RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|255764500|ref|YP_003064987.2| hypothetical protein CLIBASIA_02305 [Candidatus Liberibacter asiaticus str. psy62] (200 letters) >gnl|CDD|38822 KOG3616, KOG3616, KOG3616, Selective LIM binding factor [Transcription]. Length = 1636 Score = 26.3 bits (57), Expect = 5.9 Identities = 30/145 (20%), Positives = 51/145 (35%), Gaps = 16/145 (11%) Query: 48 NDGEPRKPTPLDHSDSQHPPVLPNSENNAHGDEPIKKSEKPTFRRNQP------VIEN-- 99 ND + H + VL A + K+E R N+P IE Sbjct: 1061 NDWAAAERVAEAHCEDLLADVLTGQARGAIEEGDFLKAEGFLLRANKPDIALNYFIEAEL 1120 Query: 100 ----LRKPTEAEKEKILAARDRYQKT---NNEEAIASIIWHRYQHMDYKGKTEQEKRALA 152 LR + + A ++ Y+K + + + + + G + AL Sbjct: 1121 WPDALRIAKDYLPHQAAAIQEEYEKEALKKGARGVDGFV-AQAKEWEQAGDWRKAVDALL 1179 Query: 153 KQSRDDFQRYATAQAANQKAADMLM 177 K +RD A A+ +KAAD+ + Sbjct: 1180 KINRDSTDNDALAEHCTEKAADLSI 1204 >gnl|CDD|176200 cd08238, sorbose_phosphate_red, L-sorbose-1-phosphate reductase. L-sorbose-1-phosphate reductase, a member of the MDR family, catalyzes the NADPH-dependent conversion of l-sorbose 1-phosphate to d-glucitol 6-phosphate in the metabolism of L-sorbose to (also converts d-fructose 1-phosphate to d-mannitol 6-phosphate). The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of an beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. Length = 410 Score = 26.2 bits (58), Expect = 6.1 Identities = 10/34 (29%), Positives = 13/34 (38%) Query: 167 AANQKAADMLMLATYGLQYDDSLTKIQDPPKMEE 200 A LM T G +DD + P +EE Sbjct: 240 ATIDDLHATLMELTGGQGFDDVFVFVPVPELVEE 273 >gnl|CDD|176081 cd08531, SAM_PNT-ERG_FLI-1, Sterile alpha motif (SAM)/Pointed domain of ERG (Ets related gene) and FLI-1 (Friend leukemia integration 1) transcription factors. SAM Pointed domain of ERG/FLI-1 subfamily of ETS transcriptional regulators is a putative protein-protein interaction domain. The ERG and FLI regulators are involved in endothelial cell differentiation, bone morphogenesis and neural crest development. They are proto-oncogenes implicated in cancer development such as myeloid leukemia, Ewing's sarcoma and erythroleukemia. Members of this subfamily are potential targets for cancer therapy. Length = 75 Score = 25.7 bits (57), Expect = 8.9 Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 13/45 (28%) Query: 133 HRYQHMDYKGKTEQEKRALAKQSRDDFQRYATAQAANQKAADMLM 177 R+Q++D GK L K +++DF R +A AD+L+ Sbjct: 32 SRFQNID--GK------ELCKMTKEDFLRLTSA-----YNADVLL 63 >gnl|CDD|35679 KOG0458, KOG0458, KOG0458, Elongation factor 1 alpha [Translation, ribosomal structure and biogenesis]. Length = 603 Score = 25.7 bits (56), Expect = 9.2 Identities = 18/105 (17%), Positives = 30/105 (28%), Gaps = 5/105 (4%) Query: 30 DHSDSQHPPVIPILKDDKNDGEPRKPTPLDHSDSQHPPVLPNSENNAHGDEP---IKKSE 86 D +S+ P +D N K S S H S + P K+ E Sbjct: 29 DEENSEDPSSSTNDDNDTNFPVLEKQHTDKLSLSYHELKKSPSSFPSTQQSPSKTEKEKE 88 Query: 87 KPTFRR--NQPVIENLRKPTEAEKEKILAARDRYQKTNNEEAIAS 129 ++ +P+ E + K + E+ A Sbjct: 89 TEPKKKKPKKPIKEANASAKVPQTSSNSNIPKHTPKVSLEQFNAP 133 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.311 0.129 0.370 Gapped Lambda K H 0.267 0.0643 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,412,951 Number of extensions: 118240 Number of successful extensions: 278 Number of sequences better than 10.0: 1 Number of HSP's gapped: 278 Number of HSP's successfully gapped: 20 Length of query: 200 Length of database: 6,263,737 Length adjustment: 89 Effective length of query: 111 Effective length of database: 4,340,536 Effective search space: 481799496 Effective search space used: 481799496 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 55 (25.1 bits)