RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|255764500|ref|YP_003064987.2| hypothetical protein CLIBASIA_02305 [Candidatus Liberibacter asiaticus str. psy62] (200 letters) >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Score = 26.6 bits (57), Expect = 1.4 Identities = 8/34 (23%), Positives = 14/34 (41%) Query: 97 IENLRKPTEAEKEKILAARDRYQKTNNEEAIASI 130 ++ LR+ E K +I AR + +I Sbjct: 4 LDQLRQEAEQLKNQIRDARKACADATLSQITNNI 37 >d2nrka1 d.218.1.14 (A:4-170) Hypothetical protein GrpB {Enterococcus faecalis [TaxId: 1351]} Length = 167 Score = 26.5 bits (58), Expect = 1.7 Identities = 11/53 (20%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Query: 118 YQKTNNEEAIASIIWHRY--QHMDYKGKTEQEKRALAKQSRDDFQRYATAQAA 168 YQ N +E + + + Y ++ K+ LA+ D +Y + A Sbjct: 100 YQFDNTQEILRHLAFRNYLRENPAIATTYGTLKKQLAQAHPDSIDKYMDGKDA 152 >d5mdha2 d.162.1.1 (A:155-333) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Length = 179 Score = 23.9 bits (51), Expect = 8.5 Identities = 12/57 (21%), Positives = 20/57 (35%), Gaps = 6/57 (10%) Query: 11 KKLGI--VSVLIPVVLGVSNCDHSDSQHPPVIPILKDDKNDGEPRKPTPLDHSDSQH 65 KLG+ V ++ G +HS +Q+P V + D S + Sbjct: 14 LKLGVTSDDVKNVIIWG----NHSSTQYPDVNHAKVKLQAKEVGVYEAVKDDSWLKG 66 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.311 0.129 0.370 Gapped Lambda K H 0.267 0.0517 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 718,911 Number of extensions: 31049 Number of successful extensions: 55 Number of sequences better than 10.0: 1 Number of HSP's gapped: 55 Number of HSP's successfully gapped: 5 Length of query: 200 Length of database: 2,407,596 Length adjustment: 81 Effective length of query: 119 Effective length of database: 1,295,466 Effective search space: 154160454 Effective search space used: 154160454 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 51 (23.9 bits)