RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|255764495|ref|YP_003065022.2| putative phosphoesterase protein [Candidatus Liberibacter asiaticus str. psy62] (309 letters) >gnl|CDD|161962 TIGR00619, sbcd, exonuclease SbcD. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). Length = 253 Score = 33.6 bits (77), Expect = 0.068 Identities = 24/96 (25%), Positives = 43/96 (44%), Gaps = 14/96 (14%) Query: 33 RIIGLVNWH----FNRKKYFSKEVANL-LINDILL-HNVDHVSITGDIVNFTCN-----R 81 RI+ +WH +++ A L + + +D + + GD+ + T N + Sbjct: 2 RILHTSDWHLGKTLEGVSRLAEQKAFLDDLLEFAKAEQIDALLVAGDVFD-TANPPAEAQ 60 Query: 82 EIFTSTHWLRSIGNPHDISIVPGNHD--AYISGAKE 115 E+F + S NP I ++ GNHD +S AK+ Sbjct: 61 ELFNAFFRNLSDANPIPIVVISGNHDSAQRLSAAKK 96 >gnl|CDD|179722 PRK04036, PRK04036, DNA polymerase II small subunit; Validated. Length = 504 Score = 28.8 bits (65), Expect = 1.7 Identities = 10/15 (66%), Positives = 11/15 (73%), Gaps = 2/15 (13%) Query: 96 PHDISIV--PGNHDA 108 P DI I+ PGNHDA Sbjct: 328 PEDIKIIISPGNHDA 342 >gnl|CDD|129135 TIGR00024, SbcD_rel_arch, putative phosphoesterase, SbcD/Mre11-related. Members of this uncharacterized family share a motif approximating DXH(X25)GDXXD(X25)GNHD as found in several phosphoesterases, including the nucleases SbcD and Mre11. SbcD is a subunit of the SbcCD nuclease of E. coli that can cleave DNA hairpins to unblock stalled DNA replication. All members of this family are archaeal. Length = 225 Score = 28.7 bits (64), Expect = 1.8 Identities = 23/105 (21%), Positives = 33/105 (31%), Gaps = 20/105 (19%) Query: 13 AHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITG 72 A I+D+HL G H + + I + L D I Sbjct: 18 AVIADLHL---------------GFER-HLDEQGVMVPGFQFREIIERALSIADKYGIEA 61 Query: 73 DIVNFTCNREIFTSTHW--LRSIG--NPHDISIVPGNHDAYISGA 113 I+N E W +R D+ ++ GNHDA I Sbjct: 62 LIINGDLKHEFKKGLEWRFIREFIEVTFRDLILIRGNHDALIPYI 106 >gnl|CDD|150300 pfam09587, PGA_cap, Bacterial capsule synthesis protein PGA_cap. This protein is a putative poly-gamma-glutamate capsule biosynthesis protein found in bacteria. Poly-gamma-glutamate is a natural polymer that may be involved in virulence and may help bacteria survive in high salt concentrations. It is a surface-associated protein. Length = 237 Score = 28.7 bits (65), Expect = 2.1 Identities = 16/91 (17%), Positives = 27/91 (29%), Gaps = 13/91 (14%) Query: 147 IALIGCSTAIATPPFSANGYFGQEQAHAT-SKLLRKANKKGFFRIIMMHHPPVLDTSSLY 205 IA + + +R+A KK I+ +H Sbjct: 131 IAFLAYTYGTNGWGAGPYRPGVNPLDEEKIKADIRRAKKKADIVIVSLHWG--------V 182 Query: 206 NRMFGIQRFQKMIWHE----GADLILHGHTH 232 + Q+ + H GADL++ H H Sbjct: 183 EYQYEPTPEQRELAHALIDAGADLVIGHHPH 213 >gnl|CDD|132655 TIGR03616, RutG, pyrimidine utilization transport protein G. This protein is observed in operons extremely similar to that characterized in E. coli K-12 responsible for the import and catabolism of pyrimidines, primarily uracil. This protein is a member of the uracil-xanthine permease family defined by TIGR00801. As well as the The Nucleobase:Cation Symporter-2 (NCS2) Family (TC 2.A.40). Length = 429 Score = 28.7 bits (64), Expect = 2.1 Identities = 12/26 (46%), Positives = 18/26 (69%) Query: 1 MTKRYTTIMFVLAHISDIHLSYSPSF 26 +TK Y+T++FV A + I L +SP F Sbjct: 316 VTKVYSTLVFVAAAVFAILLGFSPKF 341 >gnl|CDD|163441 TIGR03729, acc_ester, putative phosphoesterase. Members of this protein family belong to the larger family pfam00149 (calcineurin-like phosphoesterase), a family largely defined by small motifs of metal-chelating residues. The subfamily in this model shows a good but imperfect co-occurrence in species with domain TIGR03715 that defines a novel class of signal peptide typical of the accessory secretory system. Length = 239 Score = 28.0 bits (63), Expect = 2.9 Identities = 16/70 (22%), Positives = 29/70 (41%), Gaps = 9/70 (12%) Query: 41 HFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTH-WLRSIGNPHDI 99 H + + ++E+ L + +DH+ I GDI N F + ++ + I Sbjct: 9 HIDLNHFDTEEMLETLAQYLKKQKIDHLHIAGDISND------FQRSLPFIEKLQELKGI 62 Query: 100 SI--VPGNHD 107 + GNHD Sbjct: 63 KVTFNAGNHD 72 >gnl|CDD|162562 TIGR01854, lipid_A_lpxH, UDP-2,3-diacylglucosamine hydrolase. This model represents LpxH, UDP-2,3-diacylglucosamine hydrolase, and essential enzyme in E. coli that catalyzes the fourth step in lipid A biosynthesis. Note that Pseudomonas aeruginosa has both a member of this family that shares this function and a more distant homolog, designated LpxH2, that does not. Many species that produce lipid A lack an lpxH gene in this family; some of those species have an lpxH2 gene instead, although for which the function is unknown. Length = 231 Score = 27.8 bits (62), Expect = 3.3 Identities = 8/16 (50%), Positives = 12/16 (75%) Query: 222 GADLILHGHTHLNSLH 237 G D ++HGHTH ++H Sbjct: 185 GVDRLIHGHTHRPAIH 200 >gnl|CDD|181804 PRK09369, PRK09369, UDP-N-acetylglucosamine 1-carboxyvinyltransferase; Validated. Length = 417 Score = 27.7 bits (63), Expect = 3.8 Identities = 9/26 (34%), Positives = 13/26 (50%), Gaps = 4/26 (15%) Query: 206 NRMFGIQRFQKMIWHEGADLILHGHT 231 NR + +M GAD+ + GHT Sbjct: 331 NRFMHVPELIRM----GADIEVDGHT 352 >gnl|CDD|165113 PHA02746, PHA02746, protein tyrosine phosphatase; Provisional. Length = 323 Score = 26.9 bits (59), Expect = 6.3 Identities = 17/93 (18%), Positives = 33/93 (35%), Gaps = 7/93 (7%) Query: 176 SKLLRKANKKGFFRIIMMHHPPVLD-------TSSLYNRMFGIQRFQKMIWHEGADLILH 228 K N F +++ H V+D L RF + + + ++++ Sbjct: 12 FDFFDKTNHAKFCEFVLLEHAEVMDIPIRGTTNHFLKKENLKKNRFHDIPCWDHSRVVIN 71 Query: 229 GHTHLNSLHWIKNEKKLIPVVGIASASQKVHSN 261 H L ++ K I V +A +H+N Sbjct: 72 AHESLKMFDVGDSDGKKIEVTSEDNAENYIHAN 104 >gnl|CDD|180394 PRK06090, PRK06090, DNA polymerase III subunit delta'; Validated. Length = 319 Score = 27.1 bits (60), Expect = 6.7 Identities = 15/40 (37%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Query: 236 LHWIKNEK--KLIPVVGIASASQKVHSNKPQASYNLFYIE 273 LH IK EK K I V I ++ + Y LF IE Sbjct: 76 LHVIKPEKEGKSITVEQIRQCNRLAQESSQLNGYRLFVIE 115 >gnl|CDD|184406 PRK13933, PRK13933, stationary phase survival protein SurE; Provisional. Length = 253 Score = 26.6 bits (59), Expect = 8.4 Identities = 9/38 (23%), Positives = 18/38 (47%), Gaps = 3/38 (7%) Query: 267 YNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFY 304 +N ++ E+ +E K Y L D + +D++Y Sbjct: 189 FNTYFSEEIDEE---GNKVYKLEGDINKDIYEGTDVYY 223 >gnl|CDD|182645 PRK10682, PRK10682, putrescine transporter subunit: periplasmic-binding component of ABC superfamily; Provisional. Length = 370 Score = 26.4 bits (58), Expect = 8.9 Identities = 10/20 (50%), Positives = 13/20 (65%), Gaps = 2/20 (10%) Query: 112 GAKEKSLHA--WKDYITSDT 129 A++K+LH W DYI DT Sbjct: 26 AAEQKTLHIYNWSDYIAPDT 45 >gnl|CDD|180027 PRK05340, PRK05340, UDP-2,3-diacylglucosamine hydrolase; Provisional. Length = 241 Score = 26.3 bits (59), Expect = 9.5 Identities = 7/11 (63%), Positives = 9/11 (81%) Query: 222 GADLILHGHTH 232 G D ++HGHTH Sbjct: 187 GVDTLIHGHTH 197 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.322 0.136 0.421 Gapped Lambda K H 0.267 0.0731 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 5,096,625 Number of extensions: 317978 Number of successful extensions: 562 Number of sequences better than 10.0: 1 Number of HSP's gapped: 562 Number of HSP's successfully gapped: 19 Length of query: 309 Length of database: 5,994,473 Length adjustment: 93 Effective length of query: 216 Effective length of database: 3,984,929 Effective search space: 860744664 Effective search space used: 860744664 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 57 (25.7 bits)