HHsearch results for GI: 255764504 and protein with PDBid: 3me5_A

>3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A
Probab=99.74  E-value=3.1e-18  Score=123.61  Aligned_cols=99  Identities=32%  Similarity=0.592  Sum_probs=82.6

Q ss_pred             HHHCCCCCCCCEEEEEEEECCCC-CCCC--CCC----CCCCCCHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             34357973762799999847888-7558--887----7777784453125677432346889988997876555320135
Q gi|255764504|r    3 ACDFGVPQRRERLYIIDFLNPSV-EFKF--PTP----LGIKPRLGDILEEHIDDKSTISNKLWEGHQKRKENNKIAGKGF   75 (101)
Q Consensus         3 a~dfGvPQ~ReRvfiVg~~~~~~-~f~~--P~~----~~~~~~l~diL~~~vd~k~~ls~~~~~~l~~~~~~~k~~g~GF   75 (101)
                      +++|||||+|+|+||||++++.. .+.|  ++.    ........++|++.++.++++++.+|.++.++..++..++++|
T Consensus       269 ~a~yGVPQ~R~RvfiVG~r~dl~~~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  348 (482)
T 3me5_A          269 DGKHFLPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPVLWKYLYRYAKKHQARGNGF  348 (482)
T ss_dssp             EGGGTSSBCCEEEEEEEEEGGGCCCTTCCGGGGGGGSCSSCCCTGGGSCSSCCGGGBCCHHHHHHHHHHHHC--------
T ss_pred             CCCCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCC
T ss_conf             01137996677405884435767666767666554576533332223574112223567113456777877644205776


Q ss_pred             CCEEECCCC--CCCCCEEECCCCCCCCC
Q ss_conf             520434887--75033010403587639
Q gi|255764504|r   76 GYGLFFENS--ATTNTLSARYYKDGSEI  101 (101)
Q Consensus        76 g~~~~~~~~--~~~~Ti~arY~Kdg~e~  101 (101)
                      ++.++.++.  .+++|+++||+|||+++
T Consensus       349 ~~~~~~~~~~~~~~~t~~~r~~k~~~~~  376 (482)
T 3me5_A          349 GYGMVYPNNPQSVTRTLSARYYKDGAEI  376 (482)
T ss_dssp             --CEECTTSGGGGTCCBCCC---CCSSS
T ss_pred             CCCEECCCCCCCCCCCCCCEECCCCCCC
T ss_conf             7530037885344621033113799753