>cd01703 Pol_iota Pol iota is member of the DNA polymerase Y-family, and has also been called Rad30 homolog B. Unlike classic DNA polymerases,Y-family polymerases are induced by DNA damage. They can transverse normal replication-blocking DNA lesions. Unlike Pol eta, Pol iota is unable to replicate through a cis-syn T-T dimer. In human Pol iota, the base-pairing mode in the active site at the replicative end mat bee Hoogsteen instead of Watson-Click. Human Pol iota can incorporate the correct nucleotide opposite a purine much more efficiently than opposite a pyrimidine. Pol iota prefers to insert Guanosine instead of Adenosine opposite Thymidine.

Probab=93.45 E-value=0.19 Score=29.94 Aligned_cols=54 Identities=26% Similarity=0.193 Sum_probs=20.6 Q ss_pred HHCCCCCCHHHHHHHHHHHC-CHHHHHHCC-HHHHHHCCCCCHHHHHHHHHHHCCCCC Q ss_conf 00488879899999999808-889899389-888862789998999999998547867 Q gi|255764496|r 557 LDEINGIGPLRKRLLLQSFG-TVKMISRSS-PETLASIEGISKKIACKIYNHFHKNTS 612 (616) Q Consensus 557 Ld~I~GIG~k~~~~Ll~~Fg-s~~~i~~As-~eeL~~v~gi~~~~A~~I~~~l~~~~~ 612 (616) T Consensus 212 i~ki~GIG~kt~~~L~~~gi~ti~dl~~~~~~~~l~~~f--G~~~g~~l~~~a~GiD~ 267 (394) T cd01703 212 LRKIPGIGYKTAKKLEDHGISSVRDLQECSELLLLEKGF--GKGIAQRIWGLAHGRDD 267 (394) T ss_pred HHHHCCCCHHHHHHHHHCCCEEHHHHHCCCHHHHHHHHH--HHHHHHHHHHHHCCCCC T ss_conf 055278179999999983892679876588799999987--88999999999569789

HHsearch alignment for GI: 255764496 and conserved domain: cd01703