSKKLKIVKDAIDYVLDTQREALNAEILKFWKRV 58 +A N + + DA + EA+N +LKF+ V Sbjct: 253 VADALPNG--RYLQIPDAGHLGFFERPEAVNTAMLKFFASV 291 >3fo3_A Eight-heme nitrite reductase; alpha protein, eight hemes C, oxidoreductase; HET: HEC PG6 PG4; 1.40A {Thioalkalivibrio nitratireducens} PDB: 3d1i_A* 3f29_A* 2zo5_A* 3gm6_A* 2ot4_A* Length = 525 Score = 27.4 bits (59), Expect = 0.73 Identities = 4/31 (12%), Positives = 14/31 (45%), Gaps = 3/31 (9%) Query: 24 NSSKKLKIVKDAIDYVLDTQ---REALNAEI 51 N + + + +I + +A++A++ Sbjct: 492 NPDQARESLMTSISKSKEAVSLLNDAIDAQV 522 >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 27.6 bits (61), Expect = 0.80 Identities = 12/57 (21%), Positives = 23/57 (40%), Gaps = 13/57 (22%) Query: 2 FDSSKISFSSGADIDLLASRWQNSS-----KKLKIVKDAIDYVLDTQREALNAEILK 53 F++ + G DI LA++ + K +++K +Y+ T R K Sbjct: 91 FENC---YLEGNDIHALAAKLLQENDTTLVKTKELIK---NYI--TARIMAKRPFDK 139 >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding, early protein; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Length = 305 Score = 26.7 bits (59), Expect = 1.4 Identities = 11/42 (26%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Query: 1 MFDSSKISFSSG--ADIDLLASRWQNSSKKLKIVKDAIDYVL 40 + SKI++ A D A + ++ + K VKD V Sbjct: 25 YAEESKIAYEYALAAGSDSNARAFLATNSQAKHVKDCATMVR 66 >3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Length = 624 Score = 26.4 bits (57), Expect = 1.7 Identities = 12/39 (30%), Positives = 22/39 (56%), Gaps = 3/39 (7%) Query: 19 ASRWQNS---SKKLKIVKDAIDYVLDTQREALNAEILKF 54 +RW+ S KK + KDA+ Y +++ L E+L++ Sbjct: 467 NNRWKQSVELCKKDSLYKDAMQYASESKDTELAEELLQW 505 >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis/exocytosis complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A Length = 1630 Score = 26.2 bits (58), Expect = 1.7 Identities = 12/38 (31%), Positives = 22/38 (57%), Gaps = 3/38 (7%) Query: 20 SRWQNS---SKKLKIVKDAIDYVLDTQREALNAEILKF 54 +RW+ S KK + KDA+ Y +++ L E+L++ Sbjct: 1519 NRWKQSVELCKKDSLYKDAMQYASESKDTELAEELLQW 1556 >2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Length = 725 Score = 25.1 bits (54), Expect = 4.1 Identities = 10/34 (29%), Positives = 15/34 (44%) Query: 8 SFSSGADIDLLASRWQNSSKKLKIVKDAIDYVLD 41 FS G DI + + K+ K +ID + D Sbjct: 63 RFSGGFDISGFGEMQKGNVKEPKAGYISIDIITD 96 >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Length = 377 Score = 24.2 bits (52), Expect = 7.4 Identities = 8/33 (24%), Positives = 15/33 (45%) Query: 13 ADIDLLASRWQNSSKKLKIVKDAIDYVLDTQRE 45 A+ + +S + I + A+D VL +R Sbjct: 68 EKHYANAAIFADSKNQKTICQQAVDTVLAKKRV 100 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.319 0.130 0.379 Gapped Lambda K H 0.267 0.0469 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 505,965 Number of extensions: 15847 Number of successful extensions: 79 Number of sequences better than 10.0: 1 Number of HSP's gapped: 79 Number of HSP's successfully gapped: 14 Length of query: 60 Length of database: 5,693,230 Length adjustment: 31 Effective length of query: 29 Effective length of database: 4,941,666 Effective search space: 143308314 Effective search space used: 143308314 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.7 bits)