>TIGR00593 pola DNA polymerase I; InterPro: IPR002298 DNA carries the biological information that instructs cells how to exist in an ordered fashion. Accurate replication is thus one of the most important events in the cell life cycle. This function is mediated by DNA-directed DNA polymerases, which add nucleotide triphosphate (dNTP) residues to the 5'-end of the growing DNA chain, using a complementary DNA as template. Small RNA molecules are generally used as primers for chain elongation, although terminal proteins may also be used. DNA-dependent DNA polymerases have been grouped into families, denoted A, B and X, on the basis of sequence similarities , . Members of family A, which includes bacterial and bacteriophage polymerases, share significant similarity to Escherichia coli polymerase I; hence family A is also known as the pol I family. The bacterial polymerases also contain an exonuclease activity, which is coded for in the N-terminal portion. Three motifs, A, B and C , are seen to be conserved across all DNA polymerases, with motifs A and C also seen in RNA polymerases. They are centred on invariant residues, and their structural significance was implied from the Klenow (E. coli) structure. Motif A contains a strictly-conserved aspartate at the junction of a beta-strand and an alpha-helix; motif B contains an alpha-helix with positive charges; and motif C has a doublet of negative charges, located in a beta-turn-beta secondary structure .; GO: 0003677 DNA binding, 0003887 DNA-directed DNA polymerase activity, 0006260 DNA replication.

Probab=96.94 E-value=0.00049 Score=48.62 Aligned_cols=118 Identities=21% Similarity=0.309 Sum_probs=68.4 Q ss_pred HHHHHHHHHHHHHCCC----------CCCCCEEEEECCCCCCCCCEEEE-CCCCCEEEECCC-CHHHHHH---------- Q ss_conf 5899999999997588----------77871899971877676634898-179834885799-8999999---------- Q gi|255764496|r 473 KGQLSAAQGVLKKLNV----------ENRITIISIAKGPKRSAGMEKFF-VKKGEALVLNMR-DPILYFI---------- 530 (616) Q Consensus 473 kgQln~a~~vl~~l~i----------~~~i~viglaK~~~r~~~~e~~~-~~~~~~i~l~~~-~~~l~~L---------- 530 (616) T Consensus 86 ~~Qi~~i~e~l~algi~~~e~~GYEADD-~-IaTLA~~a~~-~G~~V~I~sgDrD~lQLvs~e~V~V~~~~~~~g~~~~~ 162 (1005) T TIGR00593 86 IEQIPLIKELLEALGIPILEVEGYEADD-V-IATLAKQAEK-EGYEVRIISGDRDLLQLVSDENVKVLIPERKKGKTEFT 162 (1005) T ss_pred HHHHHHHHHHHHHCCCEEEECCCCCHHH-H-HHHHHHHHHH-CCCEEEEEECCCCCCCCCCCCCEEEEECCCCCCCCCCE T ss_conf 8768999999997198188228871012-8-9998887754-68548998378462112178614886435456754310 Q ss_pred -HHHHHHHHHHHHHHHHHHHHHHC---CC-CHHCCCCCCHHHHHHHHHHHCCHHHHHHCC-------HHHHHHCC Q ss_conf -98878778878898998643214---77-100488879899999999808889899389-------88886278 Q gi|255764496|r 531 -QRLRDEAHRFAITTHRKRRKKAA---YS-PLDEINGIGPLRKRLLLQSFGTVKMISRSS-------PETLASIE 593 (616) Q Consensus 531 -q~iRDEaHRFAi~~hRk~r~k~~---~S-~Ld~I~GIG~k~~~~Ll~~Fgs~~~i~~As-------~eeL~~v~ 593 (616) T Consensus 163 ~~t~e~V~eKyGv~P~Q~~D~~AL~GD~SDNiPGV~GIGeKTA~kLL~~fgsLe~iy~~~ylkealr~~~~~~~k 237 (1005) T TIGR00593 163 EITPEYVVEKYGVTPSQLVDLKALVGDSSDNIPGVKGIGEKTAAKLLQEFGSLENIYENTYLKEALRLDNLDQIK 237 (1005) T ss_pred ECCHHHHHHHCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC T ss_conf 117789875418674578876204688887859989737656899998721089999887788887477586228

HHsearch alignment for GI: 255764496 and conserved domain: TIGR00593