BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|255764500|ref|YP_003064987.2| hypothetical protein CLIBASIA_02305 [Candidatus Liberibacter asiaticus str. psy62] (200 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|255764500|ref|YP_003064987.2| hypothetical protein CLIBASIA_02305 [Candidatus Liberibacter asiaticus str. psy62] Length = 200 Score = 414 bits (1065), Expect = e-118, Method: Compositional matrix adjust. Identities = 200/200 (100%), Positives = 200/200 (100%) Query: 1 MPLSGYSVSIKKLGIVSVLIPVVLGVSNCDHSDSQHPPVIPILKDDKNDGEPRKPTPLDH 60 MPLSGYSVSIKKLGIVSVLIPVVLGVSNCDHSDSQHPPVIPILKDDKNDGEPRKPTPLDH Sbjct: 1 MPLSGYSVSIKKLGIVSVLIPVVLGVSNCDHSDSQHPPVIPILKDDKNDGEPRKPTPLDH 60 Query: 61 SDSQHPPVLPNSENNAHGDEPIKKSEKPTFRRNQPVIENLRKPTEAEKEKILAARDRYQK 120 SDSQHPPVLPNSENNAHGDEPIKKSEKPTFRRNQPVIENLRKPTEAEKEKILAARDRYQK Sbjct: 61 SDSQHPPVLPNSENNAHGDEPIKKSEKPTFRRNQPVIENLRKPTEAEKEKILAARDRYQK 120 Query: 121 TNNEEAIASIIWHRYQHMDYKGKTEQEKRALAKQSRDDFQRYATAQAANQKAADMLMLAT 180 TNNEEAIASIIWHRYQHMDYKGKTEQEKRALAKQSRDDFQRYATAQAANQKAADMLMLAT Sbjct: 121 TNNEEAIASIIWHRYQHMDYKGKTEQEKRALAKQSRDDFQRYATAQAANQKAADMLMLAT 180 Query: 181 YGLQYDDSLTKIQDPPKMEE 200 YGLQYDDSLTKIQDPPKMEE Sbjct: 181 YGLQYDDSLTKIQDPPKMEE 200 >gi|254781010|ref|YP_003065423.1| hypothetical protein CLIBASIA_04560 [Candidatus Liberibacter asiaticus str. psy62] Length = 195 Score = 28.5 bits (62), Expect = 0.084, Method: Compositional matrix adjust. Identities = 12/24 (50%), Positives = 16/24 (66%) Query: 11 KKLGIVSVLIPVVLGVSNCDHSDS 34 K + IVS L+ VL +S+CD DS Sbjct: 4 KNILIVSTLVICVLSISSCDLGDS 27 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.311 0.129 0.370 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 132,731 Number of Sequences: 1233 Number of extensions: 5402 Number of successful extensions: 14 Number of sequences better than 100.0: 3 Number of HSP's better than 100.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 9 Number of HSP's gapped (non-prelim): 3 length of query: 200 length of database: 328,796 effective HSP length: 70 effective length of query: 130 effective length of database: 242,486 effective search space: 31523180 effective search space used: 31523180 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 36 (18.5 bits)