HHsearch alignment of GI: 255764504 and MMDB domain: 2c7p_A_193-274

>2c7p_A (A:193-274) Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus}
Probab=98.03  E-value=6e-07  Score=60.20  Aligned_cols=61  Identities=21%  Similarity=0.201  Sum_probs=40.5

Q ss_pred             HHCCCCCCCCEEEEEEEECC-CCCCCCCCCCCCCCCHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCEEECC
Q ss_conf             43579737627999998478-88755888777777844531256774323468899889978765553201355204348
Q gi|255764504|r    4 CDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFE   82 (101)
Q Consensus         4 ~dfGvPQ~ReRvfiVg~~~~-~~~f~~P~~~~~~~~l~diL~~~vd~k~~ls~~~~~~l~~~~~~~k~~g~GFg~~~~~~   82 (101)
                      +||||||+||||||||-.+. .....||........++.+-.                            .|=| ..++.
T Consensus         1 KdfgvpqnreRvfiIgh~r~~~~~~vfp~~~~~~~~ig~in~----------------------------ggQG-~RVYs   51 (82)
T 2c7p_A            1 KDLLLPDSEVEHLVIDRKDLVMTNQEIEQTTPKTVRLGIVGK----------------------------GGQG-ERIYS   51 (82)
T ss_dssp             GGTCCCGGGTGGGEECCTTCEECSCCCSSCCSSCCEEEESTT----------------------------CCTT-CEEEE
T ss_pred             CCCCCCCCCHHHHCCCCCCCHHHHHHHHCCCCHHHHHCCCCC----------------------------CCCC-CCCCC
T ss_conf             320002331122124532200000022203513332010367----------------------------8887-74545


Q ss_pred             CCCCCCCEEEC
Q ss_conf             87750330104
Q gi|255764504|r   83 NSATTNTLSAR   93 (101)
Q Consensus        83 ~~~~~~Ti~ar   93 (101)
                      .+..|.||+|.
T Consensus        52 ~~Gia~TLta~   62 (82)
T 2c7p_A           52 TRGIAITLSAY   62 (82)
T ss_dssp             TTSCBCCCCSS
T ss_pred             CCCCCCCCCCC
T ss_conf             65565301146