RPSBLAST alignment of GI: 255764496 and protein with PDBid: 2nrr

>2nrr_A Uvrabc system protein C; UVRC, endonuclase, NER, hydrolase; 1.20A {Thermotoga maritima} Length = 159
 Score =  122 bits (308), Expect = 2e-28
 Identities = 52/186 (27%), Positives = 87/186 (46%), Gaps = 31/186 (16%)

Query: 366 LKDFTKKFALPHIPKRIEIYDNSHIMGCSAVGCMVVVGENGFVKNQYRKFNLHPNDVKTQ 425
           L++  K   +   P RIE  D SH+ G   V  +VV  +    K  YR++ +  +     
Sbjct: 4   LEELMKLLNMKDFPYRIEGIDISHLQGKYTVASLVVFEDGFPKKGDYRRYKIEQD---HP 60

Query: 426 DDCAMMRMVLERRFSQLIKNEENLNFHPKKQEYSFPSWPDVVILDGGKGQLSAAQGVLKK 485
           DD   +R V++RR                   YS    P+++ +DGG GQ++AA   LK+
Sbjct: 61  DDYESIRTVVKRR-------------------YSKHPLPNLLFVDGGIGQVNAAIEALKE 101

Query: 486 LNVENRITIISIAKGPKRSAGMEKFFVKKGEALVLNMRDPILYFIQRLRDEAHRFAITTH 545
           +  +  +  ++           E+  V +   + L    P+L  + ++RDE HRFA++ H
Sbjct: 102 IGKDCPVVGLA---------KKEETVVFENREIHLPHDHPVLRLLVQIRDETHRFAVSYH 152

Query: 546 RKRRKK 551
           RKRR+K
Sbjct: 153 RKRREK 158