Query gi|255764503|ref|YP_003064954.2| hypothetical protein CLIBASIA_02140 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 44 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Sun May 29 22:24:15 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 255764503.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 KOG3498 consensus 52.1 12 0.00031 19.2 2.4 23 14-36 32-54 (67) 2 pfam06101 DUF946 Plant protein 43.5 4.4 0.00011 21.3 -0.9 12 26-37 335-346 (532) 3 KOG1638 consensus 22.9 49 0.0013 16.3 1.6 17 20-36 113-129 (257) 4 pfam06716 DUF1201 Protein of u 17.3 65 0.0016 15.7 1.2 14 19-32 8-21 (54) 5 TIGR02447 yiiD_Cterm thioester 14.8 1.2E+02 0.003 14.5 2.0 27 3-30 32-60 (141) 6 pfam09746 Membralin Tumour-ass 12.4 1.1E+02 0.0028 14.6 1.3 35 8-42 336-370 (375) 7 COG3489 Predicted periplasmic 11.7 1.3E+02 0.0034 14.2 1.6 18 12-29 1-18 (359) 8 PRK13461 F0F1 ATP synthase sub 11.3 1.6E+02 0.0041 13.8 2.9 35 1-36 1-35 (159) 9 COG3771 Predicted membrane pro 9.4 1.7E+02 0.0044 13.7 1.5 11 16-26 39-49 (97) 10 pfam12418 AcylCoA_DH_N Acyl-Co 8.7 1.5E+02 0.0037 14.0 0.9 17 3-19 5-21 (34) No 1 >KOG3498 consensus Probab=52.12 E-value=12 Score=19.24 Aligned_cols=23 Identities=43% Similarity=0.788 Sum_probs=19.6 Q ss_pred HHHHHHHHHHHHHHHHCHHHHHH Q ss_conf 67656899998989711021655 Q gi|255764503|r 14 EFFKISTLVAVGFLFCPFNGMFT 36 (44) Q Consensus 14 effkistlvavgflfcpfngmft 36 (44) ||-||+.-+|+||.+--|-|.|- T Consensus 32 Ef~ki~~~~aiGf~~mG~iGf~v 54 (67) T KOG3498 32 EFTKIAKATAIGFVIMGFIGFFV 54 (67) T ss_pred HHHHHHHHHHHHHHHHHHHHHHH T ss_conf 99999999988899998999999 No 2 >pfam06101 DUF946 Plant protein of unknown function (DUF946). This family consists of several hypothetical proteins from Arabidopsis thaliana and Oryza sativa. The function of this family is unknown. Probab=43.46 E-value=4.4 Score=21.34 Aligned_cols=12 Identities=58% Similarity=1.359 Sum_probs=8.9 Q ss_pred HHHHCHHHHHHH Q ss_conf 897110216556 Q gi|255764503|r 26 FLFCPFNGMFTL 37 (44) Q Consensus 26 flfcpfngmftl 37 (44) .+||||||--++ T Consensus 335 WvF~PFNGPa~~ 346 (532) T pfam06101 335 WIFCPFNGPARL 346 (532) T ss_pred EEECCCCCCCEE T ss_conf 998058988154 No 3 >KOG1638 consensus Probab=22.85 E-value=49 Score=16.29 Aligned_cols=17 Identities=35% Similarity=0.833 Sum_probs=14.0 Q ss_pred HHHHHHHHHHCHHHHHH Q ss_conf 99998989711021655 Q gi|255764503|r 20 TLVAVGFLFCPFNGMFT 36 (44) Q Consensus 20 tlvavgflfcpfngmft 36 (44) +.+|.++.||-+||+.. T Consensus 113 ~i~a~a~~F~~~NG~lq 129 (257) T KOG1638 113 IIVALAIAFCTLNGTLQ 129 (257) T ss_pred HHHHHHHHHHHHHHHHH T ss_conf 99999999998517999 No 4 >pfam06716 DUF1201 Protein of unknown function (DUF1201). This family consists of several Sugar beet yellow virus (SBYV) putative membrane-binding proteins of around 54 residues in length. The function of this family is unknown. Probab=17.27 E-value=65 Score=15.73 Aligned_cols=14 Identities=50% Similarity=0.878 Sum_probs=10.1 Q ss_pred HHHHHHHHHHHCHH Q ss_conf 89999898971102 Q gi|255764503|r 19 STLVAVGFLFCPFN 32 (44) Q Consensus 19 stlvavgflfcpfn 32 (44) --|.|.|||.|-|- T Consensus 8 ylllafgfliclfl 21 (54) T pfam06716 8 YLLLAFGFLICLFL 21 (54) T ss_pred HHHHHHHHHHHHHH T ss_conf 99999999999999 No 5 >TIGR02447 yiiD_Cterm thioesterase domain, putative; InterPro: IPR012660 This entry consists of a broadly distributed uncharacterised domain found often as a standalone protein. The member from Shewanella oneidensis is described from crystallography work as a putative thioesterase. About half of the members of this family are fused to an Acetyltransf_1 domain (PF00583). The function of this protein is unknown. . Probab=14.79 E-value=1.2e+02 Score=14.47 Aligned_cols=27 Identities=33% Similarity=0.605 Sum_probs=20.9 Q ss_pred CCCCHHHHHHH--HHHHHHHHHHHHHHHHC Q ss_conf 23474563366--67656899998989711 Q gi|255764503|r 3 INVNDKEFQMF--EFFKISTLVAVGFLFCP 30 (44) Q Consensus 3 invndkefqmf--effkistlvavgflfcp 30 (44) -|+|+|++ || -.