RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|255764493|ref|YP_003065056.2| hypothetical protein CLIBASIA_02650 [Candidatus Liberibacter asiaticus str. psy62] (60 letters) >d2qxfa1 c.55.3.5 (A:8-474) Exonuclease I {Escherichia coli K12 (Escherichia coli K-12) [TaxId: 83333]} Length = 467 Score = 23.8 bits (50), Expect = 4.4 Identities = 4/27 (14%), Positives = 14/27 (51%) Query: 13 ADIDLLASRWQNSSKKLKIVKDAIDYV 39 ++ +L ++ + +K+ ++K Y Sbjct: 438 DELQMLVQQYADDKEKVALLKALWQYA 464 >d1hx6a2 b.121.2.1 (A:245-384) Coat protein p3 {Bacteriophage prd1 [TaxId: 10658]} Length = 140 Score = 22.8 bits (48), Expect = 7.6 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 3/44 (6%) Query: 1 MFDSSKISFSSGADIDLLASRWQNSSKKLKIVKDAIDYVLDTQR 44 +FD+ SF++G DI+ L+ R N S K+ D + T+R Sbjct: 46 VFDNGG-SFNAGTDINYLSQRTANFSDTRKL--DPKTWAAQTRR 86 >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 Score = 22.7 bits (48), Expect = 9.4 Identities = 8/32 (25%), Positives = 15/32 (46%) Query: 13 ADIDLLASRWQNSSKKLKIVKDAIDYVLDTQR 44 A+ + +S + I + A+D VL +R Sbjct: 53 EKHYANAAIFADSKNQKTICQQAVDTVLAKKR 84 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.319 0.130 0.379 Gapped Lambda K H 0.267 0.0603 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 219,876 Number of extensions: 6865 Number of successful extensions: 33 Number of sequences better than 10.0: 1 Number of HSP's gapped: 33 Number of HSP's successfully gapped: 9 Length of query: 60 Length of database: 2,407,596 Length adjustment: 30 Effective length of query: 30 Effective length of database: 1,995,696 Effective search space: 59870880 Effective search space used: 59870880 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.2 bits)