RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|255764502|ref|YP_003064963.2| hypothetical protein CLIBASIA_02185 [Candidatus Liberibacter asiaticus str. psy62] (100 letters) >gnl|CDD|180160 PRK05605, PRK05605, long-chain-fatty-acid--CoA ligase; Validated. Length = 573 Score = 26.1 bits (58), Expect = 2.0 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Query: 41 GLVLVL-FIILIGTVMVLIPKAEFILGLDI-KRYP 73 GL L L + IG +VL+P + L LD K++P Sbjct: 276 GLTLCLTLAVSIGGELVLLPAPDIDLILDAMKKHP 310 >gnl|CDD|181903 PRK09490, metH, B12-dependent methionine synthase; Provisional. Length = 1229 Score = 24.8 bits (55), Expect = 5.7 Identities = 8/10 (80%), Positives = 8/10 (80%) Query: 68 DIKRYPIMID 77 DI R PIMID Sbjct: 428 DIARVPIMID 437 >gnl|CDD|173552 PTZ00359, PTZ00359, hypothetical protein; Provisional. Length = 443 Score = 24.4 bits (53), Expect = 6.4 Identities = 6/17 (35%), Positives = 13/17 (76%) Query: 41 GLVLVLFIILIGTVMVL 57 G+ +LF++L+ T++ L Sbjct: 323 GIFALLFLLLVSTLIAL 339 >gnl|CDD|177997 PLN02369, PLN02369, ribose-phosphate pyrophosphokinase. Length = 302 Score = 24.3 bits (53), Expect = 6.7 Identities = 13/30 (43%), Positives = 18/30 (60%), Gaps = 6/30 (20%) Query: 63 FILGLDIKRYPIMIDVKR--DGEIRVQGQQ 90 LGL++ + I +KR DGEI VQ Q+ Sbjct: 9 CYLGLELGK----ITIKRFADGEIYVQLQE 34 >gnl|CDD|151015 pfam10438, Cyc-maltodext_C, Cyclo-malto-dextrinase C-terminal domain. This domain is at the very C-terminus of cyclo-malto-dextrinase proteins and consists of 8 beta strands, is largely globular and appears to help stabilize the acitve sites created by upstream domains, Cyc-maltodext_N pfam09087, and Alpha-amylase pfam00128. Cyclo-malto-dextrinases hydrolyse cyclodextrans to maltose and glucose and catalyse trans-glycosylation of oligosaccharides to the C3-, C4- or C6-hydroxyl groups of various acceptor sugar molecules. Length = 78 Score = 24.1 bits (53), Expect = 9.3 Identities = 12/43 (27%), Positives = 25/43 (58%) Query: 53 TVMVLIPKAEFILGLDIKRYPIMIDVKRDGEIRVQGQQVLLNE 95 TVMV++ K + + LD+KR+ ++ G+ + G+ + L + Sbjct: 22 TVMVILNKNDKEVTLDLKRFKEVLKGATSGKDILTGKTIDLGD 64 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.325 0.144 0.380 Gapped Lambda K H 0.267 0.0748 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,560,545 Number of extensions: 89029 Number of successful extensions: 349 Number of sequences better than 10.0: 1 Number of HSP's gapped: 348 Number of HSP's successfully gapped: 31 Length of query: 100 Length of database: 5,994,473 Length adjustment: 67 Effective length of query: 33 Effective length of database: 4,546,737 Effective search space: 150042321 Effective search space used: 150042321 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 50 (23.0 bits)