|-+.||.+=|+|+-- T Consensus 32 ~N~N~~~T-~FgGSl~~~atL~gWGll~L~ 60 (141) T TIGR02447 32 ANLNHKGT-MFGGSLYSLATLSGWGLLWLR 60 (141) T ss_pred CCCCCCCC-CCHHHHHHHHHHHHHHHHHHH T ss_conf 48885212-037789999998766999999 No 6 >pfam09746 Membralin Tumour-associated protein. Membralin is evolutionarily highly conserved; though it seems to represent a unique protein family. The protein appears to contain several transmembrane regions. In humans it is expressed in certain cancers, particularly ovarian cancers. Probab=12.35 E-value=1.1e+02 Score=14.59 Aligned_cols=35 Identities=29% Similarity=0.224 Sum_probs=17.3 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHCC Q ss_conf 56336667656899998989711021655644001 Q gi|255764503|r 8 KEFQMFEFFKISTLVAVGFLFCPFNGMFTLIESHT 42 (44) Q Consensus 8 kefqmfeffkistlvavgflfcpfngmftliesht 42 (44) -|+-|+|||.-+|+.---.|..-.-..|+.|-+|| T Consensus 336 me~imsEff~D~~tafyvilivw~~d~y~~i~~~t 370 (375) T pfam09746 336 MEAIMSEFFNDTTTAFYIILIVWIADQYDAICCHT 370 (375) T ss_pred HHHHHHHHHCCCHHHHHHHHHHHHHHHHCEEEECC T ss_conf 99999998478425789999999975203355336 No 7 >COG3489 Predicted periplasmic lipoprotein [General function prediction only] Probab=11.74 E-value=1.3e+02 Score=14.19 Aligned_cols=18 Identities=39% Similarity=0.587 Sum_probs=15.2 Q ss_pred HHHHHHHHHHHHHHHHHH Q ss_conf 666765689999898971 Q gi|255764503|r 12 MFEFFKISTLVAVGFLFC 29 (44) Q Consensus 12 mfeffkistlvavgflfc 29 (44) ||.+-|++|+.+|+.|+| T Consensus 1 ~~~~~~l~~vLav~Ll~~ 18 (359) T COG3489 1 MFRMRKLVTVLAVALLAA 18 (359) T ss_pred CCCHHHHHHHHHHHHHHC T ss_conf 964678889999999832 No 8 >PRK13461 F0F1 ATP synthase subunit B; Provisional Probab=11.29 E-value=1.6e+02 Score=13.80 Aligned_cols=35 Identities=20% Similarity=0.397 Sum_probs=24.6 Q ss_pred CCCCCCHHHHHHHHHHHHHHHHHHHHHHHCHHHHHH Q ss_conf 952347456336667656899998989711021655 Q gi|255764503|r 1 MDINVNDKEFQMFEFFKISTLVAVGFLFCPFNGMFT 36 (44) Q Consensus 1 mdinvndkefqmfeffkistlvavgflfcpfngmft 36 (44) |+||+..--+|+.-|+-. -++-.-|++-|+.+++. T Consensus 1 m~in~~t~i~q~inF~il-~~il~kf~~~pi~~~l~ 35 (159) T PRK13461 1 MEINIPTIIATIINFIIL-LLILKHFFFDKIKAVID 35 (159) T ss_pred CCCCHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHH T ss_conf 978599999999999999-99999997888999999 No 9 >COG3771 Predicted membrane protein [Function unknown] Probab=9.42 E-value=1.7e+02 Score=13.67 Aligned_cols=11 Identities=55% Similarity=0.848 Sum_probs=7.6 Q ss_pred HHHHHHHHHHH Q ss_conf 65689999898 Q gi|255764503|r 16 FKISTLVAVGF 26 (44) Q Consensus 16 fkistlvavgf 26 (44) |.+|||+|+-| T Consensus 39 f~LSTLla~lF 49 (97) T COG3771 39 FRLSTLLATLF 49 (97) T ss_pred HHHHHHHHHHH T ss_conf 02999999999 No 10 >pfam12418 AcylCoA_DH_N Acyl-CoA dehydrogenase N terminal. This domain family is found in bacteria and eukaryotes, and is approximately 30 amino acids in length. The family is found in association with pfam02770, pfam00441, pfam02771. This family is one of the enzymes involved in AcylCoA interaction in beta-oxidation. Probab=8.68 E-value=1.5e+02 Score=14.03 Aligned_cols=17 Identities=18% Similarity=0.530 Sum_probs=0.0 Q ss_pred CCCCHHHHHHHHHHHHH Q ss_conf 23474563366676568 Q gi|255764503|r 3 INVNDKEFQMFEFFKIS 19 (44) Q Consensus 3 invndkefqmfeffkis 19 (44) .++.|-.|.++|.+++. T Consensus 5 ap~rD~~FvL~Evl~~e 21 (34) T pfam12418 5 APLRDMRFVLYEVLDLD 21 (34) T ss_pred CCHHHHHHHHHHHHCCH T ss_conf 40788999999998318 Done!