HHsearch alignment of GI: 255764504 and MMDB domain: 2pv0_B_182-386

>2pv0_B (B:182-386) DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B*
Probab=98.30  E-value=3.6e-08  Score=67.13  Aligned_cols=45  Identities=9%  Similarity=-0.228  Sum_probs=32.8

Q ss_pred             CCHHHCCCCCCCCEEEEEEEECCCCCCCCCC--CCCCCCCHHHHHCCC
Q ss_conf             9834357973762799999847888755888--777777844531256
Q gi|255764504|r    1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPT--PLGIKPRLGDILEEH   46 (101)
Q Consensus         1 Lna~dfGvPQ~ReRvfiVg~~~~~~~f~~P~--~~~~~~~l~diL~~~   46 (101)
                      |||++|||||+|+|+|+||.+++. .+.+|.  ......++.++|.+.
T Consensus       128 l~a~~~G~pQ~R~R~~~i~~~~~~-~~~~~~~~~~~~~~~~~~~~~~l  174 (205)
T 2pv0_B          128 IPDVHGGSLQNAVRVWSNIPAIRS-RHWALVSEEELSLLAQNKQSSKL  174 (205)
T ss_dssp             EECCCSSSCCCEEEEEECSSSSST-TCCTTSCHHHHHHHHHHHSSSSC
T ss_pred             EECCCCCCCCCEEEEEECCCCCCC-CCCCCCCCCCHHHHHHHHHHCCC
T ss_conf             646546665620799807767455-67898763302267777753136