HHsearch results for GI: 255764504 and protein with PDBid: 3g7u_A

>3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural genomics, protein structure initiative, PSI; 1.75A {Escherichia coli O157}
Probab=98.91  E-value=9.4e-10  Score=75.28  Aligned_cols=45  Identities=24%  Similarity=0.349  Sum_probs=31.6

Q ss_pred             CCHHHCCCCCCCCEEEEEEEECCCC-CC---CCCCCCCCCCCHHHHHCC
Q ss_conf             9834357973762799999847888-75---588877777784453125
Q gi|255764504|r    1 MKACDFGVPQRRERLYIIDFLNPSV-EF---KFPTPLGIKPRLGDILEE   45 (101)
Q Consensus         1 Lna~dfGvPQ~ReRvfiVg~~~~~~-~f---~~P~~~~~~~~l~diL~~   45 (101)
                      |||+||||||+|+|+||||++++.. .+   .++.......++.++|.+
T Consensus       151 l~a~~~GvPQ~R~Rvfivg~r~~~~~~~~~~~~~~~~~~~~t~~dai~~  199 (376)
T 3g7u_A          151 VKASDYGAPTIRTRYFFIGVKKSLKLDISDEVFMPKMIDPVTVKDALYG  199 (376)
T ss_dssp             EEGGGGTCSBCCEEEEEEEEEGGGCCCCCGGGTSCCSCCCCCHHHHTTT
T ss_pred             EEHHHCCCCCEECHHHCEEECCCCCCCCCCCCCCCCCCCCCCHHHHHCC
T ss_conf             7799959851033000000115777777742247544567739997505