HHSEARCH alignment of GI: 255764504 and SCOP domain: d1g55a_

Alignment
>d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]}
Probab=98.97  E-value=2e-10  Score=77.72  Aligned_cols=57  Identities=25%  Similarity=0.415  Sum_probs=37.7

Q ss_pred             CCHHHCCCCCCCCEEEEEEEECCC-CCCCCCCCCC------------------CCCCHHHHHCCCCCC-CCCCCHHH
Q ss_conf             983435797376279999984788-8755888777------------------777844531256774-32346889
Q gi|255764504|r    1 MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLG------------------IKPRLGDILEEHIDD-KSTISNKL   57 (101)
Q Consensus         1 Lna~dfGvPQ~ReRvfiVg~~~~~-~~f~~P~~~~------------------~~~~l~diL~~~vd~-k~~ls~~~   57 (101)
                      |||+||||||+|+|+||||++++. ..|.+|....                  ....+.++|++.++. ++.++.+.
T Consensus       148 lna~dyGvPQ~R~Rvfivg~r~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~  224 (343)
T d1g55a_         148 LSPTSLGIPNSRLRYFLIAKLQSEPLPFQAPGQVLMEFPKIEIHRKNQQDSDLSVKMLKDFLEDDTDVNQYLLPPKS  224 (343)
T ss_dssp             ECGGGGTCSCCCCEEEEEEEESSSCCTTCCTTCEESSCCC------------CCCCCGGGGCCTTCCHHHHBCCHHH
T ss_pred             EECCCCCCCCCCEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHCCCCCCHHHCCCCHHH
T ss_conf             30134687645203899998278666678863113467732001244445655554245430456641220367176


SCOP domain information

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: C5 cytosine-specific DNA methylase, DCM
domain: DNMT2
species: Human (Homo sapiens) [TaxId: 9606]