RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|255764502|ref|YP_003064963.2| hypothetical protein CLIBASIA_02185 [Candidatus Liberibacter asiaticus str. psy62] (100 letters) >gnl|CDD|31189 COG0848, ExbD, Biopolymer transport protein [Intracellular trafficking and secretion]. Length = 137 Score = 28.3 bits (63), Expect = 0.53 Identities = 20/79 (25%), Positives = 35/79 (44%), Gaps = 6/79 (7%) Query: 28 GRMNSELQSTSLVGLVLVLFIILIGTVMVLIPKAEFIL------GLDIKRYPIMIDVKRD 81 SE+ T L+ ++LVL II + T + + L + PI++ V D Sbjct: 10 DEEKSEINVTPLIDVMLVLLIIFMVTAPFITQSIKVDLPKASAKPAPQDKKPIIVSVDAD 69 Query: 82 GEIRVQGQQVLLNEITKKI 100 G+I + + V L E+ + Sbjct: 70 GQIYLNDKPVSLEELEAAL 88 >gnl|CDD|145552 pfam02472, ExbD, Biopolymer transport protein ExbD/TolR. This group of proteins are membrane bound transport proteins essential for ferric ion uptake in bacteria. The Pfam family consists of ExbD, and TolR which are involved in TonB-dependent transport of various receptor bound substrates including colicins. Length = 128 Score = 28.0 bits (63), Expect = 0.58 Identities = 17/81 (20%), Positives = 34/81 (41%), Gaps = 7/81 (8%) Query: 27 DGRMNSELQSTSLVGLVLVLFII-LIGTVMVLIPKAEFIL------GLDIKRYPIMIDVK 79 E+ T L+ +V +L I ++ + + L ++ ++I V Sbjct: 1 RKEEEPEINLTPLIDVVFLLLIFFMVTATFIKESVLKVELPSASSTAPVEEKEELIISVD 60 Query: 80 RDGEIRVQGQQVLLNEITKKI 100 DG+I + G+ V L E+ K+ Sbjct: 61 ADGKIYLDGEPVDLEELEAKL 81 >gnl|CDD|153329 cd07645, I-BAR_IMD_BAIAP2L1, Inverse (I)-BAR, also known as the IRSp53/MIM homology Domain (IMD), of Brain-specific Angiogenesis Inhibitor 1-Associated Protein 2-Like 1. The IMD domain, also called Inverse-Bin/Amphiphysin/Rvs (I-BAR) domain, is a dimerization and lipid-binding module that bends membranes and induces membrane protrusions. BAIAP2L1 (Brain-specific Angiogenesis Inhibitor 1-Associated Protein 2-Like 1) is also known as IRTKS (Insulin Receptor Tyrosine Kinase Substrate). It is widely expressed, serves as a substrate for the insulin receptor, and binds the small GTPase Rac. It plays a role in regulating the actin cytoskeleton and colocalizes with F-actin, cortactin, VASP, and vinculin. BAIAP2L1 expression leads to the formation of short actin bundles, distinct from filopodia-like protrusions induced by the expression of the related protein IRSp53. It contains an N-terminal IMD, an SH3 domain, and a WASP homology 2 (WH2) actin-binding motif at the C-terminus. The IMD domain of BAIAP2L1 binds and bundles actin filaments, and binds the small GTPase Rac. Length = 226 Score = 26.4 bits (58), Expect = 1.7 Identities = 11/34 (32%), Positives = 22/34 (64%) Query: 5 RSQEGIRKIRSRSKGNRNLTILDGRMNSELQSTS 38 +SQ ++KIR +S+G RN + + + N L++ + Sbjct: 130 KSQADLKKIRRKSQGRRNASKYEHKENEYLETVT 163 >gnl|CDD|30039 cd01296, Imidazolone-5PH, Imidazolonepropionase/imidazolone-5-propionate hydrolase (Imidazolone-5PH) catalyzes the third step in the histidine degradation pathway, the hydrolysis of (S)-3-(5-oxo-4,5-dihydro-3H-imidazol-4-yl)propanoate to N-formimidoyl-L-glutamate. In bacteria, the enzyme is part of histidine utilization (hut) operon.. Length = 371 Score = 25.6 bits (56), Expect = 2.8 Identities = 10/26 (38%), Positives = 12/26 (46%) Query: 52 GTVMVLIPKAEFILGLDIKRYPIMID 77 GTV VL+P F L +ID Sbjct: 251 GTVAVLLPGTAFSLRETYPPARKLID 276 >gnl|CDD|37144 KOG1933, KOG1933, KOG1933, Cholesterol transport protein (Niemann-Pick C disease protein) [Lipid transport and metabolism]. Length = 1201 Score = 24.9 bits (54), Expect = 4.5 Identities = 11/48 (22%), Positives = 19/48 (39%) Query: 21 RNLTILDGRMNSELQSTSLVGLVLVLFIILIGTVMVLIPKAEFILGLD 68 + L + G + L VG L I ++ +IP +G+D Sbjct: 581 KVLLGISGVLIVLLSVVCSVGFFSYLGITSTLIIIEVIPFLVLAVGVD 628 >gnl|CDD|133146 cd05479, RP_DDI, RP_DDI; retropepsin-like domain of DNA damage inducible protein. The family represents the retropepsin-like domain of DNA damage inducible protein. DNA damage inducible protein has a retropepsin-like domain and an amino-terminal ubiquitin-like domain and/or a UBA (ubiquitin-associated) domain. This CD represents the retropepsin-like domain of DDI. Length = 124 Score = 24.8 bits (55), Expect = 5.3 Identities = 9/21 (42%), Positives = 17/21 (80%), Gaps = 1/21 (4%) Query: 62 EFILGLDI-KRYPIMIDVKRD 81 +F++GLD+ KR+ +ID+K + Sbjct: 100 DFLIGLDMLKRHQCVIDLKEN 120 >gnl|CDD|37740 KOG2529, KOG2529, KOG2529, Pseudouridine synthase [Translation, ribosomal structure and biogenesis]. Length = 395 Score = 24.6 bits (53), Expect = 6.6 Identities = 10/35 (28%), Positives = 17/35 (48%) Query: 51 IGTVMVLIPKAEFILGLDIKRYPIMIDVKRDGEIR 85 + + L K E + G +R P++ VKR +R Sbjct: 142 VEDALKLHQKLEHLYGALFQRPPLISAVKRVLRVR 176 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.325 0.144 0.380 Gapped Lambda K H 0.267 0.0840 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,094,556 Number of extensions: 50937 Number of successful extensions: 265 Number of sequences better than 10.0: 1 Number of HSP's gapped: 265 Number of HSP's successfully gapped: 18 Length of query: 100 Length of database: 6,263,737 Length adjustment: 68 Effective length of query: 32 Effective length of database: 4,794,325 Effective search space: 153418400 Effective search space used: 153418400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (23.2 bits